F470186

General Info

Members Datasets Scaffolds Average Seq Length
623 330 623 97

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10173839|Ga0111539_101738393
Length 108
Sequence MSPISGHKEKRMAKAYWVVQYRKIKNPDKLAAYAKLAGPAIQAAGGKFLVRGTPAKVYEGGLKERTVVSEWESLEKAIAGHDSPGYQEALRALGDGAERDLRIVEGVS

Samples

Sample ID Description Type Environment
1 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
187 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
203 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
204 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
205 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
224 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
227 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
228 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
229 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
230 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
231 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
232 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
233 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
236 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
237 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
247 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
250 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
254 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
291 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
294 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
304 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
305 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
306 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
307 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
308 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
309 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
310 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
311 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
321 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
322 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
323 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
324 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
325 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
326 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
327 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
328 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
330 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.3
Nodule 0
Rhizoplane 2.89
Rhizosphere 89.89
Stem 0
Stem Tuber 0
Unclassified 1.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1071966 3300002070 Bacteria 565
2 JGI24742J22300_10068105 3300002244 Bacteria 661
3 JGI25153J46596_10000650 3300003215 Bacteria 21224
4 JGI25153J46596_10138998 3300003215 Bacteria 531
5 rootL2_10030195 3300003322 Bacteria 4070
6 rootH1_10037109 3300003323 Unclassified 1926
7 rootH1_10221863 3300003323 Bacteria 1233
8 Ga0065715_10979403 3300005293 Bacteria 514
9 Ga0070676_10058415 3300005328 Bacteria 2286
10 Ga0070676_10450801 3300005328 Bacteria 905
11 Ga0070670_100086582 3300005331 Bacteria 2692
12 Ga0070677_10217563 3300005333 Bacteria 931
13 Ga0068869_100030710 3300005334 Bacteria 3774
14 Ga0068869_100226418 3300005334 Bacteria 1484
15 Ga0068869_100265826 3300005334 Bacteria 1375
16 Ga0068869_101311364 3300005334 Bacteria 639
17 Ga0070666_10048909 3300005335 Bacteria 2841
18 Ga0070680_100054066 3300005336 Bacteria 3278
19 Ga0068868_100914845 3300005338 Bacteria 798
20 Ga0070689_100781394 3300005340 Unclassified 839
21 Ga0070689_101194229 3300005340 Bacteria 683
22 Ga0070687_100055332 3300005343 Bacteria 2072
23 Ga0070687_100943973 3300005343 Unclassified 621
24 Ga0070692_10014768 3300005345 Bacteria 3677
25 Ga0070692_10393159 3300005345 Bacteria 873
26 Ga0070692_11007017 3300005345 Bacteria 583
27 Ga0070668_100015073 3300005347 Bacteria 5775
28 Ga0070668_100023324 3300005347 Bacteria 4680
29 Ga0070669_100001513 3300005353 Bacteria 16797
30 Ga0070669_100576354 3300005353 Bacteria 941
31 Ga0070669_101372647 3300005353 Bacteria 613
32 Ga0070675_100023953 3300005354 Bacteria 4886
33 Ga0070675_100073810 3300005354 Bacteria 2833
34 Ga0070671_100422036 3300005355 Bacteria 1142
35 Ga0070674_100027958 3300005356 Bacteria 3700
36 Ga0070674_100560701 3300005356 Bacteria 960
37 Ga0070674_100670116 3300005356 Bacteria 884
38 Ga0070674_100934199 3300005356 Bacteria 757
39 Ga0070673_100051114 3300005364 Bacteria 3235
40 Ga0070673_101129652 3300005364 Bacteria 733
41 Ga0070673_101534127 3300005364 Bacteria 629
42 Ga0070673_101879356 3300005364 Bacteria 568
43 Ga0070673_102075607 3300005364 Unclassified 540
44 Ga0070688_100091243 3300005365 Bacteria 1991
45 Ga0070659_101442986 3300005366 Bacteria 612
46 Ga0070667_100117970 3300005367 Bacteria 2306
47 Ga0070667_101086173 3300005367 Bacteria 748
48 Ga0070667_101514344 3300005367 Bacteria 630
49 Ga0070667_101579826 3300005367 Bacteria 616
50 Ga0070710_10751865 3300005437 Unclassified 692
51 Ga0070701_10117592 3300005438 Bacteria 1493
52 Ga0070711_100218166 3300005439 Unclassified 1481
53 Ga0070711_101288261 3300005439 Bacteria 634
54 Ga0070705_100363085 3300005440 Bacteria 1060
55 Ga0070705_100438709 3300005440 Bacteria 977
56 Ga0070705_101477116 3300005440 Bacteria 569
57 Ga0070700_100041008 3300005441 Bacteria 2836
58 Ga0070700_100271855 3300005441 Bacteria 1225
59 Ga0070700_100512018 3300005441 Bacteria 925
60 Ga0070700_101103784 3300005441 Bacteria 658
61 Ga0070694_100127943 3300005444 Bacteria 1831
62 Ga0070694_101064416 3300005444 Bacteria 673
63 Ga0070694_101125809 3300005444 Bacteria 656
64 Ga0070694_101566094 3300005444 Unclassified 559
65 Ga0070694_101686978 3300005444 Unclassified 539
66 Ga0070708_100904442 3300005445 Bacteria 829
67 Ga0070708_101668294 3300005445 Bacteria 593
68 Ga0070663_101826592 3300005455 Bacteria 545
69 Ga0070678_100302376 3300005456 Bacteria 1360
70 Ga0070678_100392908 3300005456 Bacteria 1203
71 Ga0070678_100556655 3300005456 Bacteria 1019
72 Ga0070678_101649091 3300005456 Bacteria 603
73 Ga0070662_101112748 3300005457 Bacteria 678
74 Ga0070681_10020205 3300005458 Bacteria 6676
75 Ga0070681_10070711 3300005458 Bacteria 3455
76 Ga0070681_10540625 3300005458 Unclassified 1079
77 Ga0068867_100000729 3300005459 Bacteria 22020
78 Ga0068867_100012294 3300005459 Bacteria 6054
79 Ga0068867_100085715 3300005459 Bacteria 2382
80 Ga0070706_100177584 3300005467 Bacteria 1988
81 Ga0070699_100017541 3300005518 Bacteria 6146
82 Ga0070699_100097770 3300005518 Bacteria 2572
83 Ga0070679_100141101 3300005530 Bacteria 2389
84 Ga0070697_100189249 3300005536 Bacteria 1746
85 Ga0070672_100434306 3300005543 Bacteria 1129
86 Ga0070672_101839839 3300005543 Bacteria 545
87 Ga0070695_100059544 3300005545 Bacteria 2473
88 Ga0070695_100102066 3300005545 Bacteria 1933
89 Ga0070696_100088550 3300005546 Bacteria 2200
90 Ga0070696_100222857 3300005546 Bacteria 1416
91 Ga0070696_100342358 3300005546 Bacteria 1156
92 Ga0070696_100360207 3300005546 Bacteria 1128
93 Ga0070696_100613220 3300005546 Bacteria 878
94 Ga0070696_101903533 3300005546 Bacteria 515
95 Ga0070665_100009397 3300005548 Bacteria 9895
96 Ga0070665_100083934 3300005548 Bacteria 3190
97 Ga0070665_100452033 3300005548 Bacteria 1294
98 Ga0070665_101603816 3300005548 Bacteria 659
99 Ga0070704_100129198 3300005549 Bacteria 1955
100 Ga0070704_100479581 3300005549 Bacteria 1076
101 Ga0070704_100835754 3300005549 Bacteria 825
102 Ga0070704_101136050 3300005549 Bacteria 711
103 Ga0068855_100058069 3300005563 Bacteria 4533
104 Ga0068857_100209841 3300005577 Unclassified 1777
105 Ga0068854_100073499 3300005578 Bacteria 2506
106 Ga0070702_100436117 3300005615 Bacteria 947
107 Ga0070702_100562185 3300005615 Bacteria 849
108 Ga0070702_101294085 3300005615 Bacteria 592
109 Ga0070702_101759084 3300005615 Bacteria 517
110 Ga0068852_101437392 3300005616 Bacteria 712
111 Ga0068859_100122921 3300005617 Bacteria 2663
112 Ga0068859_101628296 3300005617 Bacteria 713
113 Ga0068864_101172485 3300005618 Unclassified 766
114 Ga0068864_101617432 3300005618 Unclassified 652
115 Ga0068866_10011132 3300005718 Bacteria 3880
116 Ga0068861_100001358 3300005719 Bacteria 15388
117 Ga0068861_100592126 3300005719 Bacteria 1016
118 Ga0068861_102621968 3300005719 Unclassified 508
119 Ga0068851_10337002 3300005834 Bacteria 875
120 Ga0068870_10074676 3300005840 Bacteria 1858
121 Ga0068870_10488857 3300005840 Bacteria 818
122 Ga0068870_10855702 3300005840 Bacteria 639
123 Ga0068863_100615008 3300005841 Bacteria 1076
124 Ga0068863_102101096 3300005841 Bacteria 575
125 Ga0068858_100636857 3300005842 Bacteria 1036
126 Ga0068858_101727801 3300005842 Bacteria 618
127 Ga0068858_102518932 3300005842 Bacteria 508
128 Ga0068860_100550606 3300005843 Bacteria 1156
129 Ga0068860_101077138 3300005843 Bacteria 823
130 Ga0068860_101318383 3300005843 Bacteria 743
131 Ga0068862_100003042 3300005844 Bacteria 14608
132 Ga0068862_100557848 3300005844 Bacteria 1094
133 Ga0081538_10129875 3300005981 Bacteria 1187
134 Ga0081540_1000883 3300005983 Bacteria 27092
135 Ga0070717_11072783 3300006028 Bacteria 734
136 Ga0070717_11229111 3300006028 Bacteria 682
137 Ga0075365_10005585 3300006038 Bacteria 6801
138 Ga0075365_10583654 3300006038 Bacteria 790
139 Ga0075368_10211734 3300006042 Bacteria 822
140 Ga0075363_100211303 3300006048 Bacteria 1111
141 Ga0075363_100546363 3300006048 Bacteria 691
142 Ga0075432_10223472 3300006058 Bacteria 754
143 Ga0075432_10325190 3300006058 Bacteria 645
144 Ga0070715_10125740 3300006163 Bacteria 1228
145 Ga0070716_101192180 3300006173 Unclassified 611
146 Ga0070712_100574179 3300006175 Unclassified 952
147 Ga0075362_10151578 3300006177 Bacteria 1112
148 Ga0075367_10134948 3300006178 Bacteria 1527
149 Ga0075366_10135469 3300006195 Bacteria 1487
150 Ga0075370_10448050 3300006353 Unclassified 777
151 Ga0075370_10756301 3300006353 Bacteria 592
152 Ga0068871_101183046 3300006358 Bacteria 717
153 Ga0075428_100066543 3300006844 Bacteria 3945
154 Ga0075428_102168622 3300006844 Bacteria 574
155 Ga0075428_102454265 3300006844 Unclassified 534
156 Ga0075430_100002561 3300006846 Bacteria 15154
157 Ga0075430_100063087 3300006846 Bacteria 3113
158 Ga0075430_100067513 3300006846 Bacteria 3002
159 Ga0075430_101778504 3300006846 Unclassified 505
160 Ga0075430_101801605 3300006846 Bacteria 502
161 Ga0075431_100072277 3300006847 Bacteria 3560
162 Ga0075431_100597506 3300006847 Bacteria 1088
163 Ga0075431_100943146 3300006847 Bacteria 831
164 Ga0075431_101001670 3300006847 Bacteria 802
165 Ga0075431_101448038 3300006847 Bacteria 646
166 Ga0075433_10001521 3300006852 Bacteria 17136
167 Ga0075434_100001305 3300006871 Bacteria 20812
168 Ga0075434_101588945 3300006871 Bacteria 662
169 Ga0075429_100009998 3300006880 Bacteria 8224
170 Ga0075429_100549168 3300006880 Bacteria 1012
171 Ga0075429_101194192 3300006880 Unclassified 664
172 Ga0068865_100694774 3300006881 Bacteria 869
173 Ga0068865_101636566 3300006881 Unclassified 579
174 Ga0068865_102017179 3300006881 Bacteria 524
175 Ga0075436_100004325 3300006914 Bacteria 9747
176 Ga0075436_100288247 3300006914 Bacteria 1175
177 Ga0097620_100122912 3300006931 Bacteria 2663
178 Ga0097620_101628519 3300006931 Bacteria 713
179 Ga0075435_100022245 3300007076 Bacteria 4889
180 Ga0099794_10265274 3300007265 Bacteria 887
181 Ga0099795_10000584 3300007788 Bacteria 6944
182 Ga0105240_10018552 3300009093 Bacteria 9338
183 Ga0105240_10453255 3300009093 Bacteria 1435
184 Ga0105240_12079028 3300009093 Bacteria 590
185 Ga0111539_10173839 3300009094 Bacteria 2516
186 Ga0111539_10324651 3300009094 Bacteria 1791
187 Ga0111539_10378186 3300009094 Bacteria 1649
188 Ga0111539_10498854 3300009094 Unclassified 1418
189 Ga0111539_10519283 3300009094 Bacteria 1387
190 Ga0111539_11424578 3300009094 Bacteria 804
191 Ga0111539_12667854 3300009094 Bacteria 579
192 Ga0105245_10550981 3300009098 Bacteria 1175
193 Ga0105245_11590194 3300009098 Bacteria 705
194 Ga0105245_12631305 3300009098 Bacteria 556
195 Ga0105247_11238024 3300009101 Bacteria 596
196 Ga0114129_10005727 3300009147 Bacteria 17603
197 Ga0114129_10518750 3300009147 Bacteria 1554
198 Ga0114129_10934941 3300009147 Bacteria 1096
199 Ga0114129_12445779 3300009147 Bacteria 625
200 Ga0105243_10011238 3300009148 Bacteria 6773
201 Ga0105243_10202946 3300009148 Bacteria 1740
202 Ga0105241_12255230 3300009174 Bacteria 541
203 Ga0105242_10782362 3300009176 Bacteria 943
204 Ga0105242_11272519 3300009176 Bacteria 758
205 Ga0105248_10128976 3300009177 Bacteria 2853
206 Ga0105248_10398623 3300009177 Bacteria 1549
207 Ga0105248_11919889 3300009177 Unclassified 672
208 Ga0105237_10193303 3300009545 Bacteria 2034
209 Ga0105237_10454041 3300009545 Bacteria 1287
210 Ga0105237_11620597 3300009545 Bacteria 654
211 Ga0105238_10629703 3300009551 Bacteria 1082
212 Ga0105249_10105216 3300009553 Bacteria 2660
213 Ga0105249_11872936 3300009553 Unclassified 672
214 Ga0099796_10014201 3300010159 Bacteria 2295
215 Ga0099796_10016453 3300010159 Bacteria 2184
216 Ga0105239_10028369 3300010375 Bacteria 6157
217 Ga0105239_10690798 3300010375 Bacteria 1166
218 Ga0105239_13432763 3300010375 Bacteria 515
219 Ga0157369_10298752 3300013105 Bacteria 1675
220 Ga0157378_11894851 3300013297 Bacteria 645
221 Ga0163162_10270093 3300013306 Bacteria 1832
222 Ga0163162_10753941 3300013306 Bacteria 1092
223 Ga0163162_10852372 3300013306 Bacteria 1026
224 Ga0163162_11178817 3300013306 Bacteria 869
225 Ga0163162_12361661 3300013306 Bacteria 611
226 Ga0157375_10315645 3300013308 Bacteria 1727
227 Ga0157375_10460721 3300013308 Bacteria 1437
228 Ga0157375_11206622 3300013308 Bacteria 888
229 Ga0163163_11091324 3300014325 Bacteria 861
230 Ga0157380_10026934 3300014326 Bacteria 4368
231 Ga0157380_11082628 3300014326 Bacteria 840
232 Ga0157377_10708722 3300014745 Bacteria 732
233 Ga0157377_11429995 3300014745 Unclassified 547
234 Ga0157379_10047671 3300014968 Bacteria 3823
235 Ga0157379_10572108 3300014968 Bacteria 1053
236 Ga0157379_11240400 3300014968 Unclassified 718
237 Ga0157376_10350807 3300014969 Bacteria 1412
238 Ga0157376_11404991 3300014969 Bacteria 730
239 Ga0163161_10043810 3300017792 Bacteria 3223
240 Ga0209758_1000074 3300025297 Bacteria 275577
241 Ga0209758_1059403 3300025297 Bacteria 1272
242 Ga0207426_1059685 3300025302 Bacteria 1102
243 Ga0207697_10249301 3300025315 Bacteria 785
244 Ga0207656_10193017 3300025321 Bacteria 981
245 Ga0207682_10097232 3300025893 Bacteria 1283
246 Ga0207682_10189728 3300025893 Bacteria 941
247 Ga0207682_10313784 3300025893 Bacteria 736
248 Ga0207642_10098190 3300025899 Bacteria 1464
249 Ga0207680_10075371 3300025903 Bacteria 2104
250 Ga0207685_10034499 3300025905 Bacteria 1839
251 Ga0207699_11307376 3300025906 Bacteria 537
252 Ga0207645_10011013 3300025907 Bacteria 6189
253 Ga0207645_10195172 3300025907 Unclassified 1331
254 Ga0207643_10078476 3300025908 Bacteria 1910
255 Ga0207643_10380630 3300025908 Bacteria 890
256 Ga0207705_10060690 3300025909 Bacteria 2731
257 Ga0207684_10653024 3300025910 Bacteria 896
258 Ga0207707_10026379 3300025912 Bacteria 5078
259 Ga0207695_10021125 3300025913 Bacteria 7435
260 Ga0207695_10397809 3300025913 Bacteria 1262
261 Ga0207695_11580092 3300025913 Bacteria 536
262 Ga0207671_10137346 3300025914 Bacteria 1881
263 Ga0207663_10144681 3300025916 Unclassified 1660
264 Ga0207660_10060868 3300025917 Bacteria 2716
265 Ga0207662_10099427 3300025918 Bacteria 1801
266 Ga0207662_10101120 3300025918 Bacteria 1786
267 Ga0207662_10131102 3300025918 Bacteria 1580
268 Ga0207649_10672431 3300025920 Bacteria 801
269 Ga0207652_10128781 3300025921 Bacteria 2256
270 Ga0207652_11076784 3300025921 Unclassified 704
271 Ga0207681_10010837 3300025923 Bacteria 5600
272 Ga0207694_10400159 3300025924 Bacteria 1142
273 Ga0207650_10068257 3300025925 Bacteria 2669
274 Ga0207650_11740453 3300025925 Bacteria 528
275 Ga0207659_10026847 3300025926 Bacteria 3891
276 Ga0207659_10068106 3300025926 Bacteria 2588
277 Ga0207664_10048812 3300025929 Bacteria 3330
278 Ga0207644_10104786 3300025931 Bacteria 2130
279 Ga0207644_10568725 3300025931 Bacteria 939
280 Ga0207690_10460100 3300025932 Bacteria 1024
281 Ga0207706_10225684 3300025933 Bacteria 1639
282 Ga0207706_10426837 3300025933 Bacteria 1148
283 Ga0207686_10089150 3300025934 Bacteria 2033
284 Ga0207686_10349998 3300025934 Bacteria 1112
285 Ga0207709_10011819 3300025935 Bacteria 4814
286 Ga0207709_10134301 3300025935 Bacteria 1691
287 Ga0207670_11267413 3300025936 Bacteria 625
288 Ga0207670_11624516 3300025936 Bacteria 550
289 Ga0207670_11685527 3300025936 Bacteria 539
290 Ga0207669_10123112 3300025937 Bacteria 1765
291 Ga0207669_10197186 3300025937 Bacteria 1458
292 Ga0207669_11006416 3300025937 Bacteria 700
293 Ga0207669_11298435 3300025937 Unclassified 618
294 Ga0207704_10142295 3300025938 Bacteria 1680
295 Ga0207704_10604325 3300025938 Bacteria 898
296 Ga0207704_11320514 3300025938 Unclassified 617
297 Ga0207704_11793166 3300025938 Bacteria 528
298 Ga0207665_10167239 3300025939 Unclassified 1586
299 Ga0207665_10277061 3300025939 Bacteria 1247
300 Ga0207665_11147144 3300025939 Unclassified 620
301 Ga0207691_10149998 3300025940 Bacteria 2050
302 Ga0207691_10237865 3300025940 Bacteria 1575
303 Ga0207691_10399034 3300025940 Bacteria 1173
304 Ga0207691_10490869 3300025940 Bacteria 1043
305 Ga0207711_10259112 3300025941 Bacteria 1598
306 Ga0207711_11141657 3300025941 Bacteria 720
307 Ga0207689_10044224 3300025942 Bacteria 3681
308 Ga0207689_10740281 3300025942 Bacteria 829
309 Ga0207679_11759844 3300025945 Bacteria 567
310 Ga0207667_10045834 3300025949 Bacteria 4630
311 Ga0207651_10188337 3300025960 Bacteria 1644
312 Ga0207651_11213655 3300025960 Bacteria 677
313 Ga0207712_10268361 3300025961 Unclassified 1387
314 Ga0207668_10017408 3300025972 Bacteria 4503
315 Ga0207668_10246172 3300025972 Bacteria 1449
316 Ga0207668_10475885 3300025972 Bacteria 1070
317 Ga0207668_10869781 3300025972 Bacteria 801
318 Ga0207640_10084581 3300025981 Bacteria 2179
319 Ga0207658_10096783 3300025986 Bacteria 2303
320 Ga0207658_10241333 3300025986 Bacteria 1531
321 Ga0207677_10324556 3300026023 Unclassified 1280
322 Ga0207677_11811479 3300026023 Unclassified 567
323 Ga0207703_10895872 3300026035 Bacteria 849
324 Ga0207678_10259942 3300026067 Bacteria 1488
325 Ga0207678_10431628 3300026067 Bacteria 1143
326 Ga0207708_10015956 3300026075 Bacteria 5640
327 Ga0207708_10113037 3300026075 Bacteria 2110
328 Ga0207708_10273928 3300026075 Bacteria 1366
329 Ga0207708_11219826 3300026075 Bacteria 658
330 Ga0207641_10835025 3300026088 Bacteria 913
331 Ga0207648_10001462 3300026089 Bacteria 25984
332 Ga0207648_10002985 3300026089 Bacteria 17880
333 Ga0207648_10108137 3300026089 Bacteria 2441
334 Ga0207648_10291304 3300026089 Bacteria 1462
335 Ga0207648_10339374 3300026089 Bacteria 1353
336 Ga0207676_12136003 3300026095 Unclassified 558
337 Ga0207675_100001475 3300026118 Bacteria 23622
338 Ga0207675_100240718 3300026118 Bacteria 1748
339 Ga0207675_100278196 3300026118 Bacteria 1625
340 Ga0207675_100591668 3300026118 Bacteria 1112
341 Ga0207683_10026920 3300026121 Bacteria 4968
342 Ga0207683_10329268 3300026121 Unclassified 1400
343 Ga0207683_11151746 3300026121 Bacteria 719
344 Ga0207698_10244145 3300026142 Bacteria 1639
345 Ga0207698_10312885 3300026142 Bacteria 1467
346 Ga0207698_12422609 3300026142 Bacteria 536
347 Ga0209969_1018846 3300027360 Bacteria 1021
348 Ga0209981_1033831 3300027378 Unclassified 754
349 Ga0209981_1048638 3300027378 Unclassified 640
350 Ga0209996_1024381 3300027395 Unclassified 862
351 Ga0209984_1050273 3300027424 Bacteria 609
352 Ga0210000_1060171 3300027462 Bacteria 615
353 Ga0209995_1000904 3300027471 Bacteria 4604
354 Ga0209968_1018379 3300027526 Bacteria 1119
355 Ga0209999_1001577 3300027543 Bacteria 3922
356 Ga0209999_1050335 3300027543 Unclassified 786
357 Ga0209970_1017346 3300027614 Bacteria 1205
358 Ga0209970_1061785 3300027614 Unclassified 688
359 Ga0209983_1011704 3300027665 Bacteria 1796
360 Ga0209971_1009679 3300027682 Bacteria 2283
361 Ga0209971_1025164 3300027682 Bacteria 1422
362 Ga0209971_1193430 3300027682 Unclassified 501
363 Ga0209813_10100811 3300027866 Bacteria 982
364 Ga0209974_10003351 3300027876 Bacteria 5787
365 Ga0209974_10153898 3300027876 Unclassified 831
366 Ga0209974_10250489 3300027876 Bacteria 666
367 Ga0207428_10087450 3300027907 Bacteria 2424
368 Ga0207428_10320466 3300027907 Bacteria 1145
369 Ga0207428_11049042 3300027907 Bacteria 571
370 Ga0207428_11176903 3300027907 Bacteria 534
371 Ga0265357_1001280 3300028023 Bacteria 1804
372 Ga0268266_10004786 3300028379 Bacteria 12859
373 Ga0268266_10029056 3300028379 Bacteria 4699
374 Ga0268266_10363748 3300028379 Bacteria 1362
375 Ga0268266_11166981 3300028379 Unclassified 745
376 Ga0268265_10004164 3300028380 Bacteria 10135
377 Ga0268265_10181017 3300028380 Bacteria 1811
378 Ga0268265_10271889 3300028380 Bacteria 1512
379 Ga0268264_10244950 3300028381 Bacteria 1662
380 Ga0265334_10002880 3300028573 Bacteria 7892
381 Ga0265322_10206210 3300028654 Bacteria 563
382 Ga0265338_10052453 3300028800 Bacteria 3658
383 Ga0265338_10257015 3300028800 Unclassified 1286
384 Ga0265320_10069871 3300031240 Bacteria 1657
385 Ga0265320_10126853 3300031240 Bacteria 1160
386 Ga0265325_10065772 3300031241 Bacteria 1830
387 Ga0265339_10027544 3300031249 Bacteria 3243
388 Ga0307408_102385831 3300031548 Bacteria 513
389 Ga0265313_10030461 3300031595 Bacteria 2778
390 Ga0265313_10034299 3300031595 Bacteria 2568
391 Ga0307405_11277335 3300031731 Bacteria 638
392 Ga0307405_11346035 3300031731 Bacteria 623
393 Ga0307410_12025921 3300031852 Unclassified 514
394 Ga0307406_10388025 3300031901 Bacteria 1103
395 Ga0307412_10384001 3300031911 Bacteria 1138
396 Ga0307409_100448831 3300031995 Bacteria 1244
397 Ga0307416_101407697 3300032002 Bacteria 803
398 Ga0307416_103018253 3300032002 Bacteria 563
399 Ga0307414_10555685 3300032004 Bacteria 1024
400 Ga0307411_10132689 3300032005 Bacteria 1823
401 Ga0307411_11315769 3300032005 Unclassified 659
402 Ga0307510_10249853 3300033180 Unclassified 1262
403 Ga0373930_0102276 3300034816 Bacteria 682
404 Ga0373950_0046128 3300034818 Bacteria 846
405 Ga0373958_0096614 3300034819 Bacteria 688
406 Ga0373926_0028063 3300035083 Bacteria 1975
407 Ga0373926_0263483 3300035083 Bacteria 669
408 Ga0373934_0112667 3300035086 Bacteria 1104
409 Ga0373940_0315390 3300035088 Bacteria 541
410 Ga0373932_0120925 3300035112 Bacteria 873
411 Ga0373932_0390867 3300035112 Bacteria 536
412 Ga0373945_0192524 3300035116 Unclassified 844
413 Ga0373945_0349944 3300035116 Bacteria 641
414 Ga0373956_0080206 3300035119 Bacteria 1497
415 Ga0373957_0561347 3300035120 Unclassified 500
416 Ga0373946_0028836 3300035171 Bacteria 2204
417 Ga0373946_0628728 3300035171 Bacteria 558
418 Ga0373955_0038176 3300035172 Bacteria 2558
419 Ga0373955_0185026 3300035172 Bacteria 1237
420 Ga0373955_0270877 3300035172 Bacteria 1020
421 Ga0373931_0002612 3300035691 Bacteria 8014
422 Ga0373935_0304146 3300035692 Bacteria 1128
423 Ga0373935_0927876 3300035692 Bacteria 645
424 Ga0373927_0201101 3300035695 Bacteria 1308
425 Ga0373927_0421065 3300035695 Bacteria 881
426 Ga0373933_0404199 3300035724 Bacteria 891
427 Ga0373933_0417977 3300035724 Unclassified 876
428 Ga0373947_0139592 3300035725 Bacteria 1553
429 Ga0373947_0272514 3300035725 Bacteria 1124
430 Ga0373947_0407283 3300035725 Bacteria 918
431 Ga0373947_0846487 3300035725 Bacteria 624
432 Ga0373937_0019421 3300036401 Bacteria 6083
433 Ga0373937_0208163 3300036401 Bacteria 1840
434 Ga0373937_0316570 3300036401 Bacteria 1476
435 Ga0373925_0020491 3300037068 Bacteria 4814
436 Ga0373925_0207970 3300037068 Bacteria 1558
437 Ga0373925_1416279 3300037068 Unclassified 569
438 Ga0436365_0514370 3300039437 Bacteria 546
439 Ga0436363_1416401 3300039450 Unclassified 1967
440 Ga0436363_1611588 3300039450 Bacteria 813
441 Ga0439436_0111736 3300041404 Bacteria 763
442 Ga0439436_0173384 3300041404 Unclassified 612
443 Ga0451853_0745474 3300041512 Bacteria 517
444 Ga0439441_034380 3300042001 Bacteria 995
445 Ga0439441_114393 3300042001 Unclassified 614
446 Ga0439456_016347 3300042013 Bacteria 1552
447 Ga0439462_0231460 3300042015 Bacteria 529
448 Ga0439446_0048257 3300042156 Bacteria 1267
449 Ga0439446_0102642 3300042156 Unclassified 906
450 Ga0439458_0231599 3300042157 Bacteria 511
451 Ga0439434_0150154 3300042435 Unclassified 771
452 Ga0439435_0001802 3300042436 Bacteria 4086
453 Ga0439435_0003371 3300042436 Bacteria 3317
454 Ga0439460_0011547 3300042461 Bacteria 2279
455 Ga0451577_1275894 3300042876 Unclassified 654
456 Ga0466970_0554623 3300044765 Bacteria 664
457 Ga0466960_0998384 3300044901 Unclassified 514
458 Ga0466959_0632330 3300045049 Unclassified 719
459 Ga0451576_0130939 3300045051 Bacteria 2615
460 Ga0495592_0212786 3300046454 Bacteria 1297
461 Ga0495651_0526571 3300046462 Bacteria 754
462 Ga0495664_0315388 3300046477 Bacteria 943
463 Ga0495584_0435476 3300046491 Bacteria 667
464 Ga0495584_0561565 3300046491 Bacteria 582
465 Ga0495606_0114983 3300046507 Unclassified 1618
466 Ga0495620_0117633 3300046515 Bacteria 1050
467 Ga0495628_0180049 3300046516 Bacteria 1599
468 Ga0495644_0154555 3300046523 Bacteria 879
469 Ga0495642_0226442 3300046528 Bacteria 817
470 Ga0495652_0702548 3300046529 Bacteria 680
471 Ga0495640_0187672 3300046533 Bacteria 1315
472 Ga0495656_0672921 3300046615 Bacteria 556
473 Ga0495634_0677340 3300046642 Bacteria 594
474 Ga0495599_0531934 3300046678 Unclassified 690
475 Ga0495599_0811585 3300046678 Bacteria 534
476 Ga0495646_0053643 3300046680 Bacteria 2430
477 Ga0495647_0295472 3300046681 Unclassified 729
478 Ga0495669_0237677 3300046684 Bacteria 874
479 Ga0495669_0443997 3300046684 Bacteria 630
480 Ga0495613_0370523 3300046689 Bacteria 981
481 Ga0495671_0274347 3300046692 Bacteria 813
482 Ga0495649_0306544 3300046694 Bacteria 808
483 Ga0495604_0076963 3300047317 Bacteria 2509
484 Ga0495674_0136111 3300047319 Bacteria 2067
485 Ga0495675_0293101 3300047444 Bacteria 968
486 Ga0495686_0700547 3300047472 Bacteria 517
487 Ga0495602_0254267 3300048088 Bacteria 1307
488 Ga0496100_0003275 3300048903 Bacteria 8416
489 Ga0496100_0512477 3300048903 Unclassified 925
490 Ga0496104_0108167 3300048907 Unclassified 2664
491 Ga0496104_0276361 3300048907 Bacteria 1592
492 Ga0496105_0023306 3300048908 Bacteria 5018
493 Ga0496105_0307858 3300048908 Bacteria 1272
494 Ga0496106_1269567 3300048909 Bacteria 572
495 Ga0496107_0065291 3300048910 Bacteria 2638
496 Ga0496107_0282922 3300048910 Unclassified 1234
497 Ga0496108_0195181 3300048911 Bacteria 1755
498 Ga0496111_0101576 3300048914 Bacteria 2113
499 Ga0496112_0121484 3300048915 Bacteria 2582
500 Ga0496112_0170056 3300048915 Bacteria 2145
501 Ga0496114_0036965 3300048917 Unclassified 4037
502 Ga0496114_0072416 3300048917 Bacteria 2898
503 Ga0496114_0805501 3300048917 Bacteria 818
504 Ga0496115_0007210 3300048918 Bacteria 8168
505 Ga0496115_0055854 3300048918 Bacteria 3172
506 Ga0496125_0193172 3300048928 Bacteria 1342
507 Ga0496126_0002340 3300048929 Bacteria 25952
508 Ga0496126_0732282 3300048929 Unclassified 765
509 Ga0496126_1033051 3300048929 Bacteria 615
510 Ga0501031_0421370 3300049568 Bacteria 863
511 Ga0501031_0690061 3300049568 Bacteria 656
512 Ga0501033_0210297 3300049570 Bacteria 1387
513 Ga0501036_0432108 3300049572 Bacteria 1098
514 Ga0501037_0570711 3300049573 Bacteria 762
515 Ga0501038_0082989 3300049574 Bacteria 2698
516 Ga0501038_0927366 3300049574 Bacteria 642
517 Ga0501039_0663385 3300049575 Bacteria 816
518 Ga0501040_0023359 3300049576 Bacteria 4146
519 Ga0501040_0082537 3300049576 Bacteria 2228
520 Ga0501040_0737416 3300049576 Bacteria 713
521 Ga0501040_0850548 3300049576 Unclassified 660
522 Ga0501041_0029174 3300049577 Bacteria 3328
523 Ga0501041_0033160 3300049577 Bacteria 3123
524 Ga0501041_0078476 3300049577 Bacteria 2032
525 Ga0501042_0021872 3300049578 Bacteria 4463
526 Ga0501042_0049425 3300049578 Bacteria 3000
527 Ga0501042_0329666 3300049578 Bacteria 1103
528 Ga0501042_1081471 3300049578 Bacteria 585
529 Ga0501043_0874152 3300049579 Bacteria 646
530 Ga0501046_0204857 3300049580 Bacteria 1467
531 Ga0501046_0466767 3300049580 Bacteria 907
532 Ga0501048_0072325 3300049582 Bacteria 2434
533 Ga0501048_0147095 3300049582 Bacteria 1666
534 Ga0501048_0347122 3300049582 Bacteria 1058
535 Ga0501069_0025011 3300049585 Bacteria 3261
536 Ga0501070_0466955 3300049586 Bacteria 1016
537 Ga0501071_0025464 3300049587 Bacteria 4145
538 Ga0501071_0470003 3300049587 Bacteria 963
539 Ga0501071_0511017 3300049587 Bacteria 922
540 Ga0501071_1586460 3300049587 Unclassified 505
541 Ga0501072_0005763 3300049588 Bacteria 9432
542 Ga0501072_0166260 3300049588 Bacteria 1760
543 Ga0501072_0411107 3300049588 Bacteria 1073
544 Ga0501072_0636200 3300049588 Bacteria 840
545 Ga0501072_1480176 3300049588 Bacteria 524
546 Ga0501073_0177174 3300049589 Bacteria 1476
547 Ga0501074_0110619 3300049590 Bacteria 1966
548 Ga0501074_0185786 3300049590 Bacteria 1482
549 Ga0501074_1132363 3300049590 Bacteria 549
550 Ga0501075_0003753 3300049591 Bacteria 10205
551 Ga0501075_0512467 3300049591 Bacteria 915
552 Ga0501076_0001091 3300049592 Bacteria 17844
553 Ga0501076_0414015 3300049592 Bacteria 1109
554 Ga0501076_0499990 3300049592 Bacteria 1002
555 Ga0501076_0788933 3300049592 Bacteria 784
556 Ga0501077_0040472 3300049593 Bacteria 2969
557 Ga0501077_0372546 3300049593 Bacteria 912
558 Ga0501079_0011674 3300049741 Bacteria 6711
559 Ga0501080_1074185 3300049742 Archaea 696
560 Ga0501081_0006843 3300049743 Bacteria 7414
561 Ga0501081_0660066 3300049743 Bacteria 784
562 Ga0501081_1258973 3300049743 Bacteria 561
563 Ga0501083_0123211 3300049744 Bacteria 1700
564 Ga0501035_0249388 3300049822 Bacteria 1508
565 Ga0501035_0375746 3300049822 Bacteria 1186
566 Ga0501045_0007341 3300049824 Bacteria 7664
567 Ga0501045_0558252 3300049824 Bacteria 849
568 nmdc:mga03n38_149604_c1 3300050490 Bacteria 1173
569 nmdc:mga0yw44_1924_c1 3300050492 Bacteria 8583
570 nmdc:mga0yw44_84473_c1 3300050492 Bacteria 1996
571 nmdc:mga0k408_35870_c1 3300050493 Bacteria 1645
572 nmdc:mga0k408_659226_c1 3300050493 Bacteria 615
573 nmdc:mga06z11_182705_c1 3300050494 Bacteria 1210
574 nmdc:mga06z11_506526_c1 3300050494 Bacteria 731
575 nmdc:mga06z11_776454_c1 3300050494 Unclassified 584
576 nmdc:mga04h51_172925_c1 3300050495 Bacteria 837
577 nmdc:mga07m45_556158_c1 3300050496 Unclassified 663
578 nmdc:mga05p37_318473_c1 3300050507 Bacteria 1842
579 nmdc:mga09592_1056472_c1 3300050508 Unclassified 677
580 nmdc:mga09592_18107_c1 3300050508 Bacteria 5776
581 nmdc:mga09592_831534_c1 3300050508 Bacteria 780
582 nmdc:mga09592_919371_c1 3300050508 Bacteria 735
583 nmdc:mga09592_979138_c1 3300050508 Unclassified 708
584 nmdc:mga0qj67_1566764_c1 3300050509 Bacteria 506
585 nmdc:mga0qj67_30276_c1 3300050509 Bacteria 4211
586 nmdc:mga0qj67_630801_c1 3300050509 Bacteria 856
587 nmdc:mga0qj67_653699_c1 3300050509 Bacteria 839
588 nmdc:mga0qj67_725446_c1 3300050509 Unclassified 790
589 nmdc:mga06r32_106764_c1 3300050510 Bacteria 2751
590 nmdc:mga06r32_1150486_c1 3300050510 Unclassified 724
591 nmdc:mga06r32_1889735_c1 3300050510 Bacteria 532
592 nmdc:mga06r32_96527_c1 3300050510 Bacteria 2895
593 nmdc:mga08y16_208263_c1 3300050511 Bacteria 2025
594 nmdc:mga08y16_270673_c1 3300050511 Bacteria 1754
595 nmdc:mga08y16_33511_c1 3300050511 Bacteria 5394
596 nmdc:mga08y16_429976_c1 3300050511 Bacteria 1348
597 nmdc:mga0n895_160009_c1 3300050512 Bacteria 2283
598 nmdc:mga0n895_1838237_c1 3300050512 Bacteria 566
599 nmdc:mga0n895_4031_c1 3300050512 Bacteria 11953
600 nmdc:mga0rr50_8806_c1 3300050513 Bacteria 6297
601 nmdc:mga08x19_1704_c1 3300050514 Bacteria 13531
602 nmdc:mga08x19_20400_c1 3300050514 Bacteria 4080
603 nmdc:mga08x19_769303_c1 3300050514 Bacteria 684
604 nmdc:mga0a205_173_c1 3300050515 Bacteria 11499
605 Ga0495601_0078981 3300053077 Bacteria 2109
606 Ga0495612_0117070 3300053078 Bacteria 1144
607 Ga0495619_0277421 3300053085 Bacteria 1161
608 Ga0500556_0169826 3300053104 Bacteria 862
609 Ga0500642_0022849 3300053130 Bacteria 2502
610 Ga0500568_0083696 3300053139 Bacteria 1209
611 Ga0500588_0143199 3300053146 Unclassified 860
612 Ga0500588_0261081 3300053146 Bacteria 652
613 Ga0500616_0007590 3300053153 Bacteria 6857
614 Ga0500616_0057208 3300053153 Bacteria 2032
615 Ga0501084_0085086 3300054114 Bacteria 2655
616 Ga0501084_0894195 3300054114 Bacteria 747
617 Ga0501084_1381017 3300054114 Bacteria 590
618 Ga0590071_012909 3300059421 Bacteria 1957
619 Ga0590075_023523 3300059424 Bacteria 1545
620 Ga0501082_0003995 3300060353 Bacteria 12872
621 Ga0501082_0311786 3300060353 Bacteria 1370
622 Ga0501082_1419964 3300060353 Bacteria 606
623 Ga0530510_0002851 3300061734 Bacteria 11883

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014745 Ga0157377_11429995 Ga0157377_114299951 81
2 3300026023 Ga0207677_11811479 Ga0207677_118114791 89
3 3300039450 Ga0436363_1611588 Ga0436363_1611588_95_388 89
4 3300045049 Ga0466959_0632330 Ga0466959_0632330_435_704 89
5 3300025981 Ga0207640_10084581 Ga0207640_100845812 91
6 3300002244 JGI24742J22300_10068105 JGI24742J22300_100681052 96
7 3300003323 rootH1_10037109 rootH1_100371095 96
8 3300003323 rootH1_10221863 rootH1_102218632 96
9 3300005328 Ga0070676_10450801 Ga0070676_104508011 96
10 3300005331 Ga0070670_100086582 Ga0070670_1000865825 96
11 3300005333 Ga0070677_10217563 Ga0070677_102175632 96
12 3300005334 Ga0068869_100226418 Ga0068869_1002264181 96
13 3300005334 Ga0068869_101311364 Ga0068869_1013113642 96
14 3300005335 Ga0070666_10048909 Ga0070666_100489096 96
15 3300005336 Ga0070680_100054066 Ga0070680_1000540663 96
16 3300005338 Ga0068868_100914845 Ga0068868_1009148452 96
17 3300005343 Ga0070687_100055332 Ga0070687_1000553321 96
18 3300005345 Ga0070692_10014768 Ga0070692_100147683 96
19 3300005347 Ga0070668_100015073 Ga0070668_1000150735 96
20 3300005347 Ga0070668_100023324 Ga0070668_1000233243 96
21 3300005353 Ga0070669_100001513 Ga0070669_10000151310 96
22 3300005354 Ga0070675_100023953 Ga0070675_1000239536 96
23 3300005355 Ga0070671_100422036 Ga0070671_1004220361 96
24 3300005356 Ga0070674_100934199 Ga0070674_1009341992 96
25 3300005364 Ga0070673_100051114 Ga0070673_1000511144 96
26 3300005364 Ga0070673_101879356 Ga0070673_1018793561 96
27 3300005364 Ga0070673_102075607 Ga0070673_1020756071 96
28 3300005367 Ga0070667_100117970 Ga0070667_1001179702 96
29 3300005367 Ga0070667_101514344 Ga0070667_1015143441 96
30 3300005367 Ga0070667_101579826 Ga0070667_1015798262 96
31 3300005441 Ga0070700_100041008 Ga0070700_1000410085 96
32 3300005441 Ga0070700_100512018 Ga0070700_1005120182 96
33 3300005444 Ga0070694_101064416 Ga0070694_1010644162 96
34 3300005444 Ga0070694_101125809 Ga0070694_1011258092 96
35 3300005444 Ga0070694_101566094 Ga0070694_1015660942 96
36 3300005445 Ga0070708_100904442 Ga0070708_1009044422 96
37 3300005455 Ga0070663_101826592 Ga0070663_1018265922 96
38 3300005456 Ga0070678_100302376 Ga0070678_1003023762 96
39 3300005457 Ga0070662_101112748 Ga0070662_1011127481 96
40 3300005458 Ga0070681_10020205 Ga0070681_100202054 96
41 3300005458 Ga0070681_10070711 Ga0070681_100707112 96
42 3300005458 Ga0070681_10540625 Ga0070681_105406252 96
43 3300005459 Ga0068867_100000729 Ga0068867_1000007294 96
44 3300005459 Ga0068867_100085715 Ga0068867_1000857155 96
45 3300005530 Ga0070679_100141101 Ga0070679_1001411014 96
46 3300005543 Ga0070672_100434306 Ga0070672_1004343063 96
47 3300005543 Ga0070672_101839839 Ga0070672_1018398392 96
48 3300005548 Ga0070665_100009397 Ga0070665_1000093972 96
49 3300005548 Ga0070665_100083934 Ga0070665_1000839345 96
50 3300005548 Ga0070665_100452033 Ga0070665_1004520332 96
51 3300005549 Ga0070704_100129198 Ga0070704_1001291982 96
52 3300005577 Ga0068857_100209841 Ga0068857_1002098412 96
53 3300005578 Ga0068854_100073499 Ga0068854_1000734991 96
54 3300005615 Ga0070702_100436117 Ga0070702_1004361172 96
55 3300005615 Ga0070702_100562185 Ga0070702_1005621852 96
56 3300005616 Ga0068852_101437392 Ga0068852_1014373922 96
57 3300005617 Ga0068859_100122921 Ga0068859_1001229215 96
58 3300005617 Ga0068859_101628296 Ga0068859_1016282961 96
59 3300005618 Ga0068864_101172485 Ga0068864_1011724851 96
60 3300005718 Ga0068866_10011132 Ga0068866_100111323 96
61 3300005719 Ga0068861_100001358 Ga0068861_1000013584 96
62 3300005719 Ga0068861_100592126 Ga0068861_1005921262 96
63 3300005719 Ga0068861_102621968 Ga0068861_1026219681 96
64 3300005834 Ga0068851_10337002 Ga0068851_103370022 96
65 3300005840 Ga0068870_10074676 Ga0068870_100746762 96
66 3300005840 Ga0068870_10488857 Ga0068870_104888572 96
67 3300005840 Ga0068870_10855702 Ga0068870_108557022 96
68 3300005841 Ga0068863_102101096 Ga0068863_1021010961 96
69 3300005842 Ga0068858_102518932 Ga0068858_1025189321 96
70 3300005843 Ga0068860_100550606 Ga0068860_1005506062 96
71 3300005844 Ga0068862_100003042 Ga0068862_10000304210 96
72 3300006173 Ga0070716_101192180 Ga0070716_1011921802 96
73 3300006844 Ga0075428_102168622 Ga0075428_1021686222 96
74 3300006846 Ga0075430_100002561 Ga0075430_10000256115 96
75 3300006847 Ga0075431_100072277 Ga0075431_1000722777 96
76 3300006847 Ga0075431_100597506 Ga0075431_1005975062 96
77 3300006871 Ga0075434_101588945 Ga0075434_1015889452 96
78 3300006880 Ga0075429_101194192 Ga0075429_1011941921 96
79 3300006881 Ga0068865_101636566 Ga0068865_1016365662 96
80 3300006881 Ga0068865_102017179 Ga0068865_1020171792 96
81 3300006931 Ga0097620_100122912 Ga0097620_1001229125 96
82 3300006931 Ga0097620_101628519 Ga0097620_1016285191 96
83 3300007265 Ga0099794_10265274 Ga0099794_102652741 96
84 3300007788 Ga0099795_10000584 Ga0099795_100005848 96
85 3300009093 Ga0105240_10453255 Ga0105240_104532552 96
86 3300009093 Ga0105240_12079028 Ga0105240_120790281 96
87 3300009094 Ga0111539_10324651 Ga0111539_103246512 96
88 3300009094 Ga0111539_10498854 Ga0111539_104988543 96
89 3300009101 Ga0105247_11238024 Ga0105247_112380241 96
90 3300009148 Ga0105243_10011238 Ga0105243_1001123810 96
91 3300009174 Ga0105241_12255230 Ga0105241_122552301 96
92 3300009545 Ga0105237_10193303 Ga0105237_101933034 96
93 3300009545 Ga0105237_10454041 Ga0105237_104540412 96
94 3300009551 Ga0105238_10629703 Ga0105238_106297032 96
95 3300009553 Ga0105249_10105216 Ga0105249_101052166 96
96 3300010159 Ga0099796_10014201 Ga0099796_100142014 96
97 3300010159 Ga0099796_10016453 Ga0099796_100164533 96
98 3300010375 Ga0105239_10028369 Ga0105239_100283694 96
99 3300013306 Ga0163162_10753941 Ga0163162_107539412 96
100 3300013306 Ga0163162_10852372 Ga0163162_108523722 96
101 3300013308 Ga0157375_10315645 Ga0157375_103156452 96
102 3300013308 Ga0157375_10460721 Ga0157375_104607211 96
103 3300014325 Ga0163163_11091324 Ga0163163_110913242 96
104 3300014326 Ga0157380_11082628 Ga0157380_110826281 96
105 3300014745 Ga0157377_10708722 Ga0157377_107087222 96
106 3300014968 Ga0157379_10572108 Ga0157379_105721083 96
107 3300014968 Ga0157379_11240400 Ga0157379_112404002 96
108 3300025315 Ga0207697_10249301 Ga0207697_102493011 96
109 3300025321 Ga0207656_10193017 Ga0207656_101930172 96
110 3300025893 Ga0207682_10189728 Ga0207682_101897281 96
111 3300025893 Ga0207682_10313784 Ga0207682_103137842 96
112 3300025903 Ga0207680_10075371 Ga0207680_100753713 96
113 3300025907 Ga0207645_10195172 Ga0207645_101951722 96
114 3300025908 Ga0207643_10078476 Ga0207643_100784763 96
115 3300025908 Ga0207643_10380630 Ga0207643_103806302 96
116 3300025912 Ga0207707_10026379 Ga0207707_100263794 96
117 3300025913 Ga0207695_10397809 Ga0207695_103978091 96
118 3300025913 Ga0207695_11580092 Ga0207695_115800921 96
119 3300025914 Ga0207671_10137346 Ga0207671_101373462 96
120 3300025917 Ga0207660_10060868 Ga0207660_100608682 96
121 3300025918 Ga0207662_10099427 Ga0207662_100994272 96
122 3300025920 Ga0207649_10672431 Ga0207649_106724311 96
123 3300025921 Ga0207652_10128781 Ga0207652_101287813 96
124 3300025923 Ga0207681_10010837 Ga0207681_1001083710 96
125 3300025924 Ga0207694_10400159 Ga0207694_104001592 96
126 3300025925 Ga0207650_10068257 Ga0207650_100682572 96
127 3300025925 Ga0207650_11740453 Ga0207650_117404531 96
128 3300025926 Ga0207659_10068106 Ga0207659_100681065 96
129 3300025933 Ga0207706_10225684 Ga0207706_102256842 96
130 3300025933 Ga0207706_10426837 Ga0207706_104268371 96
131 3300025935 Ga0207709_10011819 Ga0207709_100118195 96
132 3300025936 Ga0207670_11624516 Ga0207670_116245162 96
133 3300025937 Ga0207669_10197186 Ga0207669_101971861 96
134 3300025938 Ga0207704_10604325 Ga0207704_106043252 96
135 3300025938 Ga0207704_11320514 Ga0207704_113205141 96
136 3300025938 Ga0207704_11793166 Ga0207704_117931661 96
137 3300025939 Ga0207665_11147144 Ga0207665_111471442 96
138 3300025940 Ga0207691_10149998 Ga0207691_101499982 96
139 3300025940 Ga0207691_10237865 Ga0207691_102378651 96
140 3300025940 Ga0207691_10490869 Ga0207691_104908692 96
141 3300025945 Ga0207679_11759844 Ga0207679_117598442 96
142 3300025960 Ga0207651_10188337 Ga0207651_101883373 96
143 3300025961 Ga0207712_10268361 Ga0207712_102683611 96
144 3300025972 Ga0207668_10017408 Ga0207668_100174086 96
145 3300025972 Ga0207668_10246172 Ga0207668_102461722 96
146 3300025972 Ga0207668_10475885 Ga0207668_104758851 96
147 3300025986 Ga0207658_10096783 Ga0207658_100967834 96
148 3300025986 Ga0207658_10241333 Ga0207658_102413331 96
149 3300026023 Ga0207677_10324556 Ga0207677_103245563 96
150 3300026067 Ga0207678_10431628 Ga0207678_104316281 96
151 3300026075 Ga0207708_10015956 Ga0207708_100159563 96
152 3300026075 Ga0207708_10273928 Ga0207708_102739282 96
153 3300026089 Ga0207648_10001462 Ga0207648_1000146216 96
154 3300026089 Ga0207648_10108137 Ga0207648_101081375 96
155 3300026089 Ga0207648_10339374 Ga0207648_103393743 96
156 3300026095 Ga0207676_12136003 Ga0207676_121360032 96
157 3300026118 Ga0207675_100001475 Ga0207675_10000147522 96
158 3300026118 Ga0207675_100278196 Ga0207675_1002781964 96
159 3300026118 Ga0207675_100591668 Ga0207675_1005916682 96
160 3300026121 Ga0207683_11151746 Ga0207683_111517462 96
161 3300026142 Ga0207698_10244145 Ga0207698_102441452 96
162 3300026142 Ga0207698_10312885 Ga0207698_103128852 96
163 3300026142 Ga0207698_12422609 Ga0207698_124226092 96
164 3300027462 Ga0210000_1060171 Ga0210000_10601712 96
165 3300027907 Ga0207428_10320466 Ga0207428_103204661 96
166 3300028023 Ga0265357_1001280 Ga0265357_10012802 96
167 3300028379 Ga0268266_10004786 Ga0268266_1000478610 96
168 3300028379 Ga0268266_10029056 Ga0268266_100290561 96
169 3300028379 Ga0268266_11166981 Ga0268266_111669811 96
170 3300028380 Ga0268265_10004164 Ga0268265_100041646 96
171 3300028380 Ga0268265_10181017 Ga0268265_101810171 96
172 3300028573 Ga0265334_10002880 Ga0265334_100028808 96
173 3300028654 Ga0265322_10206210 Ga0265322_102062102 96
174 3300028800 Ga0265338_10052453 Ga0265338_100524535 96
175 3300028800 Ga0265338_10257015 Ga0265338_102570152 96
176 3300031240 Ga0265320_10069871 Ga0265320_100698712 96
177 3300031240 Ga0265320_10126853 Ga0265320_101268532 96
178 3300031249 Ga0265339_10027544 Ga0265339_100275444 96
179 3300031595 Ga0265313_10030461 Ga0265313_100304613 96
180 3300031852 Ga0307410_12025921 Ga0307410_120259211 96
181 3300031901 Ga0307406_10388025 Ga0307406_103880252 96
182 3300035083 Ga0373926_0028063 Ga0373926_0028063_397_687 96
183 3300035086 Ga0373934_0112667 Ga0373934_0112667_224_514 96
184 3300035116 Ga0373945_0192524 Ga0373945_0192524_128_418 96
185 3300035119 Ga0373956_0080206 Ga0373956_0080206_200_490 96
186 3300035172 Ga0373955_0185026 Ga0373955_0185026_111_401 96
187 3300035172 Ga0373955_0270877 Ga0373955_0270877_384_674 96
188 3300035692 Ga0373935_0927876 Ga0373935_0927876_205_495 96
189 3300035724 Ga0373933_0404199 Ga0373933_0404199_84_374 96
190 3300035725 Ga0373947_0139592 Ga0373947_0139592_124_414 96
191 3300036401 Ga0373937_0019421 Ga0373937_0019421_3218_3508 96
192 3300036401 Ga0373937_0316570 Ga0373937_0316570_90_380 96
193 3300037068 Ga0373925_0207970 Ga0373925_0207970_1128_1418 96
194 3300039437 Ga0436365_0514370 Ga0436365_0514370_209_499 96
195 3300041512 Ga0451853_0745474 Ga0451853_0745474_161_451 96
196 3300042876 Ga0451577_1275894 Ga0451577_1275894_222_518 96
197 3300044765 Ga0466970_0554623 Ga0466970_0554623_244_534 96
198 3300044901 Ga0466960_0998384 Ga0466960_0998384_98_388 96
199 3300046462 Ga0495651_0526571 Ga0495651_0526571_27_317 96
200 3300046491 Ga0495584_0435476 Ga0495584_0435476_32_322 96
201 3300046507 Ga0495606_0114983 Ga0495606_0114983_26_316 96
202 3300046684 Ga0495669_0237677 Ga0495669_0237677_435_725 96
203 3300048928 Ga0496125_0193172 Ga0496125_0193172_372_662 96
204 3300048929 Ga0496126_0002340 Ga0496126_0002340_3915_4205 96
205 3300048929 Ga0496126_0732282 Ga0496126_0732282_155_445 96
206 3300048929 Ga0496126_1033051 Ga0496126_1033051_181_471 96
207 3300049570 Ga0501033_0210297 Ga0501033_0210297_743_1033 96
208 3300049572 Ga0501036_0432108 Ga0501036_0432108_700_990 96
209 3300049574 Ga0501038_0082989 Ga0501038_0082989_357_647 96
210 3300049576 Ga0501040_0023359 Ga0501040_0023359_2002_2292 96
211 3300049576 Ga0501040_0082537 Ga0501040_0082537_919_1209 96
212 3300049577 Ga0501041_0029174 Ga0501041_0029174_2889_3179 96
213 3300049577 Ga0501041_0033160 Ga0501041_0033160_958_1248 96
214 3300049578 Ga0501042_0021872 Ga0501042_0021872_3389_3679 96
215 3300049578 Ga0501042_0049425 Ga0501042_0049425_45_335 96
216 3300049578 Ga0501042_1081471 Ga0501042_1081471_273_563 96
217 3300049580 Ga0501046_0466767 Ga0501046_0466767_32_322 96
218 3300049582 Ga0501048_0072325 Ga0501048_0072325_492_782 96
219 3300049582 Ga0501048_0147095 Ga0501048_0147095_371_661 96
220 3300049585 Ga0501069_0025011 Ga0501069_0025011_2120_2410 96
221 3300049586 Ga0501070_0466955 Ga0501070_0466955_230_520 96
222 3300049587 Ga0501071_0025464 Ga0501071_0025464_1743_2033 96
223 3300049588 Ga0501072_0005763 Ga0501072_0005763_3424_3714 96
224 3300049588 Ga0501072_0636200 Ga0501072_0636200_51_341 96
225 3300049589 Ga0501073_0177174 Ga0501073_0177174_260_550 96
226 3300049590 Ga0501074_0110619 Ga0501074_0110619_1427_1717 96
227 3300049590 Ga0501074_0185786 Ga0501074_0185786_985_1275 96
228 3300049591 Ga0501075_0003753 Ga0501075_0003753_7899_8189 96
229 3300049592 Ga0501076_0001091 Ga0501076_0001091_12180_12470 96
230 3300049593 Ga0501077_0040472 Ga0501077_0040472_2151_2441 96
231 3300049741 Ga0501079_0011674 Ga0501079_0011674_3205_3495 96
232 3300049742 Ga0501080_1074185 Ga0501080_1074185_352_642 96
233 3300049743 Ga0501081_0006843 Ga0501081_0006843_4685_4975 96
234 3300049743 Ga0501081_1258973 Ga0501081_1258973_215_505 96
235 3300049744 Ga0501083_0123211 Ga0501083_0123211_625_915 96
236 3300049822 Ga0501035_0249388 Ga0501035_0249388_412_702 96
237 3300049824 Ga0501045_0007341 Ga0501045_0007341_5024_5314 96
238 3300050508 nmdc:mga09592_1056472_c1 nmdc:mga09592_1056472_c1_78_368 96
239 3300050510 nmdc:mga06r32_106764_c1 nmdc:mga06r32_106764_c1_983_1273 96
240 3300050511 nmdc:mga08y16_270673_c1 nmdc:mga08y16_270673_c1_780_1070 96
241 3300050512 nmdc:mga0n895_160009_c1 nmdc:mga0n895_160009_c1_1672_1962 96
242 3300050512 nmdc:mga0n895_1838237_c1 nmdc:mga0n895_1838237_c1_66_356 96
243 3300053146 Ga0500588_0143199 Ga0500588_0143199_132_422 96
244 3300053153 Ga0500616_0007590 Ga0500616_0007590_4294_4584 96
245 3300054114 Ga0501084_0085086 Ga0501084_0085086_577_867 96
246 3300054114 Ga0501084_0894195 Ga0501084_0894195_42_332 96
247 3300060353 Ga0501082_0003995 Ga0501082_0003995_10853_11143 96
248 3300061734 Ga0530510_0002851 Ga0530510_0002851_2970_3260 96
249 3300002070 JGI24750J21931_1071966 JGI24750J21931_10719661 97
250 3300003215 JGI25153J46596_10000650 JGI25153J46596_1000065017 97
251 3300003215 JGI25153J46596_10138998 JGI25153J46596_101389981 97
252 3300003322 rootL2_10030195 rootL2_100301954 97
253 3300005293 Ga0065715_10979403 Ga0065715_109794031 97
254 3300005328 Ga0070676_10058415 Ga0070676_100584152 97
255 3300005334 Ga0068869_100030710 Ga0068869_1000307102 97
256 3300005334 Ga0068869_100265826 Ga0068869_1002658262 97
257 3300005340 Ga0070689_100781394 Ga0070689_1007813942 97
258 3300005340 Ga0070689_101194229 Ga0070689_1011942291 97
259 3300005343 Ga0070687_100943973 Ga0070687_1009439732 97
260 3300005345 Ga0070692_10393159 Ga0070692_103931592 97
261 3300005345 Ga0070692_11007017 Ga0070692_110070171 97
262 3300005353 Ga0070669_100576354 Ga0070669_1005763542 97
263 3300005353 Ga0070669_101372647 Ga0070669_1013726472 97
264 3300005354 Ga0070675_100073810 Ga0070675_1000738102 97
265 3300005356 Ga0070674_100027958 Ga0070674_1000279583 97
266 3300005356 Ga0070674_100560701 Ga0070674_1005607012 97
267 3300005356 Ga0070674_100670116 Ga0070674_1006701162 97
268 3300005364 Ga0070673_101129652 Ga0070673_1011296522 97
269 3300005364 Ga0070673_101534127 Ga0070673_1015341271 97
270 3300005365 Ga0070688_100091243 Ga0070688_1000912433 97
271 3300005366 Ga0070659_101442986 Ga0070659_1014429861 97
272 3300005367 Ga0070667_101086173 Ga0070667_1010861732 97
273 3300005437 Ga0070710_10751865 Ga0070710_107518652 97
274 3300005438 Ga0070701_10117592 Ga0070701_101175922 97
275 3300005439 Ga0070711_100218166 Ga0070711_1002181662 97
276 3300005439 Ga0070711_101288261 Ga0070711_1012882612 97
277 3300005440 Ga0070705_100363085 Ga0070705_1003630852 97
278 3300005440 Ga0070705_100438709 Ga0070705_1004387092 97
279 3300005440 Ga0070705_101477116 Ga0070705_1014771162 97
280 3300005441 Ga0070700_100271855 Ga0070700_1002718552 97
281 3300005441 Ga0070700_101103784 Ga0070700_1011037842 97
282 3300005444 Ga0070694_100127943 Ga0070694_1001279432 97
283 3300005444 Ga0070694_101686978 Ga0070694_1016869781 97
284 3300005445 Ga0070708_101668294 Ga0070708_1016682941 97
285 3300005456 Ga0070678_100392908 Ga0070678_1003929082 97
286 3300005456 Ga0070678_100556655 Ga0070678_1005566551 97
287 3300005456 Ga0070678_101649091 Ga0070678_1016490911 97
288 3300005459 Ga0068867_100012294 Ga0068867_1000122949 97
289 3300005467 Ga0070706_100177584 Ga0070706_1001775843 97
290 3300005518 Ga0070699_100017541 Ga0070699_1000175415 97
291 3300005518 Ga0070699_100097770 Ga0070699_1000977703 97
292 3300005536 Ga0070697_100189249 Ga0070697_1001892491 97
293 3300005545 Ga0070695_100059544 Ga0070695_1000595443 97
294 3300005545 Ga0070695_100102066 Ga0070695_1001020662 97
295 3300005546 Ga0070696_100088550 Ga0070696_1000885504 97
296 3300005546 Ga0070696_100222857 Ga0070696_1002228572 97
297 3300005546 Ga0070696_100342358 Ga0070696_1003423582 97
298 3300005546 Ga0070696_100360207 Ga0070696_1003602072 97
299 3300005546 Ga0070696_100613220 Ga0070696_1006132202 97
300 3300005546 Ga0070696_101903533 Ga0070696_1019035331 97
301 3300005548 Ga0070665_101603816 Ga0070665_1016038162 97
302 3300005549 Ga0070704_100479581 Ga0070704_1004795812 97
303 3300005549 Ga0070704_100835754 Ga0070704_1008357542 97
304 3300005549 Ga0070704_101136050 Ga0070704_1011360502 97
305 3300005563 Ga0068855_100058069 Ga0068855_1000580699 97
306 3300005615 Ga0070702_101294085 Ga0070702_1012940851 97
307 3300005615 Ga0070702_101759084 Ga0070702_1017590841 97
308 3300005618 Ga0068864_101617432 Ga0068864_1016174322 97
309 3300005841 Ga0068863_100615008 Ga0068863_1006150082 97
310 3300005842 Ga0068858_100636857 Ga0068858_1006368572 97
311 3300005842 Ga0068858_101727801 Ga0068858_1017278012 97
312 3300005843 Ga0068860_101077138 Ga0068860_1010771383 97
313 3300005843 Ga0068860_101318383 Ga0068860_1013183832 97
314 3300005844 Ga0068862_100557848 Ga0068862_1005578482 97
315 3300005981 Ga0081538_10129875 Ga0081538_101298752 97
316 3300005983 Ga0081540_1000883 Ga0081540_100088324 97
317 3300006028 Ga0070717_11072783 Ga0070717_110727832 97
318 3300006028 Ga0070717_11229111 Ga0070717_112291112 97
319 3300006038 Ga0075365_10005585 Ga0075365_100055856 97
320 3300006038 Ga0075365_10583654 Ga0075365_105836542 97
321 3300006042 Ga0075368_10211734 Ga0075368_102117342 97
322 3300006048 Ga0075363_100211303 Ga0075363_1002113032 97
323 3300006048 Ga0075363_100546363 Ga0075363_1005463631 97
324 3300006058 Ga0075432_10223472 Ga0075432_102234722 97
325 3300006058 Ga0075432_10325190 Ga0075432_103251902 97
326 3300006163 Ga0070715_10125740 Ga0070715_101257402 97
327 3300006175 Ga0070712_100574179 Ga0070712_1005741793 97
328 3300006177 Ga0075362_10151578 Ga0075362_101515781 97
329 3300006178 Ga0075367_10134948 Ga0075367_101349482 97
330 3300006195 Ga0075366_10135469 Ga0075366_101354693 97
331 3300006353 Ga0075370_10448050 Ga0075370_104480501 97
332 3300006353 Ga0075370_10756301 Ga0075370_107563012 97
333 3300006358 Ga0068871_101183046 Ga0068871_1011830462 97
334 3300006844 Ga0075428_100066543 Ga0075428_1000665435 97
335 3300006844 Ga0075428_102454265 Ga0075428_1024542652 97
336 3300006846 Ga0075430_100063087 Ga0075430_1000630873 97
337 3300006846 Ga0075430_100067513 Ga0075430_1000675132 97
338 3300006846 Ga0075430_101778504 Ga0075430_1017785042 97
339 3300006846 Ga0075430_101801605 Ga0075430_1018016052 97
340 3300006847 Ga0075431_100943146 Ga0075431_1009431462 97
341 3300006847 Ga0075431_101001670 Ga0075431_1010016702 97
342 3300006847 Ga0075431_101448038 Ga0075431_1014480381 97
343 3300006852 Ga0075433_10001521 Ga0075433_100015213 97
344 3300006871 Ga0075434_100001305 Ga0075434_1000013059 97
345 3300006880 Ga0075429_100009998 Ga0075429_1000099982 97
346 3300006880 Ga0075429_100549168 Ga0075429_1005491682 97
347 3300006881 Ga0068865_100694774 Ga0068865_1006947742 97
348 3300006914 Ga0075436_100004325 Ga0075436_10000432511 97
349 3300006914 Ga0075436_100288247 Ga0075436_1002882472 97
350 3300007076 Ga0075435_100022245 Ga0075435_1000222453 97
351 3300009093 Ga0105240_10018552 Ga0105240_1001855217 97
352 3300009094 Ga0111539_10173839 Ga0111539_101738393 97
353 3300009094 Ga0111539_10378186 Ga0111539_103781862 97
354 3300009094 Ga0111539_10519283 Ga0111539_105192832 97
355 3300009094 Ga0111539_11424578 Ga0111539_114245782 97
356 3300009094 Ga0111539_12667854 Ga0111539_126678542 97
357 3300009098 Ga0105245_10550981 Ga0105245_105509812 97
358 3300009098 Ga0105245_11590194 Ga0105245_115901942 97
359 3300009098 Ga0105245_12631305 Ga0105245_126313051 97
360 3300009147 Ga0114129_10005727 Ga0114129_100057278 97
361 3300009147 Ga0114129_10518750 Ga0114129_105187502 97
362 3300009147 Ga0114129_10934941 Ga0114129_109349412 97
363 3300009147 Ga0114129_12445779 Ga0114129_124457792 97
364 3300009148 Ga0105243_10202946 Ga0105243_102029462 97
365 3300009176 Ga0105242_10782362 Ga0105242_107823622 97
366 3300009176 Ga0105242_11272519 Ga0105242_112725192 97
367 3300009177 Ga0105248_10128976 Ga0105248_101289762 97
368 3300009177 Ga0105248_10398623 Ga0105248_103986233 97
369 3300009177 Ga0105248_11919889 Ga0105248_119198892 97
370 3300009545 Ga0105237_11620597 Ga0105237_116205972 97
371 3300009553 Ga0105249_11872936 Ga0105249_118729362 97
372 3300010375 Ga0105239_10690798 Ga0105239_106907981 97
373 3300010375 Ga0105239_13432763 Ga0105239_134327632 97
374 3300013105 Ga0157369_10298752 Ga0157369_102987521 97
375 3300013297 Ga0157378_11894851 Ga0157378_118948511 97
376 3300013306 Ga0163162_10270093 Ga0163162_102700934 97
377 3300013306 Ga0163162_11178817 Ga0163162_111788172 97
378 3300013306 Ga0163162_12361661 Ga0163162_123616611 97
379 3300013308 Ga0157375_11206622 Ga0157375_112066222 97
380 3300014326 Ga0157380_10026934 Ga0157380_100269345 97
381 3300014968 Ga0157379_10047671 Ga0157379_100476714 97
382 3300014969 Ga0157376_10350807 Ga0157376_103508073 97
383 3300014969 Ga0157376_11404991 Ga0157376_114049912 97
384 3300017792 Ga0163161_10043810 Ga0163161_100438102 97
385 3300025297 Ga0209758_1000074 Ga0209758_1000074177 97
386 3300025297 Ga0209758_1059403 Ga0209758_10594033 97
387 3300025302 Ga0207426_1059685 Ga0207426_10596853 97
388 3300025893 Ga0207682_10097232 Ga0207682_100972322 97
389 3300025899 Ga0207642_10098190 Ga0207642_100981902 97
390 3300025905 Ga0207685_10034499 Ga0207685_100344995 97
391 3300025906 Ga0207699_11307376 Ga0207699_113073761 97
392 3300025907 Ga0207645_10011013 Ga0207645_1001101311 97
393 3300025909 Ga0207705_10060690 Ga0207705_100606903 97
394 3300025910 Ga0207684_10653024 Ga0207684_106530242 97
395 3300025913 Ga0207695_10021125 Ga0207695_100211251 97
396 3300025916 Ga0207663_10144681 Ga0207663_101446813 97
397 3300025918 Ga0207662_10101120 Ga0207662_101011202 97
398 3300025918 Ga0207662_10131102 Ga0207662_101311021 97
399 3300025921 Ga0207652_11076784 Ga0207652_110767842 97
400 3300025926 Ga0207659_10026847 Ga0207659_100268472 97
401 3300025929 Ga0207664_10048812 Ga0207664_100488123 97
402 3300025931 Ga0207644_10104786 Ga0207644_101047864 97
403 3300025931 Ga0207644_10568725 Ga0207644_105687252 97
404 3300025932 Ga0207690_10460100 Ga0207690_104601002 97
405 3300025934 Ga0207686_10089150 Ga0207686_100891502 97
406 3300025934 Ga0207686_10349998 Ga0207686_103499981 97
407 3300025935 Ga0207709_10134301 Ga0207709_101343012 97
408 3300025936 Ga0207670_11267413 Ga0207670_112674132 97
409 3300025936 Ga0207670_11685527 Ga0207670_116855271 97
410 3300025937 Ga0207669_10123112 Ga0207669_101231122 97
411 3300025937 Ga0207669_11006416 Ga0207669_110064162 97
412 3300025937 Ga0207669_11298435 Ga0207669_112984352 97
413 3300025938 Ga0207704_10142295 Ga0207704_101422952 97
414 3300025939 Ga0207665_10167239 Ga0207665_101672392 97
415 3300025939 Ga0207665_10277061 Ga0207665_102770613 97
416 3300025940 Ga0207691_10399034 Ga0207691_103990342 97
417 3300025941 Ga0207711_10259112 Ga0207711_102591122 97
418 3300025941 Ga0207711_11141657 Ga0207711_111416572 97
419 3300025942 Ga0207689_10044224 Ga0207689_100442242 97
420 3300025942 Ga0207689_10740281 Ga0207689_107402811 97
421 3300025949 Ga0207667_10045834 Ga0207667_100458342 97
422 3300025960 Ga0207651_11213655 Ga0207651_112136552 97
423 3300025972 Ga0207668_10869781 Ga0207668_108697812 97
424 3300026035 Ga0207703_10895872 Ga0207703_108958722 97
425 3300026067 Ga0207678_10259942 Ga0207678_102599422 97
426 3300026075 Ga0207708_10113037 Ga0207708_101130374 97
427 3300026075 Ga0207708_11219826 Ga0207708_112198262 97
428 3300026088 Ga0207641_10835025 Ga0207641_108350251 97
429 3300026089 Ga0207648_10002985 Ga0207648_1000298511 97
430 3300026089 Ga0207648_10291304 Ga0207648_102913041 97
431 3300026118 Ga0207675_100240718 Ga0207675_1002407182 97
432 3300026121 Ga0207683_10026920 Ga0207683_100269202 97
433 3300026121 Ga0207683_10329268 Ga0207683_103292682 97
434 3300027360 Ga0209969_1018846 Ga0209969_10188462 97
435 3300027378 Ga0209981_1033831 Ga0209981_10338312 97
436 3300027378 Ga0209981_1048638 Ga0209981_10486382 97
437 3300027395 Ga0209996_1024381 Ga0209996_10243812 97
438 3300027424 Ga0209984_1050273 Ga0209984_10502732 97
439 3300027471 Ga0209995_1000904 Ga0209995_10009044 97
440 3300027526 Ga0209968_1018379 Ga0209968_10183791 97
441 3300027543 Ga0209999_1001577 Ga0209999_10015773 97
442 3300027543 Ga0209999_1050335 Ga0209999_10503352 97
443 3300027614 Ga0209970_1017346 Ga0209970_10173462 97
444 3300027614 Ga0209970_1061785 Ga0209970_10617851 97
445 3300027665 Ga0209983_1011704 Ga0209983_10117042 97
446 3300027682 Ga0209971_1009679 Ga0209971_10096793 97
447 3300027682 Ga0209971_1025164 Ga0209971_10251642 97
448 3300027682 Ga0209971_1193430 Ga0209971_11934302 97
449 3300027866 Ga0209813_10100811 Ga0209813_101008112 97
450 3300027876 Ga0209974_10003351 Ga0209974_100033513 97
451 3300027876 Ga0209974_10153898 Ga0209974_101538982 97
452 3300027876 Ga0209974_10250489 Ga0209974_102504891 97
453 3300027907 Ga0207428_10087450 Ga0207428_100874503 97
454 3300027907 Ga0207428_11049042 Ga0207428_110490422 97
455 3300027907 Ga0207428_11176903 Ga0207428_111769032 97
456 3300028379 Ga0268266_10363748 Ga0268266_103637482 97
457 3300028380 Ga0268265_10271889 Ga0268265_102718892 97
458 3300028381 Ga0268264_10244950 Ga0268264_102449503 97
459 3300031241 Ga0265325_10065772 Ga0265325_100657722 97
460 3300031548 Ga0307408_102385831 Ga0307408_1023858311 97
461 3300031595 Ga0265313_10034299 Ga0265313_100342992 97
462 3300031731 Ga0307405_11277335 Ga0307405_112773352 97
463 3300031731 Ga0307405_11346035 Ga0307405_113460352 97
464 3300031911 Ga0307412_10384001 Ga0307412_103840012 97
465 3300031995 Ga0307409_100448831 Ga0307409_1004488312 97
466 3300032002 Ga0307416_101407697 Ga0307416_1014076972 97
467 3300032002 Ga0307416_103018253 Ga0307416_1030182532 97
468 3300032004 Ga0307414_10555685 Ga0307414_105556852 97
469 3300032005 Ga0307411_10132689 Ga0307411_101326892 97
470 3300032005 Ga0307411_11315769 Ga0307411_113157692 97
471 3300033180 Ga0307510_10249853 Ga0307510_102498532 97
472 3300034816 Ga0373930_0102276 Ga0373930_0102276_116_412 97
473 3300034818 Ga0373950_0046128 Ga0373950_0046128_295_591 97
474 3300034819 Ga0373958_0096614 Ga0373958_0096614_272_568 97
475 3300035083 Ga0373926_0263483 Ga0373926_0263483_178_474 97
476 3300035088 Ga0373940_0315390 Ga0373940_0315390_83_379 97
477 3300035112 Ga0373932_0120925 Ga0373932_0120925_420_713 97
478 3300035112 Ga0373932_0390867 Ga0373932_0390867_155_481 97
479 3300035116 Ga0373945_0349944 Ga0373945_0349944_10_306 97
480 3300035120 Ga0373957_0561347 Ga0373957_0561347_56_361 97
481 3300035171 Ga0373946_0028836 Ga0373946_0028836_1033_1329 97
482 3300035171 Ga0373946_0628728 Ga0373946_0628728_41_337 97
483 3300035172 Ga0373955_0038176 Ga0373955_0038176_1463_1759 97
484 3300035691 Ga0373931_0002612 Ga0373931_0002612_6885_7181 97
485 3300035692 Ga0373935_0304146 Ga0373935_0304146_758_1054 97
486 3300035695 Ga0373927_0201101 Ga0373927_0201101_317_613 97
487 3300035695 Ga0373927_0421065 Ga0373927_0421065_480_776 97
488 3300035724 Ga0373933_0417977 Ga0373933_0417977_400_705 97
489 3300035725 Ga0373947_0272514 Ga0373947_0272514_709_1005 97
490 3300035725 Ga0373947_0407283 Ga0373947_0407283_106_399 97
491 3300035725 Ga0373947_0846487 Ga0373947_0846487_124_420 97
492 3300036401 Ga0373937_0208163 Ga0373937_0208163_834_1130 97
493 3300037068 Ga0373925_0020491 Ga0373925_0020491_941_1237 97
494 3300037068 Ga0373925_1416279 Ga0373925_1416279_80_385 97
495 3300039450 Ga0436363_1416401 Ga0436363_1416401_781_1074 97
496 3300041404 Ga0439436_0111736 Ga0439436_0111736_132_425 97
497 3300041404 Ga0439436_0173384 Ga0439436_0173384_190_483 97
498 3300042001 Ga0439441_034380 Ga0439441_034380_284_583 97
499 3300042001 Ga0439441_114393 Ga0439441_114393_86_379 97
500 3300042013 Ga0439456_016347 Ga0439456_016347_177_470 97
501 3300042015 Ga0439462_0231460 Ga0439462_0231460_93_386 97
502 3300042156 Ga0439446_0048257 Ga0439446_0048257_916_1209 97
503 3300042156 Ga0439446_0102642 Ga0439446_0102642_186_479 97
504 3300042157 Ga0439458_0231599 Ga0439458_0231599_206_499 97
505 3300042435 Ga0439434_0150154 Ga0439434_0150154_198_491 97
506 3300042436 Ga0439435_0001802 Ga0439435_0001802_196_489 97
507 3300042436 Ga0439435_0003371 Ga0439435_0003371_1835_2134 97
508 3300042461 Ga0439460_0011547 Ga0439460_0011547_316_615 97
509 3300045051 Ga0451576_0130939 Ga0451576_0130939_210_503 97
510 3300046454 Ga0495592_0212786 Ga0495592_0212786_26_322 97
511 3300046477 Ga0495664_0315388 Ga0495664_0315388_31_327 97
512 3300046491 Ga0495584_0561565 Ga0495584_0561565_134_427 97
513 3300046515 Ga0495620_0117633 Ga0495620_0117633_464_760 97
514 3300046516 Ga0495628_0180049 Ga0495628_0180049_1101_1397 97
515 3300046523 Ga0495644_0154555 Ga0495644_0154555_140_436 97
516 3300046528 Ga0495642_0226442 Ga0495642_0226442_67_360 97
517 3300046529 Ga0495652_0702548 Ga0495652_0702548_313_609 97
518 3300046533 Ga0495640_0187672 Ga0495640_0187672_564_860 97
519 3300046615 Ga0495656_0672921 Ga0495656_0672921_25_321 97
520 3300046642 Ga0495634_0677340 Ga0495634_0677340_14_310 97
521 3300046678 Ga0495599_0531934 Ga0495599_0531934_248_553 97
522 3300046678 Ga0495599_0811585 Ga0495599_0811585_226_522 97
523 3300046680 Ga0495646_0053643 Ga0495646_0053643_1625_1921 97
524 3300046681 Ga0495647_0295472 Ga0495647_0295472_72_377 97
525 3300046684 Ga0495669_0443997 Ga0495669_0443997_180_473 97
526 3300046689 Ga0495613_0370523 Ga0495613_0370523_82_378 97
527 3300046692 Ga0495671_0274347 Ga0495671_0274347_57_356 97
528 3300046694 Ga0495649_0306544 Ga0495649_0306544_465_761 97
529 3300047317 Ga0495604_0076963 Ga0495604_0076963_1386_1682 97
530 3300047319 Ga0495674_0136111 Ga0495674_0136111_482_778 97
531 3300047444 Ga0495675_0293101 Ga0495675_0293101_73_369 97
532 3300047472 Ga0495686_0700547 Ga0495686_0700547_50_346 97
533 3300048088 Ga0495602_0254267 Ga0495602_0254267_467_763 97
534 3300048903 Ga0496100_0003275 Ga0496100_0003275_7302_7598 97
535 3300048903 Ga0496100_0512477 Ga0496100_0512477_597_902 97
536 3300048907 Ga0496104_0108167 Ga0496104_0108167_1233_1538 97
537 3300048907 Ga0496104_0276361 Ga0496104_0276361_90_386 97
538 3300048908 Ga0496105_0023306 Ga0496105_0023306_380_685 97
539 3300048908 Ga0496105_0307858 Ga0496105_0307858_400_696 97
540 3300048909 Ga0496106_1269567 Ga0496106_1269567_30_326 97
541 3300048910 Ga0496107_0065291 Ga0496107_0065291_2171_2467 97
542 3300048910 Ga0496107_0282922 Ga0496107_0282922_613_918 97
543 3300048911 Ga0496108_0195181 Ga0496108_0195181_327_623 97
544 3300048914 Ga0496111_0101576 Ga0496111_0101576_1616_1912 97
545 3300048915 Ga0496112_0121484 Ga0496112_0121484_849_1145 97
546 3300048915 Ga0496112_0170056 Ga0496112_0170056_32_331 97
547 3300048917 Ga0496114_0036965 Ga0496114_0036965_312_617 97
548 3300048917 Ga0496114_0072416 Ga0496114_0072416_1137_1433 97
549 3300048917 Ga0496114_0805501 Ga0496114_0805501_506_805 97
550 3300048918 Ga0496115_0007210 Ga0496115_0007210_3309_3614 97
551 3300048918 Ga0496115_0055854 Ga0496115_0055854_2802_3098 97
552 3300049568 Ga0501031_0421370 Ga0501031_0421370_306_599 97
553 3300049568 Ga0501031_0690061 Ga0501031_0690061_163_456 97
554 3300049573 Ga0501037_0570711 Ga0501037_0570711_162_455 97
555 3300049574 Ga0501038_0927366 Ga0501038_0927366_117_410 97
556 3300049575 Ga0501039_0663385 Ga0501039_0663385_431_724 97
557 3300049576 Ga0501040_0737416 Ga0501040_0737416_106_399 97
558 3300049576 Ga0501040_0850548 Ga0501040_0850548_234_527 97
559 3300049577 Ga0501041_0078476 Ga0501041_0078476_940_1233 97
560 3300049578 Ga0501042_0329666 Ga0501042_0329666_616_909 97
561 3300049579 Ga0501043_0874152 Ga0501043_0874152_339_632 97
562 3300049580 Ga0501046_0204857 Ga0501046_0204857_25_318 97
563 3300049582 Ga0501048_0347122 Ga0501048_0347122_689_982 97
564 3300049587 Ga0501071_0470003 Ga0501071_0470003_247_540 97
565 3300049587 Ga0501071_0511017 Ga0501071_0511017_378_674 97
566 3300049587 Ga0501071_1586460 Ga0501071_1586460_194_487 97
567 3300049588 Ga0501072_0166260 Ga0501072_0166260_829_1122 97
568 3300049588 Ga0501072_0411107 Ga0501072_0411107_714_1007 97
569 3300049588 Ga0501072_1480176 Ga0501072_1480176_67_360 97
570 3300049590 Ga0501074_1132363 Ga0501074_1132363_114_407 97
571 3300049591 Ga0501075_0512467 Ga0501075_0512467_610_903 97
572 3300049592 Ga0501076_0414015 Ga0501076_0414015_291_584 97
573 3300049592 Ga0501076_0499990 Ga0501076_0499990_94_387 97
574 3300049592 Ga0501076_0788933 Ga0501076_0788933_348_641 97
575 3300049593 Ga0501077_0372546 Ga0501077_0372546_187_480 97
576 3300049743 Ga0501081_0660066 Ga0501081_0660066_89_382 97
577 3300049822 Ga0501035_0375746 Ga0501035_0375746_55_348 97
578 3300049824 Ga0501045_0558252 Ga0501045_0558252_248_541 97
579 3300050490 nmdc:mga03n38_149604_c1 nmdc:mga03n38_149604_c1_36_335 97
580 3300050492 nmdc:mga0yw44_1924_c1 nmdc:mga0yw44_1924_c1_446_745 97
581 3300050492 nmdc:mga0yw44_84473_c1 nmdc:mga0yw44_84473_c1_253_552 97
582 3300050493 nmdc:mga0k408_35870_c1 nmdc:mga0k408_35870_c1_700_996 97
583 3300050493 nmdc:mga0k408_659226_c1 nmdc:mga0k408_659226_c1_127_423 97
584 3300050494 nmdc:mga06z11_182705_c1 nmdc:mga06z11_182705_c1_32_331 97
585 3300050494 nmdc:mga06z11_506526_c1 nmdc:mga06z11_506526_c1_182_478 97
586 3300050494 nmdc:mga06z11_776454_c1 nmdc:mga06z11_776454_c1_257_556 97
587 3300050495 nmdc:mga04h51_172925_c1 nmdc:mga04h51_172925_c1_165_464 97
588 3300050496 nmdc:mga07m45_556158_c1 nmdc:mga07m45_556158_c1_70_369 97
589 3300050507 nmdc:mga05p37_318473_c1 nmdc:mga05p37_318473_c1_154_447 97
590 3300050508 nmdc:mga09592_18107_c1 nmdc:mga09592_18107_c1_1030_1323 97
591 3300050508 nmdc:mga09592_831534_c1 nmdc:mga09592_831534_c1_433_726 97
592 3300050508 nmdc:mga09592_919371_c1 nmdc:mga09592_919371_c1_413_706 97
593 3300050508 nmdc:mga09592_979138_c1 nmdc:mga09592_979138_c1_328_624 97
594 3300050509 nmdc:mga0qj67_1566764_c1 nmdc:mga0qj67_1566764_c1_61_354 97
595 3300050509 nmdc:mga0qj67_30276_c1 nmdc:mga0qj67_30276_c1_2141_2434 97
596 3300050509 nmdc:mga0qj67_630801_c1 nmdc:mga0qj67_630801_c1_318_614 97
597 3300050509 nmdc:mga0qj67_653699_c1 nmdc:mga0qj67_653699_c1_18_311 97
598 3300050509 nmdc:mga0qj67_725446_c1 nmdc:mga0qj67_725446_c1_421_714 97
599 3300050510 nmdc:mga06r32_1150486_c1 nmdc:mga06r32_1150486_c1_322_615 97
600 3300050510 nmdc:mga06r32_1889735_c1 nmdc:mga06r32_1889735_c1_203_496 97
601 3300050510 nmdc:mga06r32_96527_c1 nmdc:mga06r32_96527_c1_2046_2339 97
602 3300050511 nmdc:mga08y16_208263_c1 nmdc:mga08y16_208263_c1_1539_1865 97
603 3300050511 nmdc:mga08y16_33511_c1 nmdc:mga08y16_33511_c1_1862_2188 97
604 3300050511 nmdc:mga08y16_429976_c1 nmdc:mga08y16_429976_c1_329_622 97
605 3300050512 nmdc:mga0n895_4031_c1 nmdc:mga0n895_4031_c1_3814_4107 97
606 3300050513 nmdc:mga0rr50_8806_c1 nmdc:mga0rr50_8806_c1_3742_4035 97
607 3300050514 nmdc:mga08x19_1704_c1 nmdc:mga08x19_1704_c1_4517_4810 97
608 3300050514 nmdc:mga08x19_20400_c1 nmdc:mga08x19_20400_c1_598_891 97
609 3300050514 nmdc:mga08x19_769303_c1 nmdc:mga08x19_769303_c1_85_378 97
610 3300050515 nmdc:mga0a205_173_c1 nmdc:mga0a205_173_c1_4510_4803 97
611 3300053077 Ga0495601_0078981 Ga0495601_0078981_846_1142 97
612 3300053078 Ga0495612_0117070 Ga0495612_0117070_10_306 97
613 3300053085 Ga0495619_0277421 Ga0495619_0277421_287_583 97
614 3300053104 Ga0500556_0169826 Ga0500556_0169826_230_526 97
615 3300053130 Ga0500642_0022849 Ga0500642_0022849_1934_2230 97
616 3300053139 Ga0500568_0083696 Ga0500568_0083696_772_1068 97
617 3300053146 Ga0500588_0261081 Ga0500588_0261081_323_619 97
618 3300053153 Ga0500616_0057208 Ga0500616_0057208_751_1047 97
619 3300054114 Ga0501084_1381017 Ga0501084_1381017_185_478 97
620 3300059421 Ga0590071_012909 Ga0590071_012909_1184_1477 97
621 3300059424 Ga0590075_023523 Ga0590075_023523_291_584 97
622 3300060353 Ga0501082_0311786 Ga0501082_0311786_902_1195 97
623 3300060353 Ga0501082_1419964 Ga0501082_1419964_299_592 97

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07045

DUF1330

Domain of unknown function (DUF1330)

14

107

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.914 1 96
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.9065 3 92
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.8615 3 92
3dca-assembly2.cif.gz_D crystal structure of the rpa0582- protein of unknown function from rhodopseudomonas palustris- a structural genomics target 0.7153 2 96
3hhl-assembly2.cif.gz_C crystal structure of methylated rpa0582 protein 0.7115 2 96
ID Description Score Start End Superfamily
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.882 3 96 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8704 4 92 3.30.70.100
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8646 3 96 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8282 4 92 3.30.70.100
af_A0A0R0GC68_3_111_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7097 2 95 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A1I4AAT7-F1-model_v4 Uncharacterized conserved protein, DUF1330 family 0.9631 1 96
AF-A0A358PEN8-F1-model_v4 DUF1330 domain-containing protein 0.9624 1 96
AF-A0A6N4U901-F1-model_v4 deleted 0.9622 1 96
AF-A0A7Y9J7Z7-F1-model_v4 Uncharacterized protein (DUF1330 family) 0.9589 3 95
AF-A0A6J4NLL1-F1-model_v4 DUF1330 domain-containing protein 0.9589 3 95

Feature Viewer

pLDDT pTM Quality
94.79 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map