metagRoot

F470387

General Info

Members	Datasets	Scaffolds	Average Seq Length
625	323	498	218

Family's Representative Sequence

Representative Sequence	3300046507\|Ga0495606_0036726\|Ga0495606_0036726_2335_3060
Length	241
Sequence	VWPGFTLHSGKLKKNDNMKFFIDTANLAQIKEAHELGVLDGVTTNPSLMAKEGITGHDNIINHYKAICEITDGDVSAEVNATTYDEMIAEGEALAALHPRIVVKLPMIKDGVKAARYFSEKGIKTNVTLVFSVGQALLAAKAGATYVSPFIGRLDDISTDGLALIEEIRLVYDNYGYETQILAASVRHGMHIINCAKLGADVMTGPLSAITALLKHTLTDIGLAQFIADYNNAAAKNNELV

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2209111006	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1	Metagenome	Rhizosphere
3	2511231000	Chryseobacterium populi CF314	Isolate	Rhizosphere
4	2513020052	Flavobacterium sp. CF136	Isolate	Rhizosphere
5	2519899754	Flavobacterium sp. F52	Isolate	Rhizosphere
6	2522125168	Dyadobacter beijingensis DSM 21582	Isolate	Rhizosphere
7	2523533629	Kaistella palustris DSM 21579	Isolate	Rhizosphere
8	2582581281	Chryseobacterium sp. CF284	Isolate	Rhizosphere
9	2582581282	Chryseobacterium sp. CF299	Isolate	Rhizosphere
10	2585427687	Pedobacter borealis DSM 19626	Isolate	Rhizosphere
11	2585428184	Chryseobacterium sp. YR480	Isolate	Rhizosphere
12	2585428187	Chryseobacterium sp. YR460	Isolate	Rhizosphere
13	2599185184	Mucilaginibacter sp. NFR10	Isolate	Rhizoplane
14	2643221600	Flavobacterium sp. Root186	Isolate	Unclassified
15	2643221667	Flavobacterium sp. Root420	Isolate	Unclassified
16	2643221716	Flavobacterium sp. Root901	Isolate	Unclassified
17	2643221725	Flavobacterium sp. Root935	Isolate	Unclassified
18	2721755487	Sphingobacterium sp. B29	Isolate	Rhizosphere
19	2738541273	Elizabethkingia sp. YR214	Isolate	Unclassified
20	2738541279	Flavobacterium sp. GV069	Isolate	Unclassified
21	2738541283	Pedobacter sp. OK701	Isolate	Unclassified
22	2738541284	Pedobacter sp. YR016	Isolate	Unclassified
23	2738541285	Flavobacterium sp. GV030	Isolate	Unclassified
24	2738541302	Pedobacter sp. CF074	Isolate	Unclassified
25	2738543007	Flavobacterium sp. GV063	Isolate	Unclassified
26	2738543014	Elizabethkingia sp. YR191	Isolate	Unclassified
27	2738543023	Pedobacter sp. OK628	Isolate	Unclassified
28	2739367651	Pedobacter sp. OK291	Isolate	Unclassified
29	2739367656	Pedobacter sp. CF523	Isolate	Unclassified
30	2739367663	Pedobacter sp. YR510	Isolate	Unclassified
31	2739367857	Flavobacterium sp. GV029	Isolate	Unclassified
32	2739367858	Flavobacterium sp. GV028	Isolate	Unclassified
33	2772190705	Chryseobacterium contaminans C-26	Isolate	Rhizosphere
34	2775506739	Chryseobacterium sp. 1335	Isolate	Unclassified
35	2775506987	Pedobacter ginsengisoli T01R-27	Isolate	Unclassified
36	2802428842	Flavobacterium sp. S87F.05.LMB.W.Kidney.N	Isolate	Unclassified
37	2816332280	Flavobacterium johnsoniae GSE09	Isolate	Unclassified
38	2818991437	Pedobacter terrae 518	Isolate	Unclassified
39	2833640130	Mariniflexile sp. TRM1-10	Isolate	Rhizosphere
40	2842083920	Chryseobacterium lathyri KCTC 22544	Isolate	Rhizosphere
41	2842722452	Pedobacter sp. R-72249	Isolate	Unclassified
42	2842903701	Olivibacter sp. R-72191	Isolate	Unclassified
43	2842909656	Pedobacter sp. R-72393	Isolate	Unclassified
44	2849281842	Pedobacter sp. AK013	Isolate	Rhizosphere
45	2852627209	Pedobacter sp. AK017	Isolate	Rhizosphere
46	2857613821	Flavobacterium sp. R-72247	Isolate	Unclassified
47	2857618242	Flavobacterium sp. R-74482	Isolate	Unclassified
48	2857627736	Pedobacter sp. R-74587	Isolate	Unclassified
49	2881247448	Flavobacterium beibuense RSKm HC5	Isolate	Rhizosphere
50	2881359912	Flavobacterium ustbae T13	Isolate	Rhizosphere
51	2884634485	Algoriphagus kandeliae XY-J91	Isolate	Unclassified
52	2890737413	Parapedobacter sp. SGR-10	Isolate	Rhizosphere
53	2890804823	Fluviicola sp. SGL-29	Isolate	Rhizosphere
54	2895498888	Pseudoxanthomonas sp. SGD-10	Isolate	Rhizosphere
55	2896344016	Sphingobacterium sp. SGL-16	Isolate	Rhizosphere
56	2898713307	Sphingobacterium sp. SGG-5	Isolate	Rhizosphere
57	2902048731	Pedobacter ureilyticus THG-T11	Isolate	Rhizosphere
58	2903895155	Flavobacterium sp. HBTb2-11-1	Isolate	Rhizosphere
59	2904419702	Flavobacterium sp. 1355	Isolate	Rhizosphere
60	2904445276	Pedobacter terrae 1734	Isolate	Rhizosphere
61	2904555929	Flavobacterium sp. 1750	Isolate	Rhizosphere
62	2904780799	Sphingobacterium sp. 1304	Isolate	Rhizosphere
63	2905999023	Chryseobacterium elymi KCTC 22547	Isolate	Rhizosphere
64	2911138879	Spirosoma sp. KUDC1026	Isolate	Rhizosphere
65	2919097161	Chryseobacterium ginsenosidimutans 1394	Isolate	Rhizosphere
66	2919177583	Sphingobacterium sp. 2149	Isolate	Rhizosphere
67	2919186247	Pedobacter africanus 2697	Isolate	Rhizosphere
68	2919191525	Flavobacterium sp. 2755	Isolate	Rhizosphere
69	2919509842	Flavobacterium arsenatis 3773	Isolate	Unclassified
70	2919683626	Flavobacterium piscis 4129	Isolate	Unclassified
71	2919692658	Algoriphagus sp. 4150	Isolate	Rhizosphere
72	2928078545	Mucilaginibacter rubeus 1215	Isolate	Unclassified
73	2928147474	Mucilaginibacter rubeus 2025	Isolate	Unclassified
74	2929150217	Flavobacterium sp. R-74510 Hybrid assembly	Isolate	Unclassified
75	2932082852	Mucilaginibacter sp. 3215	Isolate	Rhizosphere
76	2939664404	Pedobacter africanus 2990	Isolate	Rhizosphere
77	2945924605	Chryseobacterium ginsenosidimutans W1I9	Isolate	Rhizosphere
78	2945997725	Pedobacter sp. W3I1	Isolate	Rhizosphere
79	2946019816	Chryseobacterium sp. W4I1	Isolate	Rhizosphere
80	2954016120	Flavobacterium sp. W4I14	Isolate	Rhizosphere
81	2958458903	Flavobacterium anhuiense RCM74	Isolate	Rhizosphere
82	2958512119	Flavobacterium sp. Sd200	Isolate	Rhizosphere
83	2965320100	Flavobacterium agri MAH-1	Isolate	Rhizosphere
84	2977232053	Mucilaginibacter terrae SORGH_AS 422	Isolate	Unclassified
85	2977243572	Chryseobacterium sp. SORGH_AS 447	Isolate	Unclassified
86	2977268062	Flavobacterium sp. SORGH_AS 622	Isolate	Unclassified
87	3003233435	Sphingobacterium shayense CrR18	Isolate	Unclassified
88	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
89	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
90	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
91	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
92	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
93	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
94	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
95	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
96	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
97	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
98	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
99	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
100	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
101	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
102	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
103	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
104	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
105	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
106	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
107	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
108	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
109	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
110	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
111	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
112	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
113	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
114	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
115	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
116	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
117	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
118	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
119	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
120	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
121	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
122	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
123	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
124	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
125	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
126	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
127	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
128	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
129	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
130	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
131	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
132	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
133	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
134	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
135	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
136	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
137	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
138	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
139	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
140	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
141	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
142	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
143	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
144	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
145	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
146	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
147	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
148	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
149	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
150	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
151	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
152	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
153	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
154	3300015682	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01	Metagenome	Rhizosphere
155	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
156	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
157	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
158	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
159	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
160	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
161	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
162	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
163	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
188	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
189	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
191	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
193	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
194	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
195	3300030734	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5	Metagenome	Rhizosphere
196	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
197	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
198	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
199	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
200	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
201	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
202	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
203	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
204	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
205	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
206	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
207	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
208	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
209	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
210	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
211	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
212	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
213	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
214	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
215	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
216	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
217	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
218	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
219	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
220	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
221	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
222	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
223	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
224	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
225	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
226	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
227	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
228	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
229	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
230	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
231	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
232	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
233	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
234	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
235	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
236	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
237	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
238	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
239	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
240	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
241	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
242	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
243	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
244	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
245	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
246	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
247	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
248	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
249	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
250	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
251	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
252	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
253	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
254	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
255	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
256	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
257	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
258	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
259	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
260	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
261	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
262	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
263	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
264	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
265	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
266	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
267	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
268	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
269	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
270	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
271	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
272	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
273	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
274	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
275	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
276	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
277	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
278	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
279	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
280	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
281	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
282	3300049130	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
283	3300049161	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
284	3300049528	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
285	3300049531	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
286	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
287	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
288	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
289	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
290	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
291	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
292	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
293	3300049671	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought	Metagenome	Rhizosphere
294	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
295	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
296	3300049763	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control	Metagenome	Rhizosphere
297	3300049766	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought	Metagenome	Rhizosphere
298	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
299	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
300	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
301	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
302	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
303	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
304	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
305	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
306	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
307	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
308	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
309	3300059493	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
310	3300059510	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
311	3300059607	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
312	3300059623	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
313	3300059630	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
314	3300059639	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
315	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
316	3300059652	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
317	3300059660	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
318	8036736890	Flavobacterium dauae TCH3-2	Isolate	Rhizosphere
319	8054307821	Flavobacterium soyae SCIV07	Isolate	Rhizosphere
320	8055419101	Flavobacterium tyrosinilyticum KCTC 42726	Isolate	Rhizosphere
321	8055588893	Parapedobacter lycopersici KACC 18788	Isolate	Rhizosphere
322	8055592153	Flavobacterium panacis DCY106	Isolate	Rhizosphere
323	8056440228	Flavobacterium hibisci THG-HG1.4	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	77.28
Metatranscriptomes	2.4
Isolates	20.32

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	6.4
Nodule	1.92
Rhizoplane	0.8
Rhizosphere	72.64
Stem	0
Stem Tuber	0
Unclassified	18.24

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_199439	2162886007	Bacteria	1681
2	SwRhRL2b_contig_2067937	2162886007	Bacteria	2745
3	SwRhRL2b_contig_353992	2162886007	Bacteria	1067
4	SwRhRL2b_contig_894088	2162886007	Bacteria	27247
5	2214769932	2209111006	Bacteria	800
6	JGI24736J21556_1003056	3300001904	Bacteria	2925
7	JGI24740J21852_10006988	3300001979	Bacteria	4628
8	JGI24740J21852_10021175	3300001979	Bacteria	2257
9	JGI24737J22298_10002517	3300001990	Bacteria	6509
10	JGI24743J22301_10013059	3300001991	Bacteria	1519
11	JGI24735J21928_10000009	3300002067	Bacteria	247425
12	JGI25152J39213_1000168	3300002773	Bacteria	44576
13	JGI25150J39212_1000019	3300002774	Bacteria	135244
14	JGI25151J46595_10000074	3300003187	Bacteria	135244
15	JGI25153J46596_10000056	3300003215	Bacteria	135244
16	rootH1_10014551	3300003316	Bacteria	7033
17	rootH1_10150855	3300003316	Bacteria	1358
18	rootH2_10323525	3300003320	Bacteria	1597
19	rootL2_10119979	3300003322	Bacteria	2243
20	rootL2_10196648	3300003322	Bacteria	2304
21	rootH1_10236234	3300003323	Bacteria	1457
22	Ga0055536_1000011	3300003781	Bacteria	275969
23	Ga0055536_1011069	3300003781	Bacteria	3505
24	Ga0055530_10003989	3300003791	Bacteria	7960
25	Ga0065165_1000088	3300005262	Bacteria	152328
26	Ga0065714_10002530	3300005288	Bacteria	17684
27	Ga0065714_10007539	3300005288	Bacteria	2832
28	Ga0065714_10008739	3300005288	Bacteria	3418
29	Ga0065714_10012314	3300005288	Bacteria	2229
30	Ga0065714_10064466	3300005288	Bacteria	64823
31	Ga0065714_10064658	3300005288	Bacteria	25359
32	Ga0065714_10074656	3300005288	Bacteria	3007
33	Ga0065714_10147024	3300005288	Bacteria	1130
34	Ga0065714_10162550	3300005288	Bacteria	1040
35	Ga0065714_10251520	3300005288	Bacteria	774
36	Ga0065704_10072241	3300005289	Bacteria	8886
37	Ga0065704_10079406	3300005289	Bacteria	4173
38	Ga0065704_10092569	3300005289	Bacteria	2646
39	Ga0065704_10142322	3300005289	Bacteria	1506
40	Ga0065715_10028855	3300005293	Bacteria	1519
41	Ga0065715_10049471	3300005293	Bacteria	1171
42	Ga0065715_10187743	3300005293	Bacteria	1434
43	Ga0065715_10195448	3300005293	Bacteria	1381
44	Ga0065715_10206601	3300005293	Bacteria	1334
45	Ga0065715_10215905	3300005293	Bacteria	1293
46	Ga0065715_10221700	3300005293	Bacteria	1269
47	Ga0065715_10293911	3300005293	Bacteria	1044
48	Ga0065715_10306263	3300005293	Bacteria	1030
49	Ga0070676_10007023	3300005328	Bacteria	6028
50	Ga0070682_100153939	3300005337	Bacteria	1581
51	Ga0070660_100242664	3300005339	Bacteria	1468
52	Ga0070671_100001609	3300005355	Bacteria	17019
53	Ga0070673_100053415	3300005364	Bacteria	3173
54	Ga0070659_100074341	3300005366	Bacteria	2707
55	Ga0070659_100267196	3300005366	Bacteria	1420
56	Ga0070663_100002555	3300005455	Bacteria	10276
57	Ga0070663_100014118	3300005455	Bacteria	5120
58	Ga0070678_100003450	3300005456	Bacteria	8816
59	Ga0070662_100000020	3300005457	Bacteria	99425
60	Ga0068867_100000368	3300005459	Bacteria	30054
61	Ga0070696_100273002	3300005546	Bacteria	1286
62	Ga0068855_100001312	3300005563	Bacteria	30806
63	Ga0068855_100176200	3300005563	Bacteria	2420
64	Ga0068855_100526242	3300005563	Bacteria	1282
65	Ga0068854_100636527	3300005578	Bacteria	914
66	Ga0068852_100001179	3300005616	Bacteria	17313
67	Ga0068852_101197970	3300005616	Bacteria	780
68	Ga0068851_10000485	3300005834	Bacteria	17424
69	Ga0075366_10092570	3300006195	Bacteria	1811
70	Ga0097621_100001107	3300006237	Bacteria	18818
71	Ga0068871_100000296	3300006358	Bacteria	34815
72	Ga0068865_100000025	3300006881	Bacteria	94590
73	Ga0099824_1001653	3300006942	Bacteria	31742
74	Ga0099824_1008461	3300006942	Bacteria	13146
75	Ga0079104_1000057	3300006946	Bacteria	165780
76	Ga0079104_1000691	3300006946	Bacteria	30800
77	Ga0099826_10003267	3300006948	Bacteria	10938
78	Ga0099826_10007426	3300006948	Bacteria	8096
79	Ga0105251_10036564	3300009011	Bacteria	2415
80	Ga0105244_10000054	3300009036	Bacteria	133715
81	Ga0105244_10000292	3300009036	Bacteria	49061
82	Ga0105244_10161526	3300009036	Bacteria	1070
83	Ga0105250_10041760	3300009092	Bacteria	1838
84	Ga0105240_10009423	3300009093	Bacteria	13819
85	Ga0105243_10000078	3300009148	Bacteria	110329
86	Ga0105241_10000134	3300009174	Bacteria	53667
87	Ga0105241_10022208	3300009174	Bacteria	4698
88	Ga0105242_10044003	3300009176	Bacteria	3613
89	Ga0105242_11262140	3300009176	Bacteria	761
90	Ga0105237_10002672	3300009545	Bacteria	21880
91	Ga0105238_10006366	3300009551	Bacteria	11742
92	Ga0105249_10336522	3300009553	Bacteria	1525
93	Ga0105239_10089819	3300010375	Bacteria	3388
94	Ga0105239_10232884	3300010375	Bacteria	2067
95	Ga0105239_10842826	3300010375	Bacteria	1051
96	Ga0157373_10000001	3300013100	Bacteria	864756
97	Ga0157373_10000041	3300013100	Bacteria	113871
98	Ga0157373_10001036	3300013100	Bacteria	21414
99	Ga0157373_10024277	3300013100	Bacteria	4393
100	Ga0157373_10025511	3300013100	Bacteria	4274
101	Ga0157373_10043927	3300013100	Bacteria	3191
102	Ga0157371_10000037	3300013102	Bacteria	214866
103	Ga0157371_10000096	3300013102	Bacteria	135954
104	Ga0157371_10000139	3300013102	Bacteria	104697
105	Ga0157371_10000293	3300013102	Bacteria	67201
106	Ga0157371_10001078	3300013102	Bacteria	29528
107	Ga0157371_10002388	3300013102	Bacteria	17967
108	Ga0157371_10004696	3300013102	Bacteria	11804
109	Ga0157371_10029576	3300013102	Bacteria	3959
110	Ga0157371_10089927	3300013102	Bacteria	2175
111	Ga0157371_10150674	3300013102	Bacteria	1658
112	Ga0157370_10000225	3300013104	Bacteria	71924
113	Ga0157370_10000403	3300013104	Bacteria	54542
114	Ga0157370_10000410	3300013104	Bacteria	54091
115	Ga0157370_10000920	3300013104	Bacteria	37348
116	Ga0157370_10002406	3300013104	Bacteria	22561
117	Ga0157370_10003175	3300013104	Bacteria	19440
118	Ga0157370_10010888	3300013104	Bacteria	9552
119	Ga0157370_10012871	3300013104	Bacteria	8649
120	Ga0157370_10013752	3300013104	Bacteria	8318
121	Ga0157370_10048147	3300013104	Bacteria	4084
122	Ga0157370_10049479	3300013104	Bacteria	4022
123	Ga0157370_10077526	3300013104	Bacteria	3131
124	Ga0157370_10095744	3300013104	Bacteria	2785
125	Ga0157370_10206843	3300013104	Bacteria	1820
126	Ga0157370_10285892	3300013104	Bacteria	1523
127	Ga0157370_10298094	3300013104	Bacteria	1488
128	Ga0157370_10695617	3300013104	Bacteria	928
129	Ga0157370_10850014	3300013104	Bacteria	829
130	Ga0157370_10947030	3300013104	Bacteria	780
131	Ga0157369_10000403	3300013105	Bacteria	57592
132	Ga0157369_10000460	3300013105	Bacteria	54042
133	Ga0157369_10002088	3300013105	Bacteria	24155
134	Ga0157369_10003046	3300013105	Bacteria	20005
135	Ga0157369_10003300	3300013105	Bacteria	19193
136	Ga0157369_10005143	3300013105	Bacteria	15313
137	Ga0157369_10009389	3300013105	Bacteria	11185
138	Ga0157369_10015002	3300013105	Bacteria	8745
139	Ga0157369_10191324	3300013105	Bacteria	2150
140	Ga0157369_10441462	3300013105	Bacteria	1348
141	Ga0157374_10000079	3300013296	Bacteria	95883
142	Ga0157374_10003573	3300013296	Bacteria	13089
143	Ga0157378_10042927	3300013297	Bacteria	4015
144	Ga0163162_10002617	3300013306	Bacteria	17074
145	Ga0163162_10009170	3300013306	Bacteria	9627
146	Ga0163162_10093289	3300013306	Bacteria	3095
147	Ga0163162_10813454	3300013306	Bacteria	1051
148	Ga0157372_10000009	3300013307	Bacteria	302051
149	Ga0157372_10044891	3300013307	Bacteria	4898
150	Ga0157372_10066698	3300013307	Bacteria	4043
151	Ga0157372_10253771	3300013307	Bacteria	2042
152	Ga0157375_10000052	3300013308	Bacteria	130032
153	Ga0157375_10044604	3300013308	Bacteria	4309
154	Ga0157375_10096334	3300013308	Bacteria	3031
155	Ga0157375_10122208	3300013308	Bacteria	2715
156	Ga0157375_10145232	3300013308	Bacteria	2503
157	Ga0157375_10391007	3300013308	Bacteria	1557
158	Ga0157375_10840481	3300013308	Bacteria	1065
159	Ga0157380_10000106	3300014326	Bacteria	45671
160	Ga0182008_10000001	3300014497	Bacteria	540790
161	Ga0182008_10000540	3300014497	Bacteria	28126
162	Ga0182008_10004022	3300014497	Bacteria	8684
163	Ga0157376_11560442	3300014969	Bacteria	694
164	Ga0182006_1000048	3300015261	Bacteria	184700
165	Ga0182006_1000770	3300015261	Bacteria	21827
166	Ga0182006_1000824	3300015261	Bacteria	20784
167	Ga0182006_1000993	3300015261	Bacteria	18568
168	Ga0182006_1001240	3300015261	Bacteria	15821
169	Ga0182006_1006338	3300015261	Bacteria	5508
170	Ga0182006_1011667	3300015261	Bacteria	3861
171	Ga0182006_1018629	3300015261	Bacteria	2931
172	Ga0182006_1019998	3300015261	Bacteria	2811
173	Ga0182006_1049135	3300015261	Bacteria	1629
174	Ga0182007_10000001	3300015262	Bacteria	1127301
175	Ga0183373_1006	3300015682	Bacteria	328276
176	Ga0163161_10000023	3300017792	Bacteria	205048
177	Ga0163161_10000061	3300017792	Bacteria	112295
178	Ga0163161_10000091	3300017792	Bacteria	90927
179	Ga0163161_10000617	3300017792	Bacteria	28499
180	Ga0163161_10005321	3300017792	Bacteria	8963
181	Ga0163161_10005364	3300017792	Bacteria	8911
182	Ga0163161_10007936	3300017792	Bacteria	7347
183	Ga0163161_10030486	3300017792	Bacteria	3839
184	Ga0163161_10030523	3300017792	Bacteria	3837
185	Ga0163161_10374007	3300017792	Bacteria	1137
186	Ga0163161_10615735	3300017792	Bacteria	897
187	Ga0154015_1345967	3300020610	Bacteria	762
188	Ga0207425_1000007	3300025245	Bacteria	777411
189	Ga0209129_1000006	3300025258	Bacteria	777761
190	Ga0209676_1000001	3300025292	Bacteria	1852142
191	Ga0209676_1000263	3300025292	Bacteria	110613
192	Ga0209025_1000025	3300025294	Bacteria	524454
193	Ga0209758_1000016	3300025297	Bacteria	778557
194	Ga0209050_1000016	3300025298	Bacteria	729149
195	Ga0207656_10000126	3300025321	Bacteria	29065
196	Ga0207655_1000003	3300025728	Bacteria	1081376
197	Ga0207655_1000012	3300025728	Bacteria	640488
198	Ga0207655_1000266	3300025728	Bacteria	82011
199	Ga0207647_10000102	3300025904	Bacteria	66103
200	Ga0207645_10000576	3300025907	Bacteria	30417
201	Ga0207654_10006024	3300025911	Bacteria	6096
202	Ga0207654_10094614	3300025911	Bacteria	1829
203	Ga0207695_10003832	3300025913	Bacteria	20820
204	Ga0207671_10020484	3300025914	Bacteria	5033
205	Ga0207657_10153582	3300025919	Bacteria	1873
206	Ga0207657_10234204	3300025919	Bacteria	1468
207	Ga0207644_10001370	3300025931	Bacteria	15686
208	Ga0207690_10516243	3300025932	Bacteria	968
209	Ga0207706_10000044	3300025933	Bacteria	123576
210	Ga0207686_10096446	3300025934	Bacteria	1965
211	Ga0207709_10000007	3300025935	Bacteria	752025
212	Ga0207709_10000253	3300025935	Bacteria	64210
213	Ga0207704_10000016	3300025938	Bacteria	158362
214	Ga0207667_10027071	3300025949	Bacteria	6252
215	Ga0207651_10005299	3300025960	Bacteria	6604
216	Ga0207712_10501302	3300025961	Bacteria	1038
217	Ga0207677_10034856	3300026023	Bacteria	3263
218	Ga0207639_10071324	3300026041	Bacteria	2717
219	Ga0207678_10013356	3300026067	Bacteria	7208
220	Ga0207678_10039808	3300026067	Bacteria	4077
221	Ga0207641_10131939	3300026088	Bacteria	2244
222	Ga0207648_10000331	3300026089	Bacteria	51769
223	Ga0207674_10315691	3300026116	Bacteria	1512
224	Ga0207698_10045862	3300026142	Bacteria	3296
225	Ga0207698_11135583	3300026142	Bacteria	795
226	Ga0209281_1000037	3300027111	Bacteria	368555
227	Ga0209281_1000276	3300027111	Bacteria	97890
228	Ga0209489_116459	3300027361	Bacteria	3937
229	Ga0209489_117393	3300027361	Bacteria	3299
230	Ga0210002_1015877	3300027617	Bacteria	1189
231	Ga0209282_1002540	3300027666	Bacteria	10604
232	Ga0209282_1019739	3300027666	Bacteria	4276
233	Ga0209974_10016117	3300027876	Bacteria	2481
234	Ga0307515_10000061	3300028794	Bacteria	251841
235	Ga0307515_10031040	3300028794	Bacteria	8934
236	Ga0307515_10176207	3300028794	Bacteria	2108
237	Ga0307515_10333803	3300028794	Bacteria	1173
238	Ga0316177_1051300	3300030731	Bacteria	5860
239	Ga0316176_1011362	3300030732	Bacteria	6073
240	Ga0316179_1034084	3300030734	Bacteria	2308
241	Ga0316183_1209124	3300030742	Bacteria	21351
242	Ga0316181_1051627	3300030744	Bacteria	18287
243	Ga0316181_1210188	3300030744	Bacteria	3251
244	Ga0265327_10001552	3300031251	Bacteria	28222
245	Ga0307509_10171647	3300031507	Bacteria	2046
246	Ga0307408_100000118	3300031548	Bacteria	86912
247	Ga0307408_100000277	3300031548	Bacteria	51510
248	Ga0307408_100001738	3300031548	Bacteria	15937
249	Ga0307408_100002864	3300031548	Bacteria	11955
250	Ga0307408_100007945	3300031548	Bacteria	7015
251	Ga0307408_100009912	3300031548	Bacteria	6277
252	Ga0307514_10012081	3300031649	Bacteria	7190
253	Ga0316576_10051842	3300031727	Bacteria	2987
254	Ga0316578_10249557	3300031728	Bacteria	1065
255	Ga0307405_10000019	3300031731	Bacteria	167960
256	Ga0307405_10000021	3300031731	Bacteria	155876
257	Ga0307405_10002022	3300031731	Bacteria	8792
258	Ga0307405_10014741	3300031731	Bacteria	4213
259	Ga0307405_10478577	3300031731	Bacteria	993
260	Ga0307405_10545254	3300031731	Bacteria	937
261	Ga0307405_10764069	3300031731	Bacteria	806
262	Ga0307413_10000867	3300031824	Bacteria	10682
263	Ga0307413_10002184	3300031824	Bacteria	7864
264	Ga0307410_10000029	3300031852	Bacteria	50877
265	Ga0307410_10000070	3300031852	Bacteria	35922
266	Ga0307410_10001785	3300031852	Bacteria	9960
267	Ga0307406_10000012	3300031901	Bacteria	111189
268	Ga0307406_10000028	3300031901	Bacteria	91602
269	Ga0307406_10018925	3300031901	Bacteria	4033
270	Ga0307406_10034448	3300031901	Bacteria	3106
271	Ga0307407_10000072	3300031903	Bacteria	37225
272	Ga0307407_10028192	3300031903	Bacteria	2998
273	Ga0307407_10047060	3300031903	Bacteria	2445
274	Ga0307412_10000028	3300031911	Bacteria	213966
275	Ga0307412_10000033	3300031911	Bacteria	206649
276	Ga0307412_10010172	3300031911	Bacteria	5413
277	Ga0307412_10087719	3300031911	Bacteria	2168
278	Ga0307412_10110734	3300031911	Bacteria	1960
279	Ga0307412_10139448	3300031911	Bacteria	1774
280	Ga0307412_10203120	3300031911	Bacteria	1506
281	Ga0307409_100050985	3300031995	Bacteria	3165
282	Ga0307416_100000052	3300032002	Bacteria	114516
283	Ga0307416_100000696	3300032002	Bacteria	17473
284	Ga0307416_100001760	3300032002	Bacteria	11989
285	Ga0307416_100007074	3300032002	Bacteria	7088
286	Ga0307414_10000001	3300032004	Bacteria	1352954
287	Ga0307414_10000008	3300032004	Bacteria	375832
288	Ga0307414_10000022	3300032004	Bacteria	212123
289	Ga0307414_10000205	3300032004	Bacteria	39667
290	Ga0307414_10000768	3300032004	Bacteria	16444
291	Ga0307414_10002599	3300032004	Bacteria	9497
292	Ga0307414_10003148	3300032004	Bacteria	8765
293	Ga0307414_10010872	3300032004	Bacteria	5310
294	Ga0307414_10011510	3300032004	Bacteria	5192
295	Ga0307414_10016043	3300032004	Bacteria	4541
296	Ga0307414_10021958	3300032004	Bacteria	4017
297	Ga0307414_10033353	3300032004	Bacteria	3403
298	Ga0307414_10093930	3300032004	Bacteria	2237
299	Ga0307414_10107707	3300032004	Bacteria	2112
300	Ga0307414_10110717	3300032004	Bacteria	2089
301	Ga0307414_10121939	3300032004	Bacteria	2006
302	Ga0307414_10152501	3300032004	Bacteria	1825
303	Ga0307414_10182381	3300032004	Bacteria	1690
304	Ga0307414_10242285	3300032004	Bacteria	1493
305	Ga0307414_10322912	3300032004	Bacteria	1315
306	Ga0307414_11018844	3300032004	Bacteria	762
307	Ga0307411_10000011	3300032005	Bacteria	204666
308	Ga0307411_10000012	3300032005	Bacteria	161467
309	Ga0307411_10124039	3300032005	Bacteria	1875
310	Ga0307510_10043530	3300033180	Bacteria	4879
311	Ga0316588_1090528	3300033528	Bacteria	762
312	Ga0316574_0340200	3300035398	Bacteria	951
313	Ga0316574_0429565	3300035398	Bacteria	829
314	Ga0373927_0064192	3300035695	Bacteria	2375
315	Ga0316584_0029155	3300036712	Bacteria	4074
316	Ga0316584_0517567	3300036712	Bacteria	836
317	Ga0395899_0000220	3300037312	Bacteria	78900
318	Ga0395900_0731214	3300037418	Bacteria	921
319	Ga0395905_0262349	3300037471	Bacteria	1613
320	Ga0395901_0540715	3300038443	Bacteria	1182
321	Ga0395901_0847007	3300038443	Bacteria	900
322	Ga0400490_55864	3300038726	Bacteria	14246
323	Ga0439439_0048630	3300041406	Bacteria	1109
324	Ga0439466_0000145	3300041411	Bacteria	28342
325	Ga0439466_0006224	3300041411	Bacteria	4541
326	Ga0439465_0000800	3300041413	Bacteria	9858
327	Ga0451807_0643652	3300041486	Bacteria	877
328	Ga0451837_0722278	3300041494	Bacteria	1799
329	Ga0451843_1730145	3300041509	Bacteria	1112
330	Ga0439433_0020497	3300041999	Bacteria	1476
331	Ga0439432_034159	3300042006	Bacteria	1634
332	Ga0439449_0000697	3300042007	Bacteria	12827
333	Ga0439457_013901	3300042014	Bacteria	1805
334	Ga0439457_020169	3300042014	Bacteria	1479
335	Ga0439462_0008953	3300042015	Bacteria	2532
336	Ga0451577_0000217	3300042876	Bacteria	119582
337	Ga0451577_0049882	3300042876	Bacteria	3736
338	Ga0453683_0114245	3300044673	Bacteria	1699
339	Ga0466966_0002407	3300044684	Bacteria	12214
340	Ga0466966_0002864	3300044684	Bacteria	11352
341	Ga0466966_0020566	3300044684	Bacteria	4337
342	Ga0466961_0010140	3300044693	Bacteria	6002
343	Ga0466961_0125569	3300044693	Bacteria	1610
344	Ga0453684_0005026	3300044712	Bacteria	26855
345	Ga0466959_0106878	3300045049	Bacteria	2000
346	Ga0451576_0005993	3300045051	Bacteria	15029
347	Ga0451576_0032770	3300045051	Bacteria	5526
348	Ga0466958_0002948	3300045836	Bacteria	8708
349	Ga0466958_0025267	3300045836	Bacteria	3501
350	Ga0495627_001701	3300046453	Bacteria	12053
351	Ga0495627_005100	3300046453	Bacteria	5365
352	Ga0495590_0011632	3300046457	Bacteria	3287
353	Ga0495638_0090689	3300046460	Bacteria	1842
354	Ga0495585_0000065	3300046492	Bacteria	108945
355	Ga0495596_0003144	3300046500	Bacteria	8504
356	Ga0495607_0006764	3300046501	Bacteria	8015
357	Ga0495607_0018698	3300046501	Bacteria	4410
358	Ga0495583_0104588	3300046506	Bacteria	1205
359	Ga0495606_0007468	3300046507	Bacteria	9771
360	Ga0495606_0018489	3300046507	Bacteria	5222
361	Ga0495606_0036726	3300046507	Bacteria	3334
362	Ga0495610_0000001	3300046512	Bacteria	1620061
363	Ga0495610_0000035	3300046512	Bacteria	189683
364	Ga0495610_0001928	3300046512	Bacteria	17885
365	Ga0495610_0003582	3300046512	Bacteria	11999
366	Ga0495610_0117788	3300046512	Bacteria	1168
367	Ga0495616_0002695	3300046513	Bacteria	11642
368	Ga0495616_0005896	3300046513	Bacteria	7474
369	Ga0495616_0009342	3300046513	Bacteria	5746
370	Ga0495637_0066841	3300046520	Bacteria	1460
371	Ga0495643_0000542	3300046522	Bacteria	46816
372	Ga0495643_0006725	3300046522	Bacteria	7524
373	Ga0495663_0002463	3300046525	Bacteria	5566
374	Ga0495654_0165378	3300046530	Bacteria	968
375	Ga0495621_0117721	3300046539	Bacteria	1024
376	Ga0495633_0000804	3300046558	Bacteria	27892
377	Ga0495633_0001827	3300046558	Bacteria	15640
378	Ga0495633_0040998	3300046558	Bacteria	2203
379	Ga0495625_0000211	3300046660	Bacteria	92222
380	Ga0495625_0001518	3300046660	Bacteria	27782
381	Ga0495625_0009279	3300046660	Bacteria	8251
382	Ga0495625_0246644	3300046660	Bacteria	1160
383	Ga0495625_0348567	3300046660	Bacteria	936
384	Ga0495661_0002976	3300046665	Bacteria	12782
385	Ga0495658_0585191	3300046683	Bacteria	715
386	Ga0495671_0142601	3300046692	Bacteria	1167
387	Ga0495649_0000090	3300046694	Bacteria	78509
388	Ga0495589_0096362	3300046794	Bacteria	1434
389	Ga0495660_0078535	3300046810	Bacteria	1735
390	Ga0495683_0061949	3300047323	Bacteria	1852
391	Ga0495687_001603	3300047443	Bacteria	20409
392	Ga0495681_0234989	3300047470	Bacteria	730
393	Ga0496102_0011111	3300048905	Bacteria	7755
394	Ga0496104_0349843	3300048907	Bacteria	1391
395	Ga0496115_0330984	3300048918	Bacteria	1244
396	Ga0496116_0000004	3300048919	Bacteria	839841
397	Ga0496116_0000012	3300048919	Bacteria	611365
398	Ga0496116_0000073	3300048919	Bacteria	237590
399	Ga0496116_0106225	3300048919	Bacteria	1663
400	Ga0496117_0000257	3300048920	Bacteria	99879
401	Ga0496117_0005122	3300048920	Bacteria	14006
402	Ga0496117_0047570	3300048920	Bacteria	3074
403	Ga0496117_0098191	3300048920	Bacteria	1863
404	Ga0496118_0000196	3300048921	Bacteria	106933
405	Ga0496118_0023301	3300048921	Bacteria	5382
406	Ga0496118_0024488	3300048921	Bacteria	5206
407	Ga0496118_0111904	3300048921	Bacteria	1809
408	Ga0496118_0221865	3300048921	Bacteria	1099
409	Ga0496119_0000002	3300048922	Bacteria	738385
410	Ga0496121_0033864	3300048924	Bacteria	4611
411	Ga0496121_0124451	3300048924	Bacteria	1941
412	Ga0496121_0238840	3300048924	Bacteria	1268
413	Ga0496122_0000633	3300048925	Bacteria	71586
414	Ga0496122_0000917	3300048925	Bacteria	53980
415	Ga0496122_0001953	3300048925	Bacteria	30874
416	Ga0496122_0009994	3300048925	Bacteria	9879
417	Ga0496122_0040625	3300048925	Bacteria	3692
418	Ga0496123_0000775	3300048926	Bacteria	51737
419	Ga0496123_0030196	3300048926	Bacteria	3971
420	Ga0496124_0010191	3300048927	Bacteria	9557
421	Ga0496124_0016915	3300048927	Bacteria	6909
422	Ga0496124_0069809	3300048927	Bacteria	2916
423	Ga0496124_0156183	3300048927	Bacteria	1784
424	Ga0496125_0000012	3300048928	Bacteria	651142
425	Ga0496125_0000253	3300048928	Bacteria	109929
426	Ga0496125_0001048	3300048928	Bacteria	42722
427	Ga0496125_0012433	3300048928	Bacteria	8452
428	Ga0496125_0019524	3300048928	Bacteria	6388
429	Ga0496125_0043328	3300048928	Bacteria	3822
430	Ga0496126_0031940	3300048929	Bacteria	4967
431	Ga0496126_0050568	3300048929	Bacteria	3786
432	Ga0496126_0068970	3300048929	Bacteria	3156
433	Ga0501310_012628	3300049130	Bacteria	971
434	Ga0501305_016746	3300049161	Bacteria	1048
435	Ga0501312_015700	3300049528	Bacteria	1076
436	Ga0501315_011788	3300049531	Bacteria	1072
437	Ga0501032_0005445	3300049569	Bacteria	9449
438	Ga0501034_0257288	3300049571	Bacteria	1689
439	Ga0501036_0184410	3300049572	Bacteria	1756
440	Ga0501198_009373	3300049649	Bacteria	1436
441	Ga0501217_031173	3300049661	Bacteria	1313
442	Ga0501223_002285	3300049663	Bacteria	4282
443	Ga0501223_007830	3300049663	Bacteria	2181
444	Ga0501223_013636	3300049663	Bacteria	1617
445	Ga0501227_042344	3300049665	Bacteria	1129
446	Ga0501238_000037	3300049671	Bacteria	23144
447	Ga0501238_000065	3300049671	Bacteria	16862
448	Ga0501238_000092	3300049671	Bacteria	14400
449	Ga0501249_000002	3300049679	Bacteria	262756
450	Ga0501249_000004	3300049679	Bacteria	226777
451	Ga0501249_000006	3300049679	Bacteria	224148
452	Ga0501249_020067	3300049679	Bacteria	1452
453	Ga0501249_038118	3300049679	Bacteria	1085
454	Ga0501249_085195	3300049679	Bacteria	746
455	Ga0501241_001044	3300049758	Bacteria	5848
456	Ga0501241_012982	3300049758	Bacteria	1512
457	Ga0501241_013317	3300049758	Bacteria	1493
458	Ga0501241_061802	3300049758	Bacteria	753
459	Ga0501266_000006	3300049763	Bacteria	312183
460	Ga0501266_000017	3300049763	Bacteria	155699
461	Ga0501266_029742	3300049763	Bacteria	776
462	Ga0501269_000072	3300049766	Bacteria	31457
463	Ga0501269_014018	3300049766	Bacteria	982
464	Ga0501280_000730	3300049776	Bacteria	7240
465	Ga0501280_002094	3300049776	Bacteria	3443
466	nmdc:mga03683_142836_c1	3300050489	Bacteria	1077
467	nmdc:mga0k408_46446_c1	3300050493	Bacteria	2507
468	Ga0500646_0001147	3300053090	Bacteria	7159
469	Ga0500646_0002588	3300053090	Bacteria	4692
470	Ga0500646_0010229	3300053090	Bacteria	2406
471	Ga0500646_0039135	3300053090	Bacteria	1329
472	Ga0500646_0122243	3300053090	Bacteria	838
473	Ga0500651_0000934	3300053093	Bacteria	14333
474	Ga0500641_0000003	3300053096	Bacteria	284831
475	Ga0500641_0000009	3300053096	Bacteria	173260
476	Ga0500641_0000033	3300053096	Bacteria	78369
477	Ga0500641_0000092	3300053096	Bacteria	34933
478	Ga0500641_0000189	3300053096	Bacteria	23249
479	Ga0500641_0000665	3300053096	Bacteria	12376
480	Ga0500641_0001934	3300053096	Bacteria	7348
481	Ga0500594_0003282	3300053118	Bacteria	3546
482	Ga0500594_0026893	3300053118	Bacteria	1485
483	Ga0500658_0000007	3300053134	Bacteria	284115
484	Ga0500658_0000035	3300053134	Bacteria	87202
485	Ga0500573_0238237	3300053140	Bacteria	945
486	Ga0500622_0000527	3300053156	Bacteria	35443
487	Ga0500622_0046977	3300053156	Bacteria	2230
488	Ga0500627_0168305	3300053158	Bacteria	988
489	Ga0500627_0247736	3300053158	Bacteria	789
490	Ga0587077_005138	3300059493	Bacteria	1770
491	Ga0587090_006090	3300059510	Bacteria	1537
492	Ga0587125_003162	3300059607	Bacteria	1379
493	Ga0587101_003068	3300059623	Bacteria	1663
494	Ga0587128_011745	3300059630	Bacteria	1203
495	Ga0587062_003653	3300059639	Bacteria	1575
496	Ga0587072_029489	3300059643	Bacteria	1018
497	Ga0587107_004261	3300059652	Bacteria	1444
498	Ga0587124_006668	3300059660	Bacteria	956

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300003323	rootH1_10236234	rootH1_102362342	185
2	3300005288	Ga0065714_10007539	Ga0065714_100075394	185
3	3300032004	Ga0307414_10000768	Ga0307414_100007689	185
4	3300047470	Ga0495681_0234989	Ga0495681_0234989_138_719	187
5	3300005288	Ga0065714_10074656	Ga0065714_100746562	196
6	3300003320	rootH2_10323525	rootH2_103235251	202
7	3300049661	Ga0501217_031173	Ga0501217_031173_509_1150	212
8	3300049776	Ga0501280_000730	Ga0501280_000730_3391_4032	213
9	iso_pu_bacteria	2511231000	2511234459	213
10	iso_pu_bacteria	2523533629	2524005963	213
11	iso_pu_bacteria	2582581281	2585155814	213
12	iso_pu_bacteria	2582581282	2585160262	213
13	iso_pu_bacteria	2585428184	2588219488	213
14	iso_pu_bacteria	2585428187	2588234386	213
15	iso_pu_bacteria	2738541273	2738699371	213
16	iso_pu_bacteria	2738543014	2739255338	213
17	iso_pu_bacteria	2772190705	2772606900	213
18	iso_pu_bacteria	2775506739	2775673596	213
19	iso_pu_bacteria	2842083920	2842083954	213
20	iso_pu_bacteria	2905999023	2906000683	213
21	iso_pu_bacteria	2919097161	2919097703	213
22	iso_pu_bacteria	2945924605	2945927332	213
23	iso_pu_bacteria	2946019816	2946022222	213
24	iso_pu_bacteria	2977243572	2977246500	213
25	iso_pu_bacteria	2513020052	2513233144	214
26	iso_pu_bacteria	2513020052	2513233600	214
27	iso_pu_bacteria	2513020052	2513234764	214
28	iso_pu_bacteria	2519899754	2520878065	214
29	iso_pu_bacteria	2519899754	2520882264	214
30	iso_pu_bacteria	2522125168	2522550115	214
31	iso_pu_bacteria	2585427687	2586206609	214
32	iso_pu_bacteria	2599185184	2599479252	214
33	iso_pu_bacteria	2643221600	2644010226	214
34	iso_pu_bacteria	2643221600	2644010283	214
35	iso_pu_bacteria	2643221667	2644370742	214
36	iso_pu_bacteria	2643221667	2644371343	214
37	iso_pu_bacteria	2643221667	2644373576	214
38	iso_pu_bacteria	2643221716	2644640239	214
39	iso_pu_bacteria	2643221716	2644644318	214
40	iso_pu_bacteria	2643221725	2644683357	214
41	iso_pu_bacteria	2643221725	2644686092	214
42	iso_pu_bacteria	2721755487	2722730408	214
43	iso_pu_bacteria	2738541279	2738733857	214
44	iso_pu_bacteria	2738541279	2738734328	214
45	iso_pu_bacteria	2738541279	2738736703	214
46	iso_pu_bacteria	2738541283	2738754843	214
47	iso_pu_bacteria	2738541284	2738761237	214
48	iso_pu_bacteria	2738541285	2738766186	214
49	iso_pu_bacteria	2738541285	2738767086	214
50	iso_pu_bacteria	2738541285	2738769159	214
51	iso_pu_bacteria	2738541302	2738853469	214
52	iso_pu_bacteria	2738543007	2739215438	214
53	iso_pu_bacteria	2738543007	2739215909	214
54	iso_pu_bacteria	2738543007	2739218285	214
55	iso_pu_bacteria	2738543023	2739304582	214
56	iso_pu_bacteria	2739367651	2739588655	214
57	iso_pu_bacteria	2739367656	2739615857	214
58	iso_pu_bacteria	2739367663	2739645328	214
59	iso_pu_bacteria	2739367857	2740001497	214
60	iso_pu_bacteria	2739367857	2740001730	214
61	iso_pu_bacteria	2739367858	2740006313	214
62	iso_pu_bacteria	2739367858	2740006546	214
63	iso_pu_bacteria	2775506987	2776613421	214
64	iso_pu_bacteria	2802428842	2802652760	214
65	iso_pu_bacteria	2802428842	2802652967	214
66	iso_pu_bacteria	2816332280	2817415096	214
67	iso_pu_bacteria	2816332280	2817417044	214
68	iso_pu_bacteria	2818991437	2819548099	214
69	iso_pu_bacteria	2833640130	2833641072	214
70	iso_pu_bacteria	2842722452	2842723790	214
71	iso_pu_bacteria	2842903701	2842906729	214
72	iso_pu_bacteria	2842909656	2842910295	214
73	iso_pu_bacteria	2849281842	2849282366	214
74	iso_pu_bacteria	2852627209	2852631947	214
75	iso_pu_bacteria	2857613821	2857613848	214
76	iso_pu_bacteria	2857613821	2857616201	214
77	iso_pu_bacteria	2857613821	2857617740	214
78	iso_pu_bacteria	2857618242	2857620629	214
79	iso_pu_bacteria	2857618242	2857622632	214
80	iso_pu_bacteria	2857627736	2857628887	214
81	iso_pu_bacteria	2881247448	2881248556	214
82	iso_pu_bacteria	2881359912	2881360379	214
83	iso_pu_bacteria	2884634485	2884636816	214
84	iso_pu_bacteria	2890737413	2890738237	214
85	iso_pu_bacteria	2890804823	2890805376	214
86	iso_pu_bacteria	2895498888	2895503611	214
87	iso_pu_bacteria	2896344016	2896345672	214
88	iso_pu_bacteria	2896344016	2896346344	214
89	iso_pu_bacteria	2898713307	2898713942	214
90	iso_pu_bacteria	2902048731	2902051409	214
91	iso_pu_bacteria	2903895155	2903896324	214
92	iso_pu_bacteria	2903895155	2903896484	214
93	iso_pu_bacteria	2904419702	2904420340	214
94	iso_pu_bacteria	2904419702	2904423514	214
95	iso_pu_bacteria	2904419702	2904423774	214
96	iso_pu_bacteria	2904445276	2904445658	214
97	iso_pu_bacteria	2904555929	2904557812	214
98	iso_pu_bacteria	2904555929	2904560346	214
99	iso_pu_bacteria	2904780799	2904785598	214
100	iso_pu_bacteria	2911138879	2911140475	214
101	iso_pu_bacteria	2919177583	2919182143	214
102	iso_pu_bacteria	2919186247	2919187078	214
103	iso_pu_bacteria	2919191525	2919191654	214
104	iso_pu_bacteria	2919191525	2919196372	214
105	iso_pu_bacteria	2919509842	2919512591	214
106	iso_pu_bacteria	2919683626	2919684123	214
107	iso_pu_bacteria	2919683626	2919688150	214
108	iso_pu_bacteria	2919692658	2919695410	214
109	iso_pu_bacteria	2928078545	2928082436	214
110	iso_pu_bacteria	2928147474	2928148980	214
111	iso_pu_bacteria	2929150217	2929151340	214
112	iso_pu_bacteria	2929150217	2929154320	214
113	iso_pu_bacteria	2929150217	2929154597	214
114	iso_pu_bacteria	2932082852	2932087510	214
115	iso_pu_bacteria	2939664404	2939665653	214
116	iso_pu_bacteria	2945997725	2946000646	214
117	iso_pu_bacteria	2954016120	2954017531	214
118	iso_pu_bacteria	2958458903	2958459451	214
119	iso_pu_bacteria	2958458903	2958463171	214
120	iso_pu_bacteria	2958512119	2958515935	214
121	iso_pu_bacteria	2965320100	2965320701	214
122	iso_pu_bacteria	2977232053	2977236443	214
123	iso_pu_bacteria	2977268062	2977268963	214
124	iso_pu_bacteria	3003233435	3003234093	214
125	iso_pu_bacteria	3003233435	3003235724	214
126	iso_pu_bacteria	8036736890	8036738478	214
127	iso_pu_bacteria	8054307821	8054308437	214
128	iso_pu_bacteria	8054307821	8054311662	214
129	iso_pu_bacteria	8055419101	8055420705	214
130	iso_pu_bacteria	8055419101	8055422637	214
131	iso_pu_bacteria	8055588893	8055589620	214
132	iso_pu_bacteria	8055592153	8055594952	214
133	iso_pu_bacteria	8055592153	8055595516	214
134	iso_pu_bacteria	8056440228	8056441757	214
135	iso_pu_bacteria	8056440228	8056443702	214
136	3300005616	Ga0068852_101197970	Ga0068852_1011979701	215
137	3300026142	Ga0207698_11135583	Ga0207698_111355831	215
138	3300059643	Ga0587072_029489	Ga0587072_029489_119_778	215
139	3300003316	rootH1_10150855	rootH1_101508552	217
140	3300005288	Ga0065714_10064658	Ga0065714_100646584	217
141	3300005293	Ga0065715_10049471	Ga0065715_100494712	217
142	3300005366	Ga0070659_100267196	Ga0070659_1002671961	217
143	3300013102	Ga0157371_10000037	Ga0157371_1000003735	217
144	3300013102	Ga0157371_10000096	Ga0157371_1000009665	217
145	3300013104	Ga0157370_10002406	Ga0157370_1000240621	217
146	3300013104	Ga0157370_10010888	Ga0157370_100108882	217
147	3300013105	Ga0157369_10000403	Ga0157369_1000040311	217
148	3300013105	Ga0157369_10009389	Ga0157369_100093895	217
149	3300013308	Ga0157375_10000052	Ga0157375_1000005239	217
150	3300015261	Ga0182006_1000048	Ga0182006_1000048110	217
151	3300025919	Ga0207657_10153582	Ga0207657_101535822	217
152	3300025932	Ga0207690_10516243	Ga0207690_105162432	217
153	3300025935	Ga0207709_10000253	Ga0207709_1000025338	217
154	3300031727	Ga0316576_10051842	Ga0316576_100518423	217
155	3300031911	Ga0307412_10000028	Ga0307412_10000028150	217
156	3300031911	Ga0307412_10110734	Ga0307412_101107341	217
157	3300032002	Ga0307416_100000052	Ga0307416_10000005224	217
158	3300032004	Ga0307414_10011510	Ga0307414_100115104	217
159	3300032004	Ga0307414_10093930	Ga0307414_100939302	217
160	3300032004	Ga0307414_10152501	Ga0307414_101525013	217
161	3300032004	Ga0307414_10242285	Ga0307414_102422852	217
162	3300035398	Ga0316574_0340200	Ga0316574_0340200_153_806	217
163	3300035398	Ga0316574_0429565	Ga0316574_0429565_44_697	217
164	3300036712	Ga0316584_0517567	Ga0316584_0517567_86_739	217
165	3300041413	Ga0439465_0000800	Ga0439465_0000800_5112_5765	217
166	3300041494	Ga0451837_0722278	Ga0451837_0722278_1127_1780	217
167	3300042006	Ga0439432_034159	Ga0439432_034159_841_1494	217
168	3300045051	Ga0451576_0032770	Ga0451576_0032770_4700_5353	217
169	3300046457	Ga0495590_0011632	Ga0495590_0011632_2213_2866	217
170	3300046500	Ga0495596_0003144	Ga0495596_0003144_2255_2908	217
171	3300046507	Ga0495606_0007468	Ga0495606_0007468_7619_8272	217
172	3300046512	Ga0495610_0000001	Ga0495610_0000001_1211673_1212326	217
173	3300046525	Ga0495663_0002463	Ga0495663_0002463_3857_4525	217
174	3300046558	Ga0495633_0001827	Ga0495633_0001827_4582_5235	217
175	3300046660	Ga0495625_0001518	Ga0495625_0001518_10398_11051	217
176	3300048905	Ga0496102_0011111	Ga0496102_0011111_3519_4172	217
177	3300048907	Ga0496104_0349843	Ga0496104_0349843_505_1158	217
178	3300048919	Ga0496116_0000012	Ga0496116_0000012_194348_195001	217
179	3300048920	Ga0496117_0000257	Ga0496117_0000257_25155_25808	217
180	3300048921	Ga0496118_0000196	Ga0496118_0000196_22993_23646	217
181	3300048922	Ga0496119_0000002	Ga0496119_0000002_369081_369734	217
182	3300048925	Ga0496122_0000633	Ga0496122_0000633_45889_46542	217
183	3300048925	Ga0496122_0000917	Ga0496122_0000917_4901_5554	217
184	3300048925	Ga0496122_0009994	Ga0496122_0009994_4165_4818	217
185	3300048926	Ga0496123_0000775	Ga0496123_0000775_42038_42691	217
186	3300048927	Ga0496124_0016915	Ga0496124_0016915_972_1625	217
187	3300048927	Ga0496124_0156183	Ga0496124_0156183_148_801	217
188	3300048928	Ga0496125_0012433	Ga0496125_0012433_4846_5499	217
189	3300048928	Ga0496125_0019524	Ga0496125_0019524_1692_2345	217
190	3300049766	Ga0501269_000072	Ga0501269_000072_13084_13737	217
191	2162886007	SwRhRL2b_contig_199439	SwRhRL2b_0847.00005120	218
192	2162886007	SwRhRL2b_contig_2067937	SwRhRL2b_0997.00001310	218
193	2162886007	SwRhRL2b_contig_353992	SwRhRL2b_0337.00006480	218
194	2162886007	SwRhRL2b_contig_894088	SwRhRL2b_0433.00003850	218
195	2209111006	2214769932	2213788606	218
196	3300001904	JGI24736J21556_1003056	JGI24736J21556_10030563	218
197	3300001979	JGI24740J21852_10006988	JGI24740J21852_100069882	218
198	3300001979	JGI24740J21852_10021175	JGI24740J21852_100211752	218
199	3300001990	JGI24737J22298_10002517	JGI24737J22298_100025174	218
200	3300001991	JGI24743J22301_10013059	JGI24743J22301_100130591	218
201	3300002067	JGI24735J21928_10000009	JGI24735J21928_10000009116	218
202	3300002773	JGI25152J39213_1000168	JGI25152J39213_10001686	218
203	3300002774	JGI25150J39212_1000019	JGI25150J39212_100001940	218
204	3300003187	JGI25151J46595_10000074	JGI25151J46595_1000007440	218
205	3300003215	JGI25153J46596_10000056	JGI25153J46596_1000005640	218
206	3300003316	rootH1_10014551	rootH1_100145512	218
207	3300003322	rootL2_10119979	rootL2_101199792	218
208	3300003322	rootL2_10196648	rootL2_101966483	218
209	3300003781	Ga0055536_1000011	Ga0055536_1000011216	218
210	3300003781	Ga0055536_1011069	Ga0055536_10110695	218
211	3300003791	Ga0055530_10003989	Ga0055530_100039892	218
212	3300005262	Ga0065165_1000088	Ga0065165_100008886	218
213	3300005288	Ga0065714_10002530	Ga0065714_100025309	218
214	3300005288	Ga0065714_10008739	Ga0065714_100087393	218
215	3300005288	Ga0065714_10012314	Ga0065714_100123141	218
216	3300005288	Ga0065714_10064466	Ga0065714_1006446642	218
217	3300005288	Ga0065714_10147024	Ga0065714_101470241	218
218	3300005288	Ga0065714_10162550	Ga0065714_101625501	218
219	3300005288	Ga0065714_10251520	Ga0065714_102515201	218
220	3300005289	Ga0065704_10072241	Ga0065704_100722417	218
221	3300005289	Ga0065704_10079406	Ga0065704_100794063	218
222	3300005289	Ga0065704_10092569	Ga0065704_100925692	218
223	3300005289	Ga0065704_10142322	Ga0065704_101423222	218
224	3300005293	Ga0065715_10028855	Ga0065715_100288552	218
225	3300005293	Ga0065715_10187743	Ga0065715_101877432	218
226	3300005293	Ga0065715_10195448	Ga0065715_101954483	218
227	3300005293	Ga0065715_10206601	Ga0065715_102066011	218
228	3300005293	Ga0065715_10215905	Ga0065715_102159052	218
229	3300005293	Ga0065715_10221700	Ga0065715_102217002	218
230	3300005293	Ga0065715_10293911	Ga0065715_102939112	218
231	3300005293	Ga0065715_10306263	Ga0065715_103062631	218
232	3300005328	Ga0070676_10007023	Ga0070676_100070233	218
233	3300005337	Ga0070682_100153939	Ga0070682_1001539393	218
234	3300005339	Ga0070660_100242664	Ga0070660_1002426642	218
235	3300005355	Ga0070671_100001609	Ga0070671_10000160911	218
236	3300005364	Ga0070673_100053415	Ga0070673_1000534151	218
237	3300005366	Ga0070659_100074341	Ga0070659_1000743413	218
238	3300005455	Ga0070663_100002555	Ga0070663_1000025554	218
239	3300005455	Ga0070663_100014118	Ga0070663_1000141182	218
240	3300005456	Ga0070678_100003450	Ga0070678_1000034507	218
241	3300005457	Ga0070662_100000020	Ga0070662_10000002084	218
242	3300005459	Ga0068867_100000368	Ga0068867_10000036818	218
243	3300005546	Ga0070696_100273002	Ga0070696_1002730022	218
244	3300005563	Ga0068855_100001312	Ga0068855_1000013127	218
245	3300005563	Ga0068855_100176200	Ga0068855_1001762002	218
246	3300005563	Ga0068855_100526242	Ga0068855_1005262422	218
247	3300005578	Ga0068854_100636527	Ga0068854_1006365272	218
248	3300005616	Ga0068852_100001179	Ga0068852_10000117910	218
249	3300005834	Ga0068851_10000485	Ga0068851_100004856	218
250	3300006195	Ga0075366_10092570	Ga0075366_100925702	218
251	3300006237	Ga0097621_100001107	Ga0097621_1000011074	218
252	3300006358	Ga0068871_100000296	Ga0068871_1000002968	218
253	3300006881	Ga0068865_100000025	Ga0068865_10000002558	218
254	3300006942	Ga0099824_1001653	Ga0099824_10016535	218
255	3300006942	Ga0099824_1008461	Ga0099824_10084617	218
256	3300006946	Ga0079104_1000057	Ga0079104_1000057131	218
257	3300006946	Ga0079104_1000691	Ga0079104_100069113	218
258	3300006948	Ga0099826_10003267	Ga0099826_100032673	218
259	3300006948	Ga0099826_10007426	Ga0099826_100074266	218
260	3300009011	Ga0105251_10036564	Ga0105251_100365642	218
261	3300009036	Ga0105244_10000054	Ga0105244_1000005431	218
262	3300009036	Ga0105244_10000292	Ga0105244_1000029230	218
263	3300009036	Ga0105244_10161526	Ga0105244_101615261	218
264	3300009092	Ga0105250_10041760	Ga0105250_100417603	218
265	3300009093	Ga0105240_10009423	Ga0105240_100094232	218
266	3300009148	Ga0105243_10000078	Ga0105243_1000007886	218
267	3300009174	Ga0105241_10000134	Ga0105241_1000013428	218
268	3300009174	Ga0105241_10022208	Ga0105241_100222084	218
269	3300009176	Ga0105242_10044003	Ga0105242_100440032	218
270	3300009176	Ga0105242_11262140	Ga0105242_112621401	218
271	3300009545	Ga0105237_10002672	Ga0105237_100026728	218
272	3300009551	Ga0105238_10006366	Ga0105238_100063664	218
273	3300009553	Ga0105249_10336522	Ga0105249_103365222	218
274	3300010375	Ga0105239_10089819	Ga0105239_100898193	218
275	3300010375	Ga0105239_10232884	Ga0105239_102328842	218
276	3300010375	Ga0105239_10842826	Ga0105239_108428261	218
277	3300013100	Ga0157373_10000001	Ga0157373_10000001547	218
278	3300013100	Ga0157373_10000041	Ga0157373_1000004171	218
279	3300013100	Ga0157373_10001036	Ga0157373_1000103614	218
280	3300013100	Ga0157373_10024277	Ga0157373_100242773	218
281	3300013100	Ga0157373_10025511	Ga0157373_100255113	218
282	3300013100	Ga0157373_10043927	Ga0157373_100439272	218
283	3300013102	Ga0157371_10000139	Ga0157371_1000013974	218
284	3300013102	Ga0157371_10000293	Ga0157371_1000029361	218
285	3300013102	Ga0157371_10001078	Ga0157371_1000107834	218
286	3300013102	Ga0157371_10002388	Ga0157371_1000238813	218
287	3300013102	Ga0157371_10004696	Ga0157371_100046966	218
288	3300013102	Ga0157371_10029576	Ga0157371_100295762	218
289	3300013102	Ga0157371_10089927	Ga0157371_100899273	218
290	3300013102	Ga0157371_10150674	Ga0157371_101506742	218
291	3300013104	Ga0157370_10000225	Ga0157370_1000022521	218
292	3300013104	Ga0157370_10000403	Ga0157370_1000040316	218
293	3300013104	Ga0157370_10000410	Ga0157370_100004102	218
294	3300013104	Ga0157370_10000920	Ga0157370_1000092014	218
295	3300013104	Ga0157370_10003175	Ga0157370_100031753	218
296	3300013104	Ga0157370_10012871	Ga0157370_100128714	218
297	3300013104	Ga0157370_10013752	Ga0157370_100137526	218
298	3300013104	Ga0157370_10048147	Ga0157370_100481472	218
299	3300013104	Ga0157370_10049479	Ga0157370_100494793	218
300	3300013104	Ga0157370_10077526	Ga0157370_100775262	218
301	3300013104	Ga0157370_10095744	Ga0157370_100957442	218
302	3300013104	Ga0157370_10206843	Ga0157370_102068432	218
303	3300013104	Ga0157370_10285892	Ga0157370_102858921	218
304	3300013104	Ga0157370_10298094	Ga0157370_102980942	218
305	3300013104	Ga0157370_10695617	Ga0157370_106956172	218
306	3300013104	Ga0157370_10850014	Ga0157370_108500141	218
307	3300013104	Ga0157370_10947030	Ga0157370_109470301	218
308	3300013105	Ga0157369_10000460	Ga0157369_1000046040	218
309	3300013105	Ga0157369_10002088	Ga0157369_100020884	218
310	3300013105	Ga0157369_10003046	Ga0157369_1000304611	218
311	3300013105	Ga0157369_10003300	Ga0157369_1000330011	218
312	3300013105	Ga0157369_10005143	Ga0157369_1000514311	218
313	3300013105	Ga0157369_10015002	Ga0157369_100150027	218
314	3300013105	Ga0157369_10191324	Ga0157369_101913242	218
315	3300013105	Ga0157369_10441462	Ga0157369_104414622	218
316	3300013296	Ga0157374_10000079	Ga0157374_1000007927	218
317	3300013296	Ga0157374_10003573	Ga0157374_100035737	218
318	3300013297	Ga0157378_10042927	Ga0157378_100429273	218
319	3300013306	Ga0163162_10002617	Ga0163162_100026176	218
320	3300013306	Ga0163162_10009170	Ga0163162_1000917011	218
321	3300013306	Ga0163162_10093289	Ga0163162_100932893	218
322	3300013306	Ga0163162_10813454	Ga0163162_108134542	218
323	3300013307	Ga0157372_10000009	Ga0157372_10000009200	218
324	3300013307	Ga0157372_10044891	Ga0157372_100448914	218
325	3300013307	Ga0157372_10066698	Ga0157372_100666983	218
326	3300013307	Ga0157372_10253771	Ga0157372_102537712	218
327	3300013308	Ga0157375_10044604	Ga0157375_100446042	218
328	3300013308	Ga0157375_10096334	Ga0157375_100963342	218
329	3300013308	Ga0157375_10122208	Ga0157375_101222082	218
330	3300013308	Ga0157375_10145232	Ga0157375_101452321	218
331	3300013308	Ga0157375_10391007	Ga0157375_103910072	218
332	3300013308	Ga0157375_10840481	Ga0157375_108404812	218
333	3300014326	Ga0157380_10000106	Ga0157380_1000010622	218
334	3300014497	Ga0182008_10000001	Ga0182008_10000001256	218
335	3300014497	Ga0182008_10000540	Ga0182008_1000054030	218
336	3300014497	Ga0182008_10004022	Ga0182008_100040222	218
337	3300014969	Ga0157376_11560442	Ga0157376_115604421	218
338	3300015261	Ga0182006_1000770	Ga0182006_100077013	218
339	3300015261	Ga0182006_1000824	Ga0182006_10008246	218
340	3300015261	Ga0182006_1000993	Ga0182006_100099329	218
341	3300015261	Ga0182006_1001240	Ga0182006_10012408	218
342	3300015261	Ga0182006_1006338	Ga0182006_10063381	218
343	3300015261	Ga0182006_1011667	Ga0182006_10116675	218
344	3300015261	Ga0182006_1018629	Ga0182006_10186292	218
345	3300015261	Ga0182006_1019998	Ga0182006_10199982	218
346	3300015261	Ga0182006_1049135	Ga0182006_10491351	218
347	3300015262	Ga0182007_10000001	Ga0182007_10000001350	218
348	3300015682	Ga0183373_1006	Ga0183373_1006153	218
349	3300017792	Ga0163161_10000023	Ga0163161_10000023108	218
350	3300017792	Ga0163161_10000061	Ga0163161_1000006132	218
351	3300017792	Ga0163161_10000091	Ga0163161_1000009157	218
352	3300017792	Ga0163161_10000617	Ga0163161_100006172	218
353	3300017792	Ga0163161_10005321	Ga0163161_100053213	218
354	3300017792	Ga0163161_10005364	Ga0163161_100053642	218
355	3300017792	Ga0163161_10007936	Ga0163161_100079366	218
356	3300017792	Ga0163161_10030486	Ga0163161_100304862	218
357	3300017792	Ga0163161_10030523	Ga0163161_100305233	218
358	3300017792	Ga0163161_10374007	Ga0163161_103740072	218
359	3300017792	Ga0163161_10615735	Ga0163161_106157351	218
360	3300020610	Ga0154015_1345967	Ga0154015_13459671	218
361	3300025245	Ga0207425_1000007	Ga0207425_1000007279	218
362	3300025258	Ga0209129_1000006	Ga0209129_1000006279	218
363	3300025292	Ga0209676_1000001	Ga0209676_1000001738	218
364	3300025292	Ga0209676_1000263	Ga0209676_100026357	218
365	3300025294	Ga0209025_1000025	Ga0209025_1000025109	218
366	3300025297	Ga0209758_1000016	Ga0209758_1000016279	218
367	3300025298	Ga0209050_1000016	Ga0209050_1000016403	218
368	3300025321	Ga0207656_10000126	Ga0207656_1000012611	218
369	3300025728	Ga0207655_1000003	Ga0207655_1000003309	218
370	3300025728	Ga0207655_1000012	Ga0207655_100001230	218
371	3300025728	Ga0207655_1000266	Ga0207655_100026625	218
372	3300025904	Ga0207647_10000102	Ga0207647_1000010229	218
373	3300025907	Ga0207645_10000576	Ga0207645_1000057615	218
374	3300025911	Ga0207654_10006024	Ga0207654_100060244	218
375	3300025911	Ga0207654_10094614	Ga0207654_100946142	218
376	3300025913	Ga0207695_10003832	Ga0207695_100038329	218
377	3300025914	Ga0207671_10020484	Ga0207671_100204842	218
378	3300025919	Ga0207657_10234204	Ga0207657_102342042	218
379	3300025931	Ga0207644_10001370	Ga0207644_1000137011	218
380	3300025933	Ga0207706_10000044	Ga0207706_10000044107	218
381	3300025934	Ga0207686_10096446	Ga0207686_100964463	218
382	3300025935	Ga0207709_10000007	Ga0207709_10000007154	218
383	3300025938	Ga0207704_10000016	Ga0207704_100000165	218
384	3300025949	Ga0207667_10027071	Ga0207667_100270717	218
385	3300025960	Ga0207651_10005299	Ga0207651_100052995	218
386	3300025961	Ga0207712_10501302	Ga0207712_105013022	218
387	3300026023	Ga0207677_10034856	Ga0207677_100348562	218
388	3300026041	Ga0207639_10071324	Ga0207639_100713243	218
389	3300026067	Ga0207678_10013356	Ga0207678_100133561	218
390	3300026067	Ga0207678_10039808	Ga0207678_100398082	218
391	3300026088	Ga0207641_10131939	Ga0207641_101319393	218
392	3300026089	Ga0207648_10000331	Ga0207648_100003319	218
393	3300026116	Ga0207674_10315691	Ga0207674_103156912	218
394	3300026142	Ga0207698_10045862	Ga0207698_100458624	218
395	3300027111	Ga0209281_1000037	Ga0209281_100003713	218
396	3300027111	Ga0209281_1000276	Ga0209281_100027673	218
397	3300027361	Ga0209489_116459	Ga0209489_1164594	218
398	3300027361	Ga0209489_117393	Ga0209489_1173933	218
399	3300027617	Ga0210002_1015877	Ga0210002_10158772	218
400	3300027666	Ga0209282_1002540	Ga0209282_100254012	218
401	3300027666	Ga0209282_1019739	Ga0209282_10197394	218
402	3300027876	Ga0209974_10016117	Ga0209974_100161173	218
403	3300028794	Ga0307515_10000061	Ga0307515_1000006133	218
404	3300028794	Ga0307515_10031040	Ga0307515_100310403	218
405	3300028794	Ga0307515_10176207	Ga0307515_101762071	218
406	3300028794	Ga0307515_10333803	Ga0307515_103338032	218
407	3300030731	Ga0316177_1051300	Ga0316177_10513002	218
408	3300030732	Ga0316176_1011362	Ga0316176_10113621	218
409	3300030734	Ga0316179_1034084	Ga0316179_10340842	218
410	3300030742	Ga0316183_1209124	Ga0316183_120912418	218
411	3300030744	Ga0316181_1051627	Ga0316181_105162711	218
412	3300030744	Ga0316181_1210188	Ga0316181_12101883	218
413	3300031251	Ga0265327_10001552	Ga0265327_1000155220	218
414	3300031507	Ga0307509_10171647	Ga0307509_101716473	218
415	3300031548	Ga0307408_100000118	Ga0307408_10000011821	218
416	3300031548	Ga0307408_100000277	Ga0307408_1000002776	218
417	3300031548	Ga0307408_100001738	Ga0307408_1000017386	218
418	3300031548	Ga0307408_100002864	Ga0307408_10000286411	218
419	3300031548	Ga0307408_100007945	Ga0307408_1000079451	218
420	3300031548	Ga0307408_100009912	Ga0307408_1000099123	218
421	3300031649	Ga0307514_10012081	Ga0307514_100120817	218
422	3300031728	Ga0316578_10249557	Ga0316578_102495572	218
423	3300031731	Ga0307405_10000019	Ga0307405_100000192	218
424	3300031731	Ga0307405_10000021	Ga0307405_1000002113	218
425	3300031731	Ga0307405_10002022	Ga0307405_100020223	218
426	3300031731	Ga0307405_10014741	Ga0307405_100147412	218
427	3300031731	Ga0307405_10478577	Ga0307405_104785772	218
428	3300031731	Ga0307405_10545254	Ga0307405_105452541	218
429	3300031731	Ga0307405_10764069	Ga0307405_107640691	218
430	3300031824	Ga0307413_10000867	Ga0307413_100008673	218
431	3300031824	Ga0307413_10002184	Ga0307413_100021842	218
432	3300031852	Ga0307410_10000029	Ga0307410_1000002925	218
433	3300031852	Ga0307410_10000070	Ga0307410_100000709	218
434	3300031852	Ga0307410_10001785	Ga0307410_100017853	218
435	3300031901	Ga0307406_10000012	Ga0307406_1000001259	218
436	3300031901	Ga0307406_10000028	Ga0307406_1000002855	218
437	3300031901	Ga0307406_10018925	Ga0307406_100189252	218
438	3300031901	Ga0307406_10034448	Ga0307406_100344482	218
439	3300031903	Ga0307407_10000072	Ga0307407_1000007230	218
440	3300031903	Ga0307407_10028192	Ga0307407_100281922	218
441	3300031903	Ga0307407_10047060	Ga0307407_100470602	218
442	3300031911	Ga0307412_10000033	Ga0307412_1000003343	218
443	3300031911	Ga0307412_10010172	Ga0307412_100101725	218
444	3300031911	Ga0307412_10087719	Ga0307412_100877193	218
445	3300031911	Ga0307412_10139448	Ga0307412_101394482	218
446	3300031911	Ga0307412_10203120	Ga0307412_102031202	218
447	3300031995	Ga0307409_100050985	Ga0307409_1000509852	218
448	3300032002	Ga0307416_100000696	Ga0307416_10000069615	218
449	3300032002	Ga0307416_100001760	Ga0307416_1000017606	218
450	3300032002	Ga0307416_100007074	Ga0307416_1000070745	218
451	3300032004	Ga0307414_10000001	Ga0307414_1000000130	218
452	3300032004	Ga0307414_10000008	Ga0307414_10000008111	218
453	3300032004	Ga0307414_10000022	Ga0307414_10000022112	218
454	3300032004	Ga0307414_10000205	Ga0307414_1000020517	218
455	3300032004	Ga0307414_10002599	Ga0307414_100025995	218
456	3300032004	Ga0307414_10003148	Ga0307414_100031482	218
457	3300032004	Ga0307414_10010872	Ga0307414_100108721	218
458	3300032004	Ga0307414_10016043	Ga0307414_100160432	218
459	3300032004	Ga0307414_10021958	Ga0307414_100219584	218
460	3300032004	Ga0307414_10033353	Ga0307414_100333532	218
461	3300032004	Ga0307414_10107707	Ga0307414_101077072	218
462	3300032004	Ga0307414_10110717	Ga0307414_101107173	218
463	3300032004	Ga0307414_10121939	Ga0307414_101219393	218
464	3300032004	Ga0307414_10182381	Ga0307414_101823812	218
465	3300032004	Ga0307414_10322912	Ga0307414_103229121	218
466	3300032004	Ga0307414_11018844	Ga0307414_110188441	218
467	3300032005	Ga0307411_10000011	Ga0307411_1000001160	218
468	3300032005	Ga0307411_10000012	Ga0307411_10000012140	218
469	3300032005	Ga0307411_10124039	Ga0307411_101240392	218
470	3300033180	Ga0307510_10043530	Ga0307510_100435303	218
471	3300033528	Ga0316588_1090528	Ga0316588_10905282	218
472	3300035695	Ga0373927_0064192	Ga0373927_0064192_1071_1727	218
473	3300036712	Ga0316584_0029155	Ga0316584_0029155_628_1284	218
474	3300037312	Ga0395899_0000220	Ga0395899_0000220_78211_78879	218
475	3300037418	Ga0395900_0731214	Ga0395900_0731214_103_774	218
476	3300037471	Ga0395905_0262349	Ga0395905_0262349_739_1395	218
477	3300038443	Ga0395901_0540715	Ga0395901_0540715_278_946	218
478	3300038443	Ga0395901_0847007	Ga0395901_0847007_138_809	218
479	3300038726	Ga0400490_55864	Ga0400490_55864_13057_13713	218
480	3300041406	Ga0439439_0048630	Ga0439439_0048630_96_770	218
481	3300041411	Ga0439466_0000145	Ga0439466_0000145_13806_14462	218
482	3300041411	Ga0439466_0006224	Ga0439466_0006224_1792_2448	218
483	3300041486	Ga0451807_0643652	Ga0451807_0643652_71_730	218
484	3300041509	Ga0451843_1730145	Ga0451843_1730145_35_691	218
485	3300041999	Ga0439433_0020497	Ga0439433_0020497_634_1308	218
486	3300042007	Ga0439449_0000697	Ga0439449_0000697_8209_8883	218
487	3300042014	Ga0439457_013901	Ga0439457_013901_976_1635	218
488	3300042014	Ga0439457_020169	Ga0439457_020169_163_837	218
489	3300042015	Ga0439462_0008953	Ga0439462_0008953_1556_2215	218
490	3300042876	Ga0451577_0000217	Ga0451577_0000217_83532_84203	218
491	3300042876	Ga0451577_0049882	Ga0451577_0049882_881_1540	218
492	3300044673	Ga0453683_0114245	Ga0453683_0114245_385_1041	218
493	3300044684	Ga0466966_0002407	Ga0466966_0002407_2977_3648	218
494	3300044684	Ga0466966_0002864	Ga0466966_0002864_10520_11188	218
495	3300044684	Ga0466966_0020566	Ga0466966_0020566_948_1616	218
496	3300044693	Ga0466961_0010140	Ga0466961_0010140_165_833	218
497	3300044693	Ga0466961_0125569	Ga0466961_0125569_148_819	218
498	3300044712	Ga0453684_0005026	Ga0453684_0005026_25311_25970	218
499	3300045049	Ga0466959_0106878	Ga0466959_0106878_962_1630	218
500	3300045051	Ga0451576_0005993	Ga0451576_0005993_11486_12142	218
501	3300045836	Ga0466958_0002948	Ga0466958_0002948_4053_4721	218
502	3300045836	Ga0466958_0025267	Ga0466958_0025267_1585_2253	218
503	3300046453	Ga0495627_001701	Ga0495627_001701_686_1342	218
504	3300046453	Ga0495627_005100	Ga0495627_005100_4549_5211	218
505	3300046460	Ga0495638_0090689	Ga0495638_0090689_714_1373	218
506	3300046492	Ga0495585_0000065	Ga0495585_0000065_23235_23894	218
507	3300046501	Ga0495607_0006764	Ga0495607_0006764_407_1063	218
508	3300046501	Ga0495607_0018698	Ga0495607_0018698_3500_4168	218
509	3300046506	Ga0495583_0104588	Ga0495583_0104588_84_743	218
510	3300046507	Ga0495606_0018489	Ga0495606_0018489_2602_3264	218
511	3300046507	Ga0495606_0036726	Ga0495606_0036726_2335_3060	218
512	3300046512	Ga0495610_0000035	Ga0495610_0000035_43845_44504	218
513	3300046512	Ga0495610_0001928	Ga0495610_0001928_5698_6357	218
514	3300046512	Ga0495610_0003582	Ga0495610_0003582_11315_11974	218
515	3300046512	Ga0495610_0117788	Ga0495610_0117788_94_750	218
516	3300046513	Ga0495616_0002695	Ga0495616_0002695_4232_4891	218
517	3300046513	Ga0495616_0005896	Ga0495616_0005896_4117_4773	218
518	3300046513	Ga0495616_0009342	Ga0495616_0009342_2004_2729	218
519	3300046520	Ga0495637_0066841	Ga0495637_0066841_707_1366	218
520	3300046522	Ga0495643_0000542	Ga0495643_0000542_14748_15404	218
521	3300046522	Ga0495643_0006725	Ga0495643_0006725_5632_6306	218
522	3300046530	Ga0495654_0165378	Ga0495654_0165378_48_704	218
523	3300046539	Ga0495621_0117721	Ga0495621_0117721_68_724	218
524	3300046558	Ga0495633_0000804	Ga0495633_0000804_21717_22376	218
525	3300046558	Ga0495633_0040998	Ga0495633_0040998_728_1387	218
526	3300046660	Ga0495625_0000211	Ga0495625_0000211_8245_8904	218
527	3300046660	Ga0495625_0009279	Ga0495625_0009279_3182_3838	218
528	3300046660	Ga0495625_0246644	Ga0495625_0246644_198_872	218
529	3300046660	Ga0495625_0348567	Ga0495625_0348567_67_738	218
530	3300046665	Ga0495661_0002976	Ga0495661_0002976_3856_4515	218
531	3300046683	Ga0495658_0585191	Ga0495658_0585191_39_695	218
532	3300046692	Ga0495671_0142601	Ga0495671_0142601_489_1148	218
533	3300046694	Ga0495649_0000090	Ga0495649_0000090_8507_9166	218
534	3300046794	Ga0495589_0096362	Ga0495589_0096362_378_1037	218
535	3300046810	Ga0495660_0078535	Ga0495660_0078535_34_690	218
536	3300047323	Ga0495683_0061949	Ga0495683_0061949_353_1012	218
537	3300047443	Ga0495687_001603	Ga0495687_001603_4857_5528	218
538	3300048918	Ga0496115_0330984	Ga0496115_0330984_15_671	218
539	3300048919	Ga0496116_0000004	Ga0496116_0000004_592208_592864	218
540	3300048919	Ga0496116_0000073	Ga0496116_0000073_28766_29422	218
541	3300048919	Ga0496116_0106225	Ga0496116_0106225_236_895	218
542	3300048920	Ga0496117_0005122	Ga0496117_0005122_6145_6804	218
543	3300048920	Ga0496117_0047570	Ga0496117_0047570_376_1032	218
544	3300048920	Ga0496117_0098191	Ga0496117_0098191_1123_1779	218
545	3300048921	Ga0496118_0023301	Ga0496118_0023301_4627_5283	218
546	3300048921	Ga0496118_0024488	Ga0496118_0024488_449_1108	218
547	3300048921	Ga0496118_0111904	Ga0496118_0111904_826_1485	218
548	3300048921	Ga0496118_0221865	Ga0496118_0221865_52_708	218
549	3300048924	Ga0496121_0033864	Ga0496121_0033864_3556_4212	218
550	3300048924	Ga0496121_0124451	Ga0496121_0124451_1121_1777	218
551	3300048924	Ga0496121_0238840	Ga0496121_0238840_137_793	218
552	3300048925	Ga0496122_0001953	Ga0496122_0001953_7596_8261	218
553	3300048925	Ga0496122_0040625	Ga0496122_0040625_797_1456	218
554	3300048926	Ga0496123_0030196	Ga0496123_0030196_3247_3912	218
555	3300048927	Ga0496124_0010191	Ga0496124_0010191_3184_3840	218
556	3300048927	Ga0496124_0069809	Ga0496124_0069809_1623_2279	218
557	3300048928	Ga0496125_0000012	Ga0496125_0000012_633870_634526	218
558	3300048928	Ga0496125_0000253	Ga0496125_0000253_28907_29563	218
559	3300048928	Ga0496125_0001048	Ga0496125_0001048_28387_29043	218
560	3300048928	Ga0496125_0043328	Ga0496125_0043328_1968_2633	218
561	3300048929	Ga0496126_0031940	Ga0496126_0031940_1057_1713	218
562	3300048929	Ga0496126_0050568	Ga0496126_0050568_45_701	218
563	3300048929	Ga0496126_0068970	Ga0496126_0068970_386_1042	218
564	3300049130	Ga0501310_012628	Ga0501310_012628_138_794	218
565	3300049161	Ga0501305_016746	Ga0501305_016746_47_703	218
566	3300049528	Ga0501312_015700	Ga0501312_015700_185_841	218
567	3300049531	Ga0501315_011788	Ga0501315_011788_178_834	218
568	3300049569	Ga0501032_0005445	Ga0501032_0005445_927_1601	218
569	3300049571	Ga0501034_0257288	Ga0501034_0257288_73_729	218
570	3300049572	Ga0501036_0184410	Ga0501036_0184410_953_1609	218
571	3300049649	Ga0501198_009373	Ga0501198_009373_251_910	218
572	3300049663	Ga0501223_002285	Ga0501223_002285_2845_3504	218
573	3300049663	Ga0501223_007830	Ga0501223_007830_773_1432	218
574	3300049663	Ga0501223_013636	Ga0501223_013636_693_1349	218
575	3300049665	Ga0501227_042344	Ga0501227_042344_246_902	218
576	3300049671	Ga0501238_000037	Ga0501238_000037_2943_3599	218
577	3300049671	Ga0501238_000065	Ga0501238_000065_7350_8006	218
578	3300049671	Ga0501238_000092	Ga0501238_000092_12266_12922	218
579	3300049679	Ga0501249_000002	Ga0501249_000002_80369_81025	218
580	3300049679	Ga0501249_000004	Ga0501249_000004_83118_83774	218
581	3300049679	Ga0501249_000006	Ga0501249_000006_195978_196634	218
582	3300049679	Ga0501249_020067	Ga0501249_020067_728_1384	218
583	3300049679	Ga0501249_038118	Ga0501249_038118_142_798	218
584	3300049679	Ga0501249_085195	Ga0501249_085195_10_669	218
585	3300049758	Ga0501241_001044	Ga0501241_001044_4776_5438	218
586	3300049758	Ga0501241_012982	Ga0501241_012982_30_686	218
587	3300049758	Ga0501241_013317	Ga0501241_013317_122_778	218
588	3300049758	Ga0501241_061802	Ga0501241_061802_46_705	218
589	3300049763	Ga0501266_000006	Ga0501266_000006_62272_62928	218
590	3300049763	Ga0501266_000017	Ga0501266_000017_99483_100139	218
591	3300049763	Ga0501266_029742	Ga0501266_029742_24_680	218
592	3300049766	Ga0501269_014018	Ga0501269_014018_70_726	218
593	3300049776	Ga0501280_002094	Ga0501280_002094_2445_3101	218
594	3300050489	nmdc:mga03683_142836_c1	nmdc:mga03683_142836_c1_82_738	218
595	3300050493	nmdc:mga0k408_46446_c1	nmdc:mga0k408_46446_c1_1614_2273	218
596	3300053090	Ga0500646_0001147	Ga0500646_0001147_4747_5403	218
597	3300053090	Ga0500646_0002588	Ga0500646_0002588_3647_4303	218
598	3300053090	Ga0500646_0010229	Ga0500646_0010229_289_945	218
599	3300053090	Ga0500646_0039135	Ga0500646_0039135_125_781	218
600	3300053090	Ga0500646_0122243	Ga0500646_0122243_49_720	218
601	3300053093	Ga0500651_0000934	Ga0500651_0000934_3438_4100	218
602	3300053096	Ga0500641_0000003	Ga0500641_0000003_31802_32458	218
603	3300053096	Ga0500641_0000009	Ga0500641_0000009_71893_72549	218
604	3300053096	Ga0500641_0000033	Ga0500641_0000033_41761_42417	218
605	3300053096	Ga0500641_0000092	Ga0500641_0000092_27589_28245	218
606	3300053096	Ga0500641_0000189	Ga0500641_0000189_10366_11022	218
607	3300053096	Ga0500641_0000665	Ga0500641_0000665_9797_10453	218
608	3300053096	Ga0500641_0001934	Ga0500641_0001934_3934_4590	218
609	3300053118	Ga0500594_0003282	Ga0500594_0003282_2384_3040	218
610	3300053118	Ga0500594_0026893	Ga0500594_0026893_314_970	218
611	3300053134	Ga0500658_0000007	Ga0500658_0000007_237065_237721	218
612	3300053134	Ga0500658_0000035	Ga0500658_0000035_46056_46712	218
613	3300053140	Ga0500573_0238237	Ga0500573_0238237_60_716	218
614	3300053156	Ga0500622_0000527	Ga0500622_0000527_32227_32886	218
615	3300053156	Ga0500622_0046977	Ga0500622_0046977_478_1152	218
616	3300053158	Ga0500627_0168305	Ga0500627_0168305_135_794	218
617	3300053158	Ga0500627_0247736	Ga0500627_0247736_77_733	218
618	3300059493	Ga0587077_005138	Ga0587077_005138_96_752	218
619	3300059510	Ga0587090_006090	Ga0587090_006090_768_1424	218
620	3300059607	Ga0587125_003162	Ga0587125_003162_118_774	218
621	3300059623	Ga0587101_003068	Ga0587101_003068_916_1572	218
622	3300059630	Ga0587128_011745	Ga0587128_011745_159_815	218
623	3300059639	Ga0587062_003653	Ga0587062_003653_805_1461	218
624	3300059652	Ga0587107_004261	Ga0587107_004261_630_1286	218
625	3300059660	Ga0587124_006668	Ga0587124_006668_179_835	218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

20

240

0.89 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3r8r-assembly2.cif.gz_N	transaldolase from bacillus subtilis	0.9891	1	213
3r8r-assembly1.cif.gz_C	transaldolase from bacillus subtilis	0.9879	1	213
3r8r-assembly1.cif.gz_J	transaldolase from bacillus subtilis	0.9877	1	213
3r8r-assembly2.cif.gz_L	transaldolase from bacillus subtilis	0.9864	1	214
3r8r-assembly2.cif.gz_P	transaldolase from bacillus subtilis	0.986	1	213

ID	Description	Score	Start	End	Superfamily
3r8rB00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9841	1	214	3.20.20.70
3r8rB00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9749	1	214	3.20.20.70
1l6wA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9214	1	216	3.20.20.70
1l6wA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9014	1	216	3.20.20.70
af_A0A1L1QZF2_1_286_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.8597	1	196	3.20.20.70

ID	Description	Score	Start	End	GO Terms
AF-A0A2D7VSZ6-F1-model_v4	Fructose-6-phosphate aldolase	1.001	1	106	GO:0005975
AF-A0A4Q1III0-F1-model_v4	Fructose-6-phosphate aldolase	0.9996	1	148	GO:0005737 GO:0005975 GO:0016832
AF-A0A349NT29-F1-model_v4	deleted	0.9996	1	88
AF-A0A3D6BWL1-F1-model_v4	Fructose-6-phosphate aldolase	0.9978	1	133	GO:0005975
AF-A0A420DLH0-F1-model_v4	Probable transaldolase (EC 2.2.1.2)	0.9974	1	216	GO:0004801 GO:0005737 GO:0005975 GO:0006098 GO:0016832

Feature Viewer

pLDDT	pTM	Quality
95.81	0.89	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F470387

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

20

240

0.89

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map