F470335

General Info

Members Datasets Scaffolds Average Seq Length
625 281 1250 59

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100705419|Ga0070660_1007054192
Length 63
Sequence MAIHLTPTELAREAGLERRDVISKCLEMGVPIFQGRIDKTLFMASLHEVNPAAAAPPPRLATG

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
114 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
185 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
197 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
198 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
199 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
264 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.96
Metatranscriptomes 7.04
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 6.56
Rhizosphere 91.68
Stem 0
Stem Tuber 0
Unclassified 10.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100705419 3300005339 Bacteria 846
2 JGI24737J22298_10194445 3300001990 Bacteria 599
3 JGI24743J22301_10016952 3300001991 Bacteria 1363
4 JGI24034J26672_10043090 3300002239 Bacteria 761
5 Ga0006777J48905_1011881 3300003308 Unclassified 520
6 Ga0006781J51513_1003364 3300003568 Bacteria 515
7 Ga0007410J51695_1017613 3300003574 Bacteria 541
8 Ga0007409J51694_1018556 3300003575 Bacteria 622
9 Ga0007416J51690_1008078 3300003577 Bacteria 578
10 Ga0007416J51690_1024874 3300003577 Bacteria 538
11 Ga0007429J51699_1002066 3300003579 Unclassified 590
12 Ga0070658_10081452 3300005327 Bacteria 2659
13 Ga0070658_10089012 3300005327 Bacteria 2542
14 Ga0070658_10311237 3300005327 Bacteria 1344
15 Ga0070683_100040969 3300005329 Bacteria 4259
16 Ga0070683_100121397 3300005329 Bacteria 2469
17 Ga0070683_100189206 3300005329 Unclassified 1954
18 Ga0070683_101823728 3300005329 Unclassified 585
19 Ga0070690_100823033 3300005330 Bacteria 722
20 Ga0070677_10800682 3300005333 Bacteria 538
21 Ga0068869_101760553 3300005334 Archaea 554
22 Ga0070680_100002730 3300005336 Bacteria 13092
23 Ga0070680_100317593 3300005336 Bacteria 1322
24 Ga0070680_100440406 3300005336 Bacteria 1113
25 Ga0070680_101303249 3300005336 Bacteria 629
26 Ga0070680_101388087 3300005336 Bacteria 608
27 Ga0070680_101959321 3300005336 Bacteria 508
28 Ga0070682_100034437 3300005337 Bacteria 3085
29 Ga0070682_100151748 3300005337 Bacteria 1591
30 Ga0070682_100409542 3300005337 Bacteria 1028
31 Ga0070682_100647312 3300005337 Bacteria 841
32 Ga0068868_100593320 3300005338 Bacteria 981
33 Ga0068868_100992546 3300005338 Bacteria 768
34 Ga0068868_101911458 3300005338 Unclassified 562
35 Ga0070660_100026031 3300005339 Bacteria 4353
36 Ga0070660_100187680 3300005339 Bacteria 1674
37 Ga0070660_100246655 3300005339 Bacteria 1456
38 Ga0070660_100260828 3300005339 Bacteria 1415
39 Ga0070660_100478025 3300005339 Bacteria 1035
40 Ga0070660_100543731 3300005339 Bacteria 969
41 Ga0070660_100942039 3300005339 Archaea 729
42 Ga0070689_100069122 3300005340 Bacteria 2755
43 Ga0070689_100394211 3300005340 Unclassified 1169
44 Ga0070691_10182366 3300005341 Archaea 1094
45 Ga0070691_10608184 3300005341 Bacteria 646
46 Ga0070661_100019910 3300005344 Bacteria 4782
47 Ga0070661_100114736 3300005344 Bacteria 2014
48 Ga0070661_100782668 3300005344 Bacteria 782
49 Ga0070692_10312871 3300005345 Bacteria 963
50 Ga0070692_10829440 3300005345 Bacteria 634
51 Ga0070692_10931392 3300005345 Unclassified 603
52 Ga0070668_101304606 3300005347 Bacteria 660
53 Ga0070668_101394191 3300005347 Bacteria 639
54 Ga0070668_102092171 3300005347 Unclassified 523
55 Ga0070669_100643189 3300005353 Bacteria 892
56 Ga0070675_100512496 3300005354 Archaea 1082
57 Ga0070675_101100453 3300005354 Bacteria 731
58 Ga0070675_101532635 3300005354 Bacteria 615
59 Ga0070671_100342005 3300005355 Unclassified 1276
60 Ga0070674_100149015 3300005356 Bacteria 1764
61 Ga0070674_100168313 3300005356 Bacteria 1669
62 Ga0070673_100925945 3300005364 Bacteria 809
63 Ga0070673_100928934 3300005364 Unclassified 808
64 Ga0070673_100934800 3300005364 Bacteria 805
65 Ga0070688_100033828 3300005365 Bacteria 3091
66 Ga0070688_100773978 3300005365 Bacteria 749
67 Ga0070659_100000160 3300005366 Bacteria 51528
68 Ga0070659_100004055 3300005366 Bacteria 10442
69 Ga0070659_100150351 3300005366 Bacteria 1899
70 Ga0070659_100234170 3300005366 Bacteria 1518
71 Ga0070659_101546554 3300005366 Bacteria 592
72 Ga0070714_100011718 3300005435 Bacteria 6965
73 Ga0070714_101506054 3300005435 Bacteria 657
74 Ga0070701_10056908 3300005438 Bacteria 2048
75 Ga0070701_10279691 3300005438 Archaea 1018
76 Ga0070701_10934719 3300005438 Bacteria 601
77 Ga0070705_100001935 3300005440 Bacteria 10615
78 Ga0070705_100164917 3300005440 Bacteria 1485
79 Ga0070705_100579515 3300005440 Bacteria 865
80 Ga0070705_101275434 3300005440 Bacteria 608
81 Ga0070700_100256283 3300005441 Bacteria 1258
82 Ga0070700_100521766 3300005441 Bacteria 918
83 Ga0070694_100306923 3300005444 Bacteria 1218
84 Ga0070694_101611314 3300005444 Bacteria 551
85 Ga0070663_101412718 3300005455 Bacteria 617
86 Ga0070678_100752208 3300005456 Bacteria 882
87 Ga0070678_100839766 3300005456 Bacteria 836
88 Ga0070678_100960931 3300005456 Archaea 784
89 Ga0070678_102282131 3300005456 Bacteria 513
90 Ga0070662_100700920 3300005457 Bacteria 857
91 Ga0070681_10015180 3300005458 Bacteria 7661
92 Ga0070681_10166260 3300005458 Bacteria 2129
93 Ga0068867_100126113 3300005459 Bacteria 1984
94 Ga0068867_100432153 3300005459 Bacteria 1118
95 Ga0068867_101081369 3300005459 Bacteria 731
96 Ga0068867_101156584 3300005459 Bacteria 709
97 Ga0068867_101775114 3300005459 Unclassified 580
98 Ga0070685_10014837 3300005466 Bacteria 4132
99 Ga0070685_11381876 3300005466 Archaea 540
100 Ga0070699_100905375 3300005518 Bacteria 808
101 Ga0070679_100035087 3300005530 Bacteria 4975
102 Ga0070679_100049072 3300005530 Bacteria 4205
103 Ga0070679_100223228 3300005530 Unclassified 1845
104 Ga0070679_100279910 3300005530 Bacteria 1621
105 Ga0070684_100018851 3300005535 Bacteria 5696
106 Ga0070684_100267203 3300005535 Unclassified 1565
107 Ga0070684_100302227 3300005535 Bacteria 1468
108 Ga0068853_100007671 3300005539 Bacteria 8651
109 Ga0068853_100807388 3300005539 Bacteria 899
110 Ga0068853_101095771 3300005539 Bacteria 768
111 Ga0070686_100028286 3300005544 Bacteria 3399
112 Ga0070695_100203444 3300005545 Bacteria 1416
113 Ga0070695_100831029 3300005545 Unclassified 742
114 Ga0070695_101720058 3300005545 Bacteria 525
115 Ga0070695_101784233 3300005545 Unclassified 516
116 Ga0070696_100167406 3300005546 Bacteria 1623
117 Ga0070696_100453052 3300005546 Bacteria 1013
118 Ga0070696_101430800 3300005546 Bacteria 590
119 Ga0070693_100422102 3300005547 Bacteria 930
120 Ga0070693_101025009 3300005547 Unclassified 626
121 Ga0070693_101416961 3300005547 Bacteria 541
122 Ga0070665_100180187 3300005548 Bacteria 2114
123 Ga0070704_100076801 3300005549 Bacteria 2444
124 Ga0070704_100279400 3300005549 Bacteria 1383
125 Ga0070704_100807059 3300005549 Bacteria 839
126 Ga0070704_100830617 3300005549 Unclassified 827
127 Ga0068855_100118647 3300005563 Bacteria 3030
128 Ga0068855_101092949 3300005563 Bacteria 834
129 Ga0068855_101636929 3300005563 Bacteria 658
130 Ga0070664_100165835 3300005564 Bacteria 1957
131 Ga0070664_100395298 3300005564 Archaea 1263
132 Ga0070664_100580235 3300005564 Bacteria 1039
133 Ga0070664_100811889 3300005564 Unclassified 875
134 Ga0068857_100251211 3300005577 Bacteria 1621
135 Ga0068857_100952074 3300005577 Bacteria 825
136 Ga0068854_100069803 3300005578 Bacteria 2566
137 Ga0068854_100403483 3300005578 Bacteria 1132
138 Ga0068854_101629183 3300005578 Bacteria 589
139 Ga0068856_100162438 3300005614 Bacteria 2245
140 Ga0068856_101255516 3300005614 Unclassified 757
141 Ga0068856_101612399 3300005614 Bacteria 662
142 Ga0068856_101869861 3300005614 Unclassified 612
143 Ga0070702_100034138 3300005615 Bacteria 2802
144 Ga0070702_100621294 3300005615 Bacteria 813
145 Ga0070702_101097684 3300005615 Bacteria 635
146 Ga0068852_100029025 3300005616 Bacteria 4537
147 Ga0068852_100254841 3300005616 Bacteria 1682
148 Ga0068852_100280581 3300005616 Bacteria 1606
149 Ga0068852_100454532 3300005616 Bacteria 1268
150 Ga0068852_101728541 3300005616 Unclassified 648
151 Ga0068852_102597904 3300005616 Bacteria 526
152 Ga0068859_100079234 3300005617 Bacteria 3325
153 Ga0068864_100331553 3300005618 Bacteria 1432
154 Ga0068864_101977702 3300005618 Unclassified 589
155 Ga0068866_10339732 3300005718 Bacteria 951
156 Ga0068866_11052785 3300005718 Bacteria 581
157 Ga0068866_11229843 3300005718 Bacteria 542
158 Ga0068861_100040849 3300005719 Bacteria 3471
159 Ga0068861_100478381 3300005719 Bacteria 1121
160 Ga0068861_100838972 3300005719 Archaea 865
161 Ga0068861_100942097 3300005719 Bacteria 820
162 Ga0068851_10536304 3300005834 Bacteria 706
163 Ga0068870_10239431 3300005840 Bacteria 1120
164 Ga0068863_100413858 3300005841 Bacteria 1320
165 Ga0068863_101585212 3300005841 Bacteria 664
166 Ga0068858_100306197 3300005842 Bacteria 1517
167 Ga0068860_100387446 3300005843 Bacteria 1381
168 Ga0068862_100248632 3300005844 Bacteria 1620
169 Ga0068862_100399314 3300005844 Bacteria 1286
170 Ga0068862_101449780 3300005844 Bacteria 691
171 Ga0081455_10313907 3300005937 Bacteria 1119
172 Ga0070717_10000069 3300006028 Bacteria 86039
173 Ga0075365_10088967 3300006038 Bacteria 2102
174 Ga0075365_10761261 3300006038 Bacteria 684
175 Ga0075363_100932504 3300006048 Bacteria 533
176 Ga0075432_10147487 3300006058 Archaea 902
177 Ga0075432_10473058 3300006058 Bacteria 554
178 Ga0075367_10637078 3300006178 Bacteria 678
179 Ga0097621_101073864 3300006237 Archaea 755
180 Ga0075428_100372185 3300006844 Archaea 1532
181 Ga0075430_100511595 3300006846 Archaea 991
182 Ga0075430_100595566 3300006846 Bacteria 912
183 Ga0075433_10413187 3300006852 Bacteria 1190
184 Ga0075433_10881913 3300006852 Bacteria 780
185 Ga0075434_100701468 3300006871 Bacteria 1029
186 Ga0075429_100045397 3300006880 Bacteria 3823
187 Ga0075429_101380870 3300006880 Unclassified 614
188 Ga0075429_101513881 3300006880 Archaea 584
189 Ga0068865_100349382 3300006881 Bacteria 1198
190 Ga0068865_100608044 3300006881 Bacteria 925
191 Ga0068865_100623969 3300006881 Archaea 913
192 Ga0075436_100915236 3300006914 Bacteria 656
193 Ga0097620_100079244 3300006931 Bacteria 3325
194 Ga0105240_10007416 3300009093 Bacteria 15936
195 Ga0105240_10974489 3300009093 Bacteria 908
196 Ga0111539_10064239 3300009094 Bacteria 4343
197 Ga0111539_10413929 3300009094 Bacteria 1570
198 Ga0111539_11130367 3300009094 Bacteria 910
199 Ga0105245_10137319 3300009098 Bacteria 2299
200 Ga0105245_11577949 3300009098 Bacteria 708
201 Ga0105245_11831109 3300009098 Bacteria 660
202 Ga0114129_10370275 3300009147 Bacteria 1894
203 Ga0114129_11890546 3300009147 Bacteria 724
204 Ga0105243_10056561 3300009148 Bacteria 3120
205 Ga0105243_10168128 3300009148 Bacteria 1897
206 Ga0105243_10199000 3300009148 Bacteria 1756
207 Ga0105243_11631066 3300009148 Bacteria 672
208 Ga0105241_11306066 3300009174 Bacteria 691
209 Ga0105242_12372519 3300009176 Archaea 577
210 Ga0105248_11435896 3300009177 Bacteria 781
211 Ga0105248_11862056 3300009177 Bacteria 683
212 Ga0105237_10034524 3300009545 Bacteria 5121
213 Ga0105238_10021217 3300009551 Bacteria 6620
214 Ga0105238_10254166 3300009551 Bacteria 1736
215 Ga0105238_10721266 3300009551 Bacteria 1010
216 Ga0105238_11175686 3300009551 Unclassified 791
217 Ga0105238_12715535 3300009551 Bacteria 532
218 Ga0105249_10117917 3300009553 Bacteria 2518
219 Ga0105249_10164158 3300009553 Bacteria 2149
220 Ga0105249_10464538 3300009553 Bacteria 1306
221 Ga0105249_10809256 3300009553 Archaea 1001
222 Ga0105249_11845952 3300009553 Bacteria 677
223 Ga0105239_10191957 3300010375 Bacteria 2286
224 Ga0105239_10349544 3300010375 Bacteria 1669
225 Ga0105239_11619332 3300010375 Bacteria 749
226 Ga0105239_12462102 3300010375 Bacteria 606
227 Ga0105246_10309485 3300011119 Bacteria 1279
228 Ga0105246_11854783 3300011119 Bacteria 578
229 Ga0157371_10458781 3300013102 Bacteria 937
230 Ga0157371_10521485 3300013102 Bacteria 879
231 Ga0157370_10035753 3300013104 Bacteria 4825
232 Ga0157370_12127381 3300013104 Unclassified 503
233 Ga0157369_10034188 3300013105 Bacteria 5581
234 Ga0157369_10206911 3300013105 Bacteria 2058
235 Ga0157369_10533453 3300013105 Bacteria 1214
236 Ga0157369_11789349 3300013105 Bacteria 624
237 Ga0157374_11018650 3300013296 Archaea 847
238 Ga0157374_11285879 3300013296 Bacteria 753
239 Ga0157374_12111933 3300013296 Bacteria 590
240 Ga0157378_12323005 3300013297 Bacteria 588
241 Ga0163162_10335553 3300013306 Bacteria 1644
242 Ga0163162_10442524 3300013306 Bacteria 1432
243 Ga0163162_10644169 3300013306 Bacteria 1184
244 Ga0163162_11136244 3300013306 Bacteria 886
245 Ga0157372_10015328 3300013307 Bacteria 8213
246 Ga0157372_10335877 3300013307 Bacteria 1760
247 Ga0157372_10370687 3300013307 Bacteria 1668
248 Ga0157372_10669156 3300013307 Bacteria 1209
249 Ga0157372_11776937 3300013307 Bacteria 709
250 Ga0157372_12358518 3300013307 Bacteria 611
251 Ga0157372_12521518 3300013307 Unclassified 590
252 Ga0157375_10400521 3300013308 Bacteria 1539
253 Ga0157375_11808592 3300013308 Bacteria 724
254 Ga0163163_10915164 3300014325 Bacteria 940
255 Ga0163163_12671246 3300014325 Bacteria 556
256 Ga0157380_10199658 3300014326 Bacteria 1773
257 Ga0157380_10243173 3300014326 Bacteria 1624
258 Ga0157380_11152754 3300014326 Bacteria 817
259 Ga0157380_12231668 3300014326 Archaea 611
260 Ga0182008_10130628 3300014497 Bacteria 1252
261 Ga0157377_10396688 3300014745 Archaea 938
262 Ga0157377_11124383 3300014745 Unclassified 603
263 Ga0157379_10261319 3300014968 Bacteria 1573
264 Ga0163161_10586359 3300017792 Bacteria 917
265 Ga0163161_10815677 3300017792 Bacteria 785
266 Ga0197907_10333813 3300020069 Bacteria 571
267 Ga0197907_11196280 3300020069 Bacteria 718
268 Ga0197907_11315377 3300020069 Bacteria 1285
269 Ga0206356_10185117 3300020070 Bacteria 850
270 Ga0206356_10702446 3300020070 Bacteria 2079
271 Ga0206356_11040991 3300020070 Bacteria 1253
272 Ga0206356_11537382 3300020070 Bacteria 650
273 Ga0206355_1117640 3300020076 Unclassified 501
274 Ga0206355_1288692 3300020076 Bacteria 592
275 Ga0206355_1567919 3300020076 Bacteria 1083
276 Ga0206352_10764695 3300020078 Bacteria 567
277 Ga0206352_11090162 3300020078 Bacteria 510
278 Ga0206350_10049337 3300020080 Bacteria 700
279 Ga0206350_10107478 3300020080 Bacteria 646
280 Ga0206354_10832481 3300020081 Bacteria 582
281 Ga0206354_10953384 3300020081 Bacteria 622
282 Ga0206353_11663949 3300020082 Bacteria 625
283 Ga0154015_1472852 3300020610 Bacteria 1299
284 Ga0154015_1479429 3300020610 Bacteria 508
285 Ga0224712_10397787 3300022467 Bacteria 656
286 Ga0224712_10586367 3300022467 Bacteria 544
287 Ga0224712_10629905 3300022467 Bacteria 525
288 Ga0207697_10547871 3300025315 Bacteria 509
289 Ga0207710_10061709 3300025900 Bacteria 1702
290 Ga0207688_10062432 3300025901 Bacteria 2100
291 Ga0207688_10803004 3300025901 Bacteria 596
292 Ga0207647_10474273 3300025904 Unclassified 699
293 Ga0207643_10230690 3300025908 Bacteria 1135
294 Ga0207643_10462955 3300025908 Archaea 808
295 Ga0207705_10162050 3300025909 Bacteria 1681
296 Ga0207707_10030721 3300025912 Bacteria 4699
297 Ga0207707_10393562 3300025912 Unclassified 1190
298 Ga0207707_10444833 3300025912 Unclassified 1109
299 Ga0207695_10137778 3300025913 Bacteria 2392
300 Ga0207695_11698484 3300025913 Bacteria 512
301 Ga0207671_10036586 3300025914 Bacteria 3641
302 Ga0207671_11481563 3300025914 Bacteria 524
303 Ga0207660_10006356 3300025917 Bacteria 7659
304 Ga0207660_10457521 3300025917 Bacteria 1032
305 Ga0207660_11153697 3300025917 Bacteria 631
306 Ga0207657_10002314 3300025919 Bacteria 20663
307 Ga0207657_10018312 3300025919 Bacteria 6691
308 Ga0207657_10229148 3300025919 Bacteria 1486
309 Ga0207657_10263415 3300025919 Bacteria 1371
310 Ga0207657_10299098 3300025919 Bacteria 1275
311 Ga0207657_10432160 3300025919 Bacteria 1034
312 Ga0207657_10605744 3300025919 Bacteria 854
313 Ga0207649_10013200 3300025920 Bacteria 4609
314 Ga0207652_10000984 3300025921 Bacteria 26404
315 Ga0207652_10015760 3300025921 Bacteria 6156
316 Ga0207652_10130647 3300025921 Bacteria 2240
317 Ga0207652_10773431 3300025921 Bacteria 854
318 Ga0207681_10944483 3300025923 Bacteria 723
319 Ga0207681_11494092 3300025923 Bacteria 566
320 Ga0207694_10092860 3300025924 Bacteria 2383
321 Ga0207694_11328591 3300025924 Bacteria 608
322 Ga0207650_10368610 3300025925 Bacteria 1184
323 Ga0207659_11059880 3300025926 Archaea 698
324 Ga0207659_11187573 3300025926 Bacteria 656
325 Ga0207687_10330881 3300025927 Bacteria 1236
326 Ga0207687_10974219 3300025927 Archaea 727
327 Ga0207687_11345868 3300025927 Bacteria 614
328 Ga0207687_11760215 3300025927 Unclassified 531
329 Ga0207664_10013354 3300025929 Bacteria 5891
330 Ga0207664_11130075 3300025929 Bacteria 700
331 Ga0207690_10000165 3300025932 Bacteria 51537
332 Ga0207690_10046410 3300025932 Bacteria 2877
333 Ga0207690_10071679 3300025932 Bacteria 2390
334 Ga0207690_11260429 3300025932 Bacteria 618
335 Ga0207690_11794590 3300025932 Bacteria 512
336 Ga0207706_10495239 3300025933 Bacteria 1055
337 Ga0207686_10739675 3300025934 Bacteria 784
338 Ga0207686_10957767 3300025934 Bacteria 693
339 Ga0207709_10223629 3300025935 Bacteria 1359
340 Ga0207709_10865868 3300025935 Unclassified 733
341 Ga0207709_11036482 3300025935 Bacteria 672
342 Ga0207709_11129844 3300025935 Unclassified 644
343 Ga0207670_10168276 3300025936 Bacteria 1641
344 Ga0207670_11431603 3300025936 Bacteria 587
345 Ga0207669_10123123 3300025937 Bacteria 1765
346 Ga0207669_10214806 3300025937 Bacteria 1407
347 Ga0207669_11137235 3300025937 Unclassified 660
348 Ga0207704_10087375 3300025938 Bacteria 2036
349 Ga0207704_10721505 3300025938 Bacteria 827
350 Ga0207704_10976952 3300025938 Archaea 715
351 Ga0207704_11293172 3300025938 Bacteria 623
352 Ga0207691_10216573 3300025940 Bacteria 1662
353 Ga0207691_10633860 3300025940 Bacteria 904
354 Ga0207711_10058584 3300025941 Bacteria 3315
355 Ga0207711_10922928 3300025941 Bacteria 811
356 Ga0207689_10742237 3300025942 Archaea 828
357 Ga0207689_10914359 3300025942 Bacteria 740
358 Ga0207689_11064256 3300025942 Bacteria 682
359 Ga0207661_10006603 3300025944 Bacteria 8200
360 Ga0207661_10141585 3300025944 Unclassified 2070
361 Ga0207661_10466821 3300025944 Bacteria 1151
362 Ga0207661_12088583 3300025944 Unclassified 513
363 Ga0207679_10476885 3300025945 Bacteria 1110
364 Ga0207679_11864176 3300025945 Unclassified 549
365 Ga0207667_10144746 3300025949 Bacteria 2447
366 Ga0207667_10472832 3300025949 Bacteria 1273
367 Ga0207651_10563592 3300025960 Bacteria 992
368 Ga0207712_10055938 3300025961 Bacteria 2778
369 Ga0207712_12146366 3300025961 Unclassified 500
370 Ga0207668_10860380 3300025972 Bacteria 805
371 Ga0207668_11309613 3300025972 Archaea 652
372 Ga0207640_10140885 3300025981 Bacteria 1758
373 Ga0207640_10263125 3300025981 Bacteria 1345
374 Ga0207640_10425020 3300025981 Bacteria 1088
375 Ga0207640_11245490 3300025981 Unclassified 663
376 Ga0207658_10430858 3300025986 Bacteria 1165
377 Ga0207658_10590668 3300025986 Bacteria 997
378 Ga0207677_10315226 3300026023 Bacteria 1297
379 Ga0207677_11023812 3300026023 Bacteria 750
380 Ga0207703_10413866 3300026035 Bacteria 1253
381 Ga0207678_10244933 3300026067 Bacteria 1535
382 Ga0207708_10041693 3300026075 Bacteria 3499
383 Ga0207708_10257169 3300026075 Bacteria 1408
384 Ga0207708_10424911 3300026075 Bacteria 1102
385 Ga0207702_10066256 3300026078 Bacteria 3095
386 Ga0207641_10241716 3300026088 Bacteria 1683
387 Ga0207641_12210147 3300026088 Bacteria 550
388 Ga0207648_10137100 3300026089 Bacteria 2156
389 Ga0207648_10466492 3300026089 Bacteria 1152
390 Ga0207676_10466679 3300026095 Bacteria 1193
391 Ga0207676_11215759 3300026095 Bacteria 747
392 Ga0207674_10118134 3300026116 Bacteria 2622
393 Ga0207674_10385741 3300026116 Bacteria 1354
394 Ga0207674_10901994 3300026116 Bacteria 852
395 Ga0207675_100033813 3300026118 Bacteria 4764
396 Ga0207675_100124135 3300026118 Bacteria 2445
397 Ga0207675_100357036 3300026118 Bacteria 1433
398 Ga0207683_10092729 3300026121 Bacteria 2691
399 Ga0207683_10321924 3300026121 Bacteria 1416
400 Ga0207698_10034670 3300026142 Bacteria 3682
401 Ga0207698_10430807 3300026142 Bacteria 1268
402 Ga0207698_12289817 3300026142 Unclassified 552
403 Ga0209813_10483550 3300027866 Unclassified 511
404 Ga0207428_10835438 3300027907 Archaea 653
405 Ga0207428_10924005 3300027907 Unclassified 616
406 Ga0268265_11062964 3300028380 Bacteria 802
407 Ga0268265_11196380 3300028380 Bacteria 757
408 Ga0307405_10231020 3300031731 Bacteria 1364
409 Ga0307410_10429053 3300031852 Bacteria 1074
410 Ga0307407_11115554 3300031903 Unclassified 614
411 Ga0307407_11686331 3300031903 Bacteria 504
412 Ga0307409_100580760 3300031995 Bacteria 1105
413 Ga0307409_101236147 3300031995 Bacteria 771
414 Ga0307409_102576272 3300031995 Bacteria 537
415 Ga0307409_102635028 3300031995 Bacteria 531
416 Ga0307416_100537806 3300032002 Unclassified 1240
417 Ga0307416_100579979 3300032002 Bacteria 1199
418 Ga0307416_101134589 3300032002 Unclassified 887
419 Ga0307416_102360766 3300032002 Archaea 632
420 Ga0307411_10786340 3300032005 Archaea 837
421 Ga0307411_10911230 3300032005 Bacteria 782
422 Ga0307415_101235745 3300032126 Unclassified 705
423 Ga0307415_101236570 3300032126 Bacteria 705
424 Ga0373961_0337912 3300035241 Bacteria 565
425 Ga0373931_0916723 3300035691 Bacteria 590
426 Ga0395899_0580355 3300037312 Bacteria 717
427 Ga0395899_0755816 3300037312 Bacteria 605
428 Ga0395899_0908235 3300037312 Bacteria 537
429 Ga0395900_0988558 3300037418 Bacteria 762
430 Ga0395901_0244183 3300038443 Bacteria 1872
431 Ga0395901_1292572 3300038443 Bacteria 692
432 Ga0242420_035048 3300038996 Bacteria 943
433 Ga0451804_0049696 3300041463 Archaea 805
434 Ga0451807_2673068 3300041486 Unclassified 579
435 Ga0451835_0739753 3300041492 Archaea 633
436 Ga0451853_2394529 3300041512 Bacteria 767
437 Ga0439440_0281315 3300042993 Bacteria 514
438 Ga0466969_0029068 3300044656 Bacteria 2825
439 Ga0466972_0111317 3300044658 Bacteria 1294
440 Ga0466965_0662962 3300044683 Bacteria 596
441 Ga0466966_0042608 3300044684 Bacteria 2912
442 Ga0466966_0251619 3300044684 Bacteria 1064
443 Ga0466961_0021219 3300044693 Bacteria 4181
444 Ga0466961_0614970 3300044693 Bacteria 653
445 Ga0466963_0182507 3300044694 Bacteria 1465
446 Ga0466963_0213887 3300044694 Bacteria 1349
447 Ga0466963_0583773 3300044694 Bacteria 789
448 Ga0466963_0731816 3300044694 Bacteria 698
449 Ga0466964_0191909 3300044706 Bacteria 975
450 Ga0466964_0239421 3300044706 Bacteria 889
451 Ga0466964_0624962 3300044706 Unclassified 593
452 Ga0466971_0060204 3300044719 Bacteria 1716
453 Ga0466971_0353772 3300044719 Unclassified 711
454 Ga0466971_0606545 3300044719 Unclassified 546
455 Ga0466968_0653518 3300044735 Unclassified 534
456 Ga0466970_0591779 3300044765 Bacteria 643
457 Ga0466957_0085119 3300044842 Bacteria 1974
458 Ga0466957_0183074 3300044842 Bacteria 1369
459 Ga0466957_0325328 3300044842 Bacteria 1038
460 Ga0466957_1102485 3300044842 Bacteria 572
461 Ga0466960_0182255 3300044901 Bacteria 1139
462 Ga0466960_0282998 3300044901 Bacteria 930
463 Ga0466960_0302629 3300044901 Bacteria 901
464 Ga0466960_0313187 3300044901 Bacteria 887
465 Ga0466960_0330544 3300044901 Bacteria 865
466 Ga0466960_0486516 3300044901 Bacteria 721
467 Ga0466960_0506642 3300044901 Bacteria 708
468 Ga0466960_1017878 3300044901 Bacteria 509
469 Ga0466959_0047340 3300045049 Bacteria 3163
470 Ga0466959_1119763 3300045049 Unclassified 523
471 Ga0466958_0072889 3300045836 Bacteria 2103
472 Ga0466958_0102960 3300045836 Bacteria 1777
473 Ga0466958_1047149 3300045836 Unclassified 532
474 Ga0466967_0025563 3300045976 Bacteria 4872
475 Ga0466967_0063988 3300045976 Bacteria 3270
476 Ga0466967_0078002 3300045976 Bacteria 2983
477 Ga0466967_0116501 3300045976 Bacteria 2461
478 Ga0466967_0263515 3300045976 Bacteria 1649
479 Ga0466967_0334952 3300045976 Bacteria 1462
480 Ga0466967_0555851 3300045976 Bacteria 1130
481 Ga0466967_0626058 3300045976 Bacteria 1063
482 Ga0466967_1000574 3300045976 Bacteria 832
483 Ga0466967_1083571 3300045976 Bacteria 798
484 Ga0466967_1381043 3300045976 Bacteria 701
485 Ga0466967_1585845 3300045976 Bacteria 652
486 Ga0466967_1718353 3300045976 Bacteria 625
487 Ga0466967_1758674 3300045976 Bacteria 617
488 Ga0466967_1908176 3300045976 Bacteria 591
489 Ga0495664_0000007 3300046477 Bacteria 386710
490 Ga0495620_0404075 3300046515 Bacteria 517
491 Ga0495631_0290313 3300046518 Bacteria 696
492 Ga0495637_0297957 3300046520 Bacteria 573
493 Ga0495656_0684645 3300046615 Bacteria 551
494 Ga0495589_0561653 3300046794 Bacteria 520
495 Ga0495686_0624316 3300047472 Bacteria 556
496 Ga0496100_0108852 3300048903 Bacteria 1922
497 Ga0496100_0457980 3300048903 Bacteria 978
498 Ga0496100_0864159 3300048903 Archaea 710
499 Ga0496101_0003327 3300048904 Bacteria 10002
500 Ga0496101_0312096 3300048904 Bacteria 1233
501 Ga0496102_0131708 3300048905 Bacteria 2341
502 Ga0496102_0288199 3300048905 Bacteria 1548
503 Ga0496102_0334673 3300048905 Bacteria 1426
504 Ga0496102_0490748 3300048905 Bacteria 1150
505 Ga0496102_0706363 3300048905 Bacteria 931
506 Ga0496103_0051007 3300048906 Bacteria 2560
507 Ga0496103_0198609 3300048906 Bacteria 1290
508 Ga0496104_1232683 3300048907 Bacteria 651
509 Ga0496105_0057731 3300048908 Bacteria 3204
510 Ga0496105_0805619 3300048908 Bacteria 714
511 Ga0496106_0012787 3300048909 Bacteria 6196
512 Ga0496106_0293326 3300048909 Bacteria 1304
513 Ga0496106_0327041 3300048909 Unclassified 1231
514 Ga0496106_0528059 3300048909 Bacteria 947
515 Ga0496107_0002033 3300048910 Bacteria 12923
516 Ga0496107_0217367 3300048910 Bacteria 1421
517 Ga0496107_0261527 3300048910 Bacteria 1288
518 Ga0496107_0836313 3300048910 Bacteria 673
519 Ga0496108_0079248 3300048911 Bacteria 2781
520 Ga0496108_0466612 3300048911 Bacteria 1103
521 Ga0496108_1299497 3300048911 Bacteria 612
522 Ga0496108_1572698 3300048911 Bacteria 545
523 Ga0496109_0294337 3300048912 Bacteria 1530
524 Ga0496109_0338334 3300048912 Bacteria 1421
525 Ga0496109_1669837 3300048912 Bacteria 571
526 Ga0496111_0409813 3300048914 Unclassified 1001
527 Ga0496111_1078079 3300048914 Bacteria 573
528 Ga0496112_0233817 3300048915 Archaea 1792
529 Ga0496112_0364792 3300048915 Bacteria 1386
530 Ga0496113_0110915 3300048916 Bacteria 2135
531 Ga0496113_0212546 3300048916 Bacteria 1540
532 Ga0496113_0336292 3300048916 Bacteria 1211
533 Ga0496114_0653504 3300048917 Bacteria 925
534 Ga0496115_0120651 3300048918 Bacteria 2157
535 Ga0501033_1110990 3300049570 Bacteria 525
536 Ga0501036_0573089 3300049572 Bacteria 937
537 Ga0501036_1727802 3300049572 Bacteria 504
538 Ga0501037_0058277 3300049573 Bacteria 2819
539 Ga0501038_0343662 3300049574 Bacteria 1163
540 Ga0501038_0435790 3300049574 Bacteria 1010
541 Ga0501038_1311831 3300049574 Archaea 522
542 Ga0501039_0045809 3300049575 Bacteria 3379
543 Ga0501039_0096877 3300049575 Archaea 2300
544 Ga0501039_1128950 3300049575 Archaea 607
545 Ga0501040_0208043 3300049576 Bacteria 1390
546 Ga0501040_0326144 3300049576 Bacteria 1098
547 Ga0501042_0147738 3300049578 Archaea 1695
548 Ga0501042_0247840 3300049578 Bacteria 1285
549 Ga0501043_0566746 3300049579 Bacteria 842
550 Ga0501046_0512256 3300049580 Bacteria 858
551 Ga0501048_0049946 3300049582 Bacteria 2980
552 Ga0501048_0138252 3300049582 Bacteria 1722
553 Ga0501048_0208947 3300049582 Bacteria 1384
554 Ga0501067_0263236 3300049583 Bacteria 960
555 Ga0501067_0462507 3300049583 Unclassified 709
556 Ga0501068_0241908 3300049584 Bacteria 1149
557 Ga0501068_0811495 3300049584 Bacteria 614
558 Ga0501069_0114843 3300049585 Unclassified 1535
559 Ga0501069_0534847 3300049585 Bacteria 701
560 Ga0501070_0711551 3300049586 Bacteria 794
561 Ga0501071_0148762 3300049587 Bacteria 1746
562 Ga0501071_0183741 3300049587 Bacteria 1567
563 Ga0501071_0381227 3300049587 Bacteria 1075
564 Ga0501071_1451245 3300049587 Unclassified 530
565 Ga0501072_0346505 3300049588 Bacteria 1179
566 Ga0501072_0637237 3300049588 Bacteria 839
567 Ga0501074_0314904 3300049590 Bacteria 1111
568 Ga0501074_0786574 3300049590 Bacteria 670
569 Ga0501074_0820411 3300049590 Unclassified 655
570 Ga0501074_1122644 3300049590 Bacteria 552
571 Ga0501075_0251664 3300049591 Bacteria 1347
572 Ga0501075_0337366 3300049591 Archaea 1149
573 Ga0501075_0459938 3300049591 Bacteria 970
574 Ga0501075_1226523 3300049591 Archaea 569
575 Ga0501076_0068496 3300049592 Bacteria 2835
576 Ga0501076_0255469 3300049592 Bacteria 1434
577 Ga0501077_0133819 3300049593 Bacteria 1572
578 Ga0501077_0492699 3300049593 Bacteria 786
579 Ga0501079_0402223 3300049741 Archaea 1074
580 Ga0501079_0423337 3300049741 Bacteria 1045
581 Ga0501081_0119635 3300049743 Bacteria 1875
582 Ga0501083_0904173 3300049744 Bacteria 574
583 Ga0501035_0179169 3300049822 Unclassified 1827
584 Ga0501035_1281169 3300049822 Unclassified 566
585 Ga0501044_1102692 3300049823 Bacteria 663
586 Ga0501045_0488584 3300049824 Bacteria 914
587 nmdc:mga03n38_233234_c1 3300050490 Bacteria 965
588 nmdc:mga0yw44_990364_c1 3300050492 Bacteria 569
589 nmdc:mga04h51_169428_c1 3300050495 Bacteria 844
590 nmdc:mga09592_41720_c1 3300050508 Bacteria 3859
591 nmdc:mga0qj67_697258_c1 3300050509 Bacteria 808
592 nmdc:mga08y16_188009_c1 3300050511 Bacteria 2143
593 nmdc:mga08y16_242671_c1 3300050511 Bacteria 1862
594 nmdc:mga0n895_277538_c1 3300050512 Bacteria 1699
595 nmdc:mga0n895_308353_c1 3300050512 Bacteria 1604
596 nmdc:mga0rr50_991154_c1 3300050513 Bacteria 716
597 nmdc:mga08x19_1135164_c1 3300050514 Unclassified 554
598 nmdc:mga0a205_974994_c1 3300050515 Bacteria 695
599 Ga0495655_0219929 3300053083 Bacteria 628
600 Ga0495655_0252713 3300053083 Bacteria 593
601 Ga0500627_0166569 3300053158 Bacteria 994
602 Ga0501084_0031521 3300054114 Bacteria 4432
603 Ga0501084_0680024 3300054114 Archaea 868
604 Ga0501084_0778995 3300054114 Bacteria 806
605 Ga0501084_1455824 3300054114 Bacteria 573
606 Ga0590075_205373 3300059424 Bacteria 522
607 Ga0587084_126458 3300059477 Bacteria 542
608 Ga0587066_140427 3300059490 Bacteria 589
609 Ga0587073_0226100 3300059492 Unclassified 574
610 Ga0587083_0176658 3300059505 Bacteria 595
611 Ga0587091_115945 3300059511 Bacteria 645
612 Ga0587091_224877 3300059511 Bacteria 515
613 Ga0587099_044145 3300059622 Bacteria 579
614 Ga0587109_160631 3300059624 Bacteria 562
615 Ga0587128_125750 3300059630 Bacteria 562
616 Ga0587130_029086 3300059631 Bacteria 630
617 Ga0587062_049460 3300059639 Bacteria 707
618 Ga0587062_115275 3300059639 Bacteria 538
619 Ga0587068_106005 3300059641 Bacteria 595
620 Ga0587075_062606 3300059644 Bacteria 674
621 Ga0587114_085406 3300059655 Bacteria 594
622 Ga0466962_0017292 3300061719 Bacteria 3473
623 Ga0466962_0045562 3300061719 Bacteria 2096
624 Ga0530510_0104423 3300061734 Bacteria 2073
625 Ga0530510_0652534 3300061734 Bacteria 801
626 Ga0070660_100705419
627 JGI24737J22298_10194445
628 JGI24743J22301_10016952
629 JGI24034J26672_10043090
630 Ga0006777J48905_1011881
631 Ga0006781J51513_1003364
632 Ga0007410J51695_1017613
633 Ga0007409J51694_1018556
634 Ga0007416J51690_1008078
635 Ga0007416J51690_1024874
636 Ga0007429J51699_1002066
637 Ga0070658_10081452
638 Ga0070658_10089012
639 Ga0070658_10311237
640 Ga0070683_100040969
641 Ga0070683_100121397
642 Ga0070683_100189206
643 Ga0070683_101823728
644 Ga0070690_100823033
645 Ga0070677_10800682
646 Ga0068869_101760553
647 Ga0070680_100002730
648 Ga0070680_100317593
649 Ga0070680_100440406
650 Ga0070680_101303249
651 Ga0070680_101388087
652 Ga0070680_101959321
653 Ga0070682_100034437
654 Ga0070682_100151748
655 Ga0070682_100409542
656 Ga0070682_100647312
657 Ga0068868_100593320
658 Ga0068868_100992546
659 Ga0068868_101911458
660 Ga0070660_100026031
661 Ga0070660_100187680
662 Ga0070660_100246655
663 Ga0070660_100260828
664 Ga0070660_100478025
665 Ga0070660_100543731
666 Ga0070660_100942039
667 Ga0070689_100069122
668 Ga0070689_100394211
669 Ga0070691_10182366
670 Ga0070691_10608184
671 Ga0070661_100019910
672 Ga0070661_100114736
673 Ga0070661_100782668
674 Ga0070692_10312871
675 Ga0070692_10829440
676 Ga0070692_10931392
677 Ga0070668_101304606
678 Ga0070668_101394191
679 Ga0070668_102092171
680 Ga0070669_100643189
681 Ga0070675_100512496
682 Ga0070675_101100453
683 Ga0070675_101532635
684 Ga0070671_100342005
685 Ga0070674_100149015
686 Ga0070674_100168313
687 Ga0070673_100925945
688 Ga0070673_100928934
689 Ga0070673_100934800
690 Ga0070688_100033828
691 Ga0070688_100773978
692 Ga0070659_100000160
693 Ga0070659_100004055
694 Ga0070659_100150351
695 Ga0070659_100234170
696 Ga0070659_101546554
697 Ga0070714_100011718
698 Ga0070714_101506054
699 Ga0070701_10056908
700 Ga0070701_10279691
701 Ga0070701_10934719
702 Ga0070705_100001935
703 Ga0070705_100164917
704 Ga0070705_100579515
705 Ga0070705_101275434
706 Ga0070700_100256283
707 Ga0070700_100521766
708 Ga0070694_100306923
709 Ga0070694_101611314
710 Ga0070663_101412718
711 Ga0070678_100752208
712 Ga0070678_100839766
713 Ga0070678_100960931
714 Ga0070678_102282131
715 Ga0070662_100700920
716 Ga0070681_10015180
717 Ga0070681_10166260
718 Ga0068867_100126113
719 Ga0068867_100432153
720 Ga0068867_101081369
721 Ga0068867_101156584
722 Ga0068867_101775114
723 Ga0070685_10014837
724 Ga0070685_11381876
725 Ga0070699_100905375
726 Ga0070679_100035087
727 Ga0070679_100049072
728 Ga0070679_100223228
729 Ga0070679_100279910
730 Ga0070684_100018851
731 Ga0070684_100267203
732 Ga0070684_100302227
733 Ga0068853_100007671
734 Ga0068853_100807388
735 Ga0068853_101095771
736 Ga0070686_100028286
737 Ga0070695_100203444
738 Ga0070695_100831029
739 Ga0070695_101720058
740 Ga0070695_101784233
741 Ga0070696_100167406
742 Ga0070696_100453052
743 Ga0070696_101430800
744 Ga0070693_100422102
745 Ga0070693_101025009
746 Ga0070693_101416961
747 Ga0070665_100180187
748 Ga0070704_100076801
749 Ga0070704_100279400
750 Ga0070704_100807059
751 Ga0070704_100830617
752 Ga0068855_100118647
753 Ga0068855_101092949
754 Ga0068855_101636929
755 Ga0070664_100165835
756 Ga0070664_100395298
757 Ga0070664_100580235
758 Ga0070664_100811889
759 Ga0068857_100251211
760 Ga0068857_100952074
761 Ga0068854_100069803
762 Ga0068854_100403483
763 Ga0068854_101629183
764 Ga0068856_100162438
765 Ga0068856_101255516
766 Ga0068856_101612399
767 Ga0068856_101869861
768 Ga0070702_100034138
769 Ga0070702_100621294
770 Ga0070702_101097684
771 Ga0068852_100029025
772 Ga0068852_100254841
773 Ga0068852_100280581
774 Ga0068852_100454532
775 Ga0068852_101728541
776 Ga0068852_102597904
777 Ga0068859_100079234
778 Ga0068864_100331553
779 Ga0068864_101977702
780 Ga0068866_10339732
781 Ga0068866_11052785
782 Ga0068866_11229843
783 Ga0068861_100040849
784 Ga0068861_100478381
785 Ga0068861_100838972
786 Ga0068861_100942097
787 Ga0068851_10536304
788 Ga0068870_10239431
789 Ga0068863_100413858
790 Ga0068863_101585212
791 Ga0068858_100306197
792 Ga0068860_100387446
793 Ga0068862_100248632
794 Ga0068862_100399314
795 Ga0068862_101449780
796 Ga0081455_10313907
797 Ga0070717_10000069
798 Ga0075365_10088967
799 Ga0075365_10761261
800 Ga0075363_100932504
801 Ga0075432_10147487
802 Ga0075432_10473058
803 Ga0075367_10637078
804 Ga0097621_101073864
805 Ga0075428_100372185
806 Ga0075430_100511595
807 Ga0075430_100595566
808 Ga0075433_10413187
809 Ga0075433_10881913
810 Ga0075434_100701468
811 Ga0075429_100045397
812 Ga0075429_101380870
813 Ga0075429_101513881
814 Ga0068865_100349382
815 Ga0068865_100608044
816 Ga0068865_100623969
817 Ga0075436_100915236
818 Ga0097620_100079244
819 Ga0105240_10007416
820 Ga0105240_10974489
821 Ga0111539_10064239
822 Ga0111539_10413929
823 Ga0111539_11130367
824 Ga0105245_10137319
825 Ga0105245_11577949
826 Ga0105245_11831109
827 Ga0114129_10370275
828 Ga0114129_11890546
829 Ga0105243_10056561
830 Ga0105243_10168128
831 Ga0105243_10199000
832 Ga0105243_11631066
833 Ga0105241_11306066
834 Ga0105242_12372519
835 Ga0105248_11435896
836 Ga0105248_11862056
837 Ga0105237_10034524
838 Ga0105238_10021217
839 Ga0105238_10254166
840 Ga0105238_10721266
841 Ga0105238_11175686
842 Ga0105238_12715535
843 Ga0105249_10117917
844 Ga0105249_10164158
845 Ga0105249_10464538
846 Ga0105249_10809256
847 Ga0105249_11845952
848 Ga0105239_10191957
849 Ga0105239_10349544
850 Ga0105239_11619332
851 Ga0105239_12462102
852 Ga0105246_10309485
853 Ga0105246_11854783
854 Ga0157371_10458781
855 Ga0157371_10521485
856 Ga0157370_10035753
857 Ga0157370_12127381
858 Ga0157369_10034188
859 Ga0157369_10206911
860 Ga0157369_10533453
861 Ga0157369_11789349
862 Ga0157374_11018650
863 Ga0157374_11285879
864 Ga0157374_12111933
865 Ga0157378_12323005
866 Ga0163162_10335553
867 Ga0163162_10442524
868 Ga0163162_10644169
869 Ga0163162_11136244
870 Ga0157372_10015328
871 Ga0157372_10335877
872 Ga0157372_10370687
873 Ga0157372_10669156
874 Ga0157372_11776937
875 Ga0157372_12358518
876 Ga0157372_12521518
877 Ga0157375_10400521
878 Ga0157375_11808592
879 Ga0163163_10915164
880 Ga0163163_12671246
881 Ga0157380_10199658
882 Ga0157380_10243173
883 Ga0157380_11152754
884 Ga0157380_12231668
885 Ga0182008_10130628
886 Ga0157377_10396688
887 Ga0157377_11124383
888 Ga0157379_10261319
889 Ga0163161_10586359
890 Ga0163161_10815677
891 Ga0197907_10333813
892 Ga0197907_11196280
893 Ga0197907_11315377
894 Ga0206356_10185117
895 Ga0206356_10702446
896 Ga0206356_11040991
897 Ga0206356_11537382
898 Ga0206355_1117640
899 Ga0206355_1288692
900 Ga0206355_1567919
901 Ga0206352_10764695
902 Ga0206352_11090162
903 Ga0206350_10049337
904 Ga0206350_10107478
905 Ga0206354_10832481
906 Ga0206354_10953384
907 Ga0206353_11663949
908 Ga0154015_1472852
909 Ga0154015_1479429
910 Ga0224712_10397787
911 Ga0224712_10586367
912 Ga0224712_10629905
913 Ga0207697_10547871
914 Ga0207710_10061709
915 Ga0207688_10062432
916 Ga0207688_10803004
917 Ga0207647_10474273
918 Ga0207643_10230690
919 Ga0207643_10462955
920 Ga0207705_10162050
921 Ga0207707_10030721
922 Ga0207707_10393562
923 Ga0207707_10444833
924 Ga0207695_10137778
925 Ga0207695_11698484
926 Ga0207671_10036586
927 Ga0207671_11481563
928 Ga0207660_10006356
929 Ga0207660_10457521
930 Ga0207660_11153697
931 Ga0207657_10002314
932 Ga0207657_10018312
933 Ga0207657_10229148
934 Ga0207657_10263415
935 Ga0207657_10299098
936 Ga0207657_10432160
937 Ga0207657_10605744
938 Ga0207649_10013200
939 Ga0207652_10000984
940 Ga0207652_10015760
941 Ga0207652_10130647
942 Ga0207652_10773431
943 Ga0207681_10944483
944 Ga0207681_11494092
945 Ga0207694_10092860
946 Ga0207694_11328591
947 Ga0207650_10368610
948 Ga0207659_11059880
949 Ga0207659_11187573
950 Ga0207687_10330881
951 Ga0207687_10974219
952 Ga0207687_11345868
953 Ga0207687_11760215
954 Ga0207664_10013354
955 Ga0207664_11130075
956 Ga0207690_10000165
957 Ga0207690_10046410
958 Ga0207690_10071679
959 Ga0207690_11260429
960 Ga0207690_11794590
961 Ga0207706_10495239
962 Ga0207686_10739675
963 Ga0207686_10957767
964 Ga0207709_10223629
965 Ga0207709_10865868
966 Ga0207709_11036482
967 Ga0207709_11129844
968 Ga0207670_10168276
969 Ga0207670_11431603
970 Ga0207669_10123123
971 Ga0207669_10214806
972 Ga0207669_11137235
973 Ga0207704_10087375
974 Ga0207704_10721505
975 Ga0207704_10976952
976 Ga0207704_11293172
977 Ga0207691_10216573
978 Ga0207691_10633860
979 Ga0207711_10058584
980 Ga0207711_10922928
981 Ga0207689_10742237
982 Ga0207689_10914359
983 Ga0207689_11064256
984 Ga0207661_10006603
985 Ga0207661_10141585
986 Ga0207661_10466821
987 Ga0207661_12088583
988 Ga0207679_10476885
989 Ga0207679_11864176
990 Ga0207667_10144746
991 Ga0207667_10472832
992 Ga0207651_10563592
993 Ga0207712_10055938
994 Ga0207712_12146366
995 Ga0207668_10860380
996 Ga0207668_11309613
997 Ga0207640_10140885
998 Ga0207640_10263125
999 Ga0207640_10425020
1000 Ga0207640_11245490
1001 Ga0207658_10430858
1002 Ga0207658_10590668
1003 Ga0207677_10315226
1004 Ga0207677_11023812
1005 Ga0207703_10413866
1006 Ga0207678_10244933
1007 Ga0207708_10041693
1008 Ga0207708_10257169
1009 Ga0207708_10424911
1010 Ga0207702_10066256
1011 Ga0207641_10241716
1012 Ga0207641_12210147
1013 Ga0207648_10137100
1014 Ga0207648_10466492
1015 Ga0207676_10466679
1016 Ga0207676_11215759
1017 Ga0207674_10118134
1018 Ga0207674_10385741
1019 Ga0207674_10901994
1020 Ga0207675_100033813
1021 Ga0207675_100124135
1022 Ga0207675_100357036
1023 Ga0207683_10092729
1024 Ga0207683_10321924
1025 Ga0207698_10034670
1026 Ga0207698_10430807
1027 Ga0207698_12289817
1028 Ga0209813_10483550
1029 Ga0207428_10835438
1030 Ga0207428_10924005
1031 Ga0268265_11062964
1032 Ga0268265_11196380
1033 Ga0307405_10231020
1034 Ga0307410_10429053
1035 Ga0307407_11115554
1036 Ga0307407_11686331
1037 Ga0307409_100580760
1038 Ga0307409_101236147
1039 Ga0307409_102576272
1040 Ga0307409_102635028
1041 Ga0307416_100537806
1042 Ga0307416_100579979
1043 Ga0307416_101134589
1044 Ga0307416_102360766
1045 Ga0307411_10786340
1046 Ga0307411_10911230
1047 Ga0307415_101235745
1048 Ga0307415_101236570
1049 Ga0373961_0337912
1050 Ga0373931_0916723
1051 Ga0395899_0580355
1052 Ga0395899_0755816
1053 Ga0395899_0908235
1054 Ga0395900_0988558
1055 Ga0395901_0244183
1056 Ga0395901_1292572
1057 Ga0242420_035048
1058 Ga0451804_0049696
1059 Ga0451807_2673068
1060 Ga0451835_0739753
1061 Ga0451853_2394529
1062 Ga0439440_0281315
1063 Ga0466969_0029068
1064 Ga0466972_0111317
1065 Ga0466965_0662962
1066 Ga0466966_0042608
1067 Ga0466966_0251619
1068 Ga0466961_0021219
1069 Ga0466961_0614970
1070 Ga0466963_0182507
1071 Ga0466963_0213887
1072 Ga0466963_0583773
1073 Ga0466963_0731816
1074 Ga0466964_0191909
1075 Ga0466964_0239421
1076 Ga0466964_0624962
1077 Ga0466971_0060204
1078 Ga0466971_0353772
1079 Ga0466971_0606545
1080 Ga0466968_0653518
1081 Ga0466970_0591779
1082 Ga0466957_0085119
1083 Ga0466957_0183074
1084 Ga0466957_0325328
1085 Ga0466957_1102485
1086 Ga0466960_0182255
1087 Ga0466960_0282998
1088 Ga0466960_0302629
1089 Ga0466960_0313187
1090 Ga0466960_0330544
1091 Ga0466960_0486516
1092 Ga0466960_0506642
1093 Ga0466960_1017878
1094 Ga0466959_0047340
1095 Ga0466959_1119763
1096 Ga0466958_0072889
1097 Ga0466958_0102960
1098 Ga0466958_1047149
1099 Ga0466967_0025563
1100 Ga0466967_0063988
1101 Ga0466967_0078002
1102 Ga0466967_0116501
1103 Ga0466967_0263515
1104 Ga0466967_0334952
1105 Ga0466967_0555851
1106 Ga0466967_0626058
1107 Ga0466967_1000574
1108 Ga0466967_1083571
1109 Ga0466967_1381043
1110 Ga0466967_1585845
1111 Ga0466967_1718353
1112 Ga0466967_1758674
1113 Ga0466967_1908176
1114 Ga0495664_0000007
1115 Ga0495620_0404075
1116 Ga0495631_0290313
1117 Ga0495637_0297957
1118 Ga0495656_0684645
1119 Ga0495589_0561653
1120 Ga0495686_0624316
1121 Ga0496100_0108852
1122 Ga0496100_0457980
1123 Ga0496100_0864159
1124 Ga0496101_0003327
1125 Ga0496101_0312096
1126 Ga0496102_0131708
1127 Ga0496102_0288199
1128 Ga0496102_0334673
1129 Ga0496102_0490748
1130 Ga0496102_0706363
1131 Ga0496103_0051007
1132 Ga0496103_0198609
1133 Ga0496104_1232683
1134 Ga0496105_0057731
1135 Ga0496105_0805619
1136 Ga0496106_0012787
1137 Ga0496106_0293326
1138 Ga0496106_0327041
1139 Ga0496106_0528059
1140 Ga0496107_0002033
1141 Ga0496107_0217367
1142 Ga0496107_0261527
1143 Ga0496107_0836313
1144 Ga0496108_0079248
1145 Ga0496108_0466612
1146 Ga0496108_1299497
1147 Ga0496108_1572698
1148 Ga0496109_0294337
1149 Ga0496109_0338334
1150 Ga0496109_1669837
1151 Ga0496111_0409813
1152 Ga0496111_1078079
1153 Ga0496112_0233817
1154 Ga0496112_0364792
1155 Ga0496113_0110915
1156 Ga0496113_0212546
1157 Ga0496113_0336292
1158 Ga0496114_0653504
1159 Ga0496115_0120651
1160 Ga0501033_1110990
1161 Ga0501036_0573089
1162 Ga0501036_1727802
1163 Ga0501037_0058277
1164 Ga0501038_0343662
1165 Ga0501038_0435790
1166 Ga0501038_1311831
1167 Ga0501039_0045809
1168 Ga0501039_0096877
1169 Ga0501039_1128950
1170 Ga0501040_0208043
1171 Ga0501040_0326144
1172 Ga0501042_0147738
1173 Ga0501042_0247840
1174 Ga0501043_0566746
1175 Ga0501046_0512256
1176 Ga0501048_0049946
1177 Ga0501048_0138252
1178 Ga0501048_0208947
1179 Ga0501067_0263236
1180 Ga0501067_0462507
1181 Ga0501068_0241908
1182 Ga0501068_0811495
1183 Ga0501069_0114843
1184 Ga0501069_0534847
1185 Ga0501070_0711551
1186 Ga0501071_0148762
1187 Ga0501071_0183741
1188 Ga0501071_0381227
1189 Ga0501071_1451245
1190 Ga0501072_0346505
1191 Ga0501072_0637237
1192 Ga0501074_0314904
1193 Ga0501074_0786574
1194 Ga0501074_0820411
1195 Ga0501074_1122644
1196 Ga0501075_0251664
1197 Ga0501075_0337366
1198 Ga0501075_0459938
1199 Ga0501075_1226523
1200 Ga0501076_0068496
1201 Ga0501076_0255469
1202 Ga0501077_0133819
1203 Ga0501077_0492699
1204 Ga0501079_0402223
1205 Ga0501079_0423337
1206 Ga0501081_0119635
1207 Ga0501083_0904173
1208 Ga0501035_0179169
1209 Ga0501035_1281169
1210 Ga0501044_1102692
1211 Ga0501045_0488584
1212 nmdc:mga03n38_233234_c1
1213 nmdc:mga0yw44_990364_c1
1214 nmdc:mga04h51_169428_c1
1215 nmdc:mga09592_41720_c1
1216 nmdc:mga0qj67_697258_c1
1217 nmdc:mga08y16_188009_c1
1218 nmdc:mga08y16_242671_c1
1219 nmdc:mga0n895_277538_c1
1220 nmdc:mga0n895_308353_c1
1221 nmdc:mga0rr50_991154_c1
1222 nmdc:mga08x19_1135164_c1
1223 nmdc:mga0a205_974994_c1
1224 Ga0495655_0219929
1225 Ga0495655_0252713
1226 Ga0500627_0166569
1227 Ga0501084_0031521
1228 Ga0501084_0680024
1229 Ga0501084_0778995
1230 Ga0501084_1455824
1231 Ga0590075_205373
1232 Ga0587084_126458
1233 Ga0587066_140427
1234 Ga0587073_0226100
1235 Ga0587083_0176658
1236 Ga0587091_115945
1237 Ga0587091_224877
1238 Ga0587099_044145
1239 Ga0587109_160631
1240 Ga0587128_125750
1241 Ga0587130_029086
1242 Ga0587062_049460
1243 Ga0587062_115275
1244 Ga0587068_106005
1245 Ga0587075_062606
1246 Ga0587114_085406
1247 Ga0466962_0017292
1248 Ga0466962_0045562
1249 Ga0530510_0104423
1250 Ga0530510_0652534

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j2n-assembly1.cif.gz_B crystal structure of mycobacteriophage pukovnik xis 0.906 1 27
4j2n-assembly1.cif.gz_A crystal structure of mycobacteriophage pukovnik xis 0.8087 1 45
5i44-assembly4.cif.gz_H-3 structure of raca-dna complex; p21 form 0.8083 5 33
1j5y-assembly1.cif.gz_A crystal structure of transcriptional regulator (tm1602) from thermotoga maritima at 2.3 a resolution 0.8029 5 38
7lxs-assembly1.cif.gz_A structural and biochemical insight into assembly of molecular motors involved in viral dna packaging 0.7939 4 44
ID Description Score Start End Superfamily
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8358 3 38 1.10.10.10
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8181 3 38 1.10.10.10
af_I6YE30_32_77_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8136 5 42 1.10.10.10
5i44H00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8083 5 33 1.10.1660.10
af_P31062_1_68_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7958 4 55 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7V9VPM7-F1-model_v4 deleted 0.9934 1 56
AF-A0A6J4RAV9-F1-model_v4 Translation initiation factor IF-2 N-terminal domain-containing protein 0.9884 1 52
AF-A0A7V8VJZ4-F1-model_v4 DNA-binding protein 0.9879 1 54
AF-A0A838FHI1-F1-model_v4 DNA-binding protein 0.9781 1 48
AF-A0A7W1S1I8-F1-model_v4 deleted 0.9743 1 58

Map