F470186
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 623 | 330 | 623 | 97 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10173839|Ga0111539_101738393 |
| Length | 108 |
| Sequence | MSPISGHKEKRMAKAYWVVQYRKIKNPDKLAAYAKLAGPAIQAAGGKFLVRGTPAKVYEGGLKERTVVSEWESLEKAIAGHDSPGYQEALRALGDGAERDLRIVEGVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 191 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 201 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 202 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 203 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 205 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 207 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 213 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 218 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 219 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 220 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 224 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 227 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 228 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 229 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 230 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 231 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 232 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 233 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 236 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 237 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 238 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 239 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 274 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 275 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 276 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 304 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 306 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 307 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 308 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 322 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 323 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 324 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 325 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 326 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 328 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.3 |
| Nodule | 0 |
| Rhizoplane | 2.89 |
| Rhizosphere | 89.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1071966 | 3300002070 | Bacteria | 565 |
| 2 | JGI24742J22300_10068105 | 3300002244 | Bacteria | 661 |
| 3 | JGI25153J46596_10000650 | 3300003215 | Bacteria | 21224 |
| 4 | JGI25153J46596_10138998 | 3300003215 | Bacteria | 531 |
| 5 | rootL2_10030195 | 3300003322 | Bacteria | 4070 |
| 6 | rootH1_10037109 | 3300003323 | Unclassified | 1926 |
| 7 | rootH1_10221863 | 3300003323 | Bacteria | 1233 |
| 8 | Ga0065715_10979403 | 3300005293 | Bacteria | 514 |
| 9 | Ga0070676_10058415 | 3300005328 | Bacteria | 2286 |
| 10 | Ga0070676_10450801 | 3300005328 | Bacteria | 905 |
| 11 | Ga0070670_100086582 | 3300005331 | Bacteria | 2692 |
| 12 | Ga0070677_10217563 | 3300005333 | Bacteria | 931 |
| 13 | Ga0068869_100030710 | 3300005334 | Bacteria | 3774 |
| 14 | Ga0068869_100226418 | 3300005334 | Bacteria | 1484 |
| 15 | Ga0068869_100265826 | 3300005334 | Bacteria | 1375 |
| 16 | Ga0068869_101311364 | 3300005334 | Bacteria | 639 |
| 17 | Ga0070666_10048909 | 3300005335 | Bacteria | 2841 |
| 18 | Ga0070680_100054066 | 3300005336 | Bacteria | 3278 |
| 19 | Ga0068868_100914845 | 3300005338 | Bacteria | 798 |
| 20 | Ga0070689_100781394 | 3300005340 | Unclassified | 839 |
| 21 | Ga0070689_101194229 | 3300005340 | Bacteria | 683 |
| 22 | Ga0070687_100055332 | 3300005343 | Bacteria | 2072 |
| 23 | Ga0070687_100943973 | 3300005343 | Unclassified | 621 |
| 24 | Ga0070692_10014768 | 3300005345 | Bacteria | 3677 |
| 25 | Ga0070692_10393159 | 3300005345 | Bacteria | 873 |
| 26 | Ga0070692_11007017 | 3300005345 | Bacteria | 583 |
| 27 | Ga0070668_100015073 | 3300005347 | Bacteria | 5775 |
| 28 | Ga0070668_100023324 | 3300005347 | Bacteria | 4680 |
| 29 | Ga0070669_100001513 | 3300005353 | Bacteria | 16797 |
| 30 | Ga0070669_100576354 | 3300005353 | Bacteria | 941 |
| 31 | Ga0070669_101372647 | 3300005353 | Bacteria | 613 |
| 32 | Ga0070675_100023953 | 3300005354 | Bacteria | 4886 |
| 33 | Ga0070675_100073810 | 3300005354 | Bacteria | 2833 |
| 34 | Ga0070671_100422036 | 3300005355 | Bacteria | 1142 |
| 35 | Ga0070674_100027958 | 3300005356 | Bacteria | 3700 |
| 36 | Ga0070674_100560701 | 3300005356 | Bacteria | 960 |
| 37 | Ga0070674_100670116 | 3300005356 | Bacteria | 884 |
| 38 | Ga0070674_100934199 | 3300005356 | Bacteria | 757 |
| 39 | Ga0070673_100051114 | 3300005364 | Bacteria | 3235 |
| 40 | Ga0070673_101129652 | 3300005364 | Bacteria | 733 |
| 41 | Ga0070673_101534127 | 3300005364 | Bacteria | 629 |
| 42 | Ga0070673_101879356 | 3300005364 | Bacteria | 568 |
| 43 | Ga0070673_102075607 | 3300005364 | Unclassified | 540 |
| 44 | Ga0070688_100091243 | 3300005365 | Bacteria | 1991 |
| 45 | Ga0070659_101442986 | 3300005366 | Bacteria | 612 |
| 46 | Ga0070667_100117970 | 3300005367 | Bacteria | 2306 |
| 47 | Ga0070667_101086173 | 3300005367 | Bacteria | 748 |
| 48 | Ga0070667_101514344 | 3300005367 | Bacteria | 630 |
| 49 | Ga0070667_101579826 | 3300005367 | Bacteria | 616 |
| 50 | Ga0070710_10751865 | 3300005437 | Unclassified | 692 |
| 51 | Ga0070701_10117592 | 3300005438 | Bacteria | 1493 |
| 52 | Ga0070711_100218166 | 3300005439 | Unclassified | 1481 |
| 53 | Ga0070711_101288261 | 3300005439 | Bacteria | 634 |
| 54 | Ga0070705_100363085 | 3300005440 | Bacteria | 1060 |
| 55 | Ga0070705_100438709 | 3300005440 | Bacteria | 977 |
| 56 | Ga0070705_101477116 | 3300005440 | Bacteria | 569 |
| 57 | Ga0070700_100041008 | 3300005441 | Bacteria | 2836 |
| 58 | Ga0070700_100271855 | 3300005441 | Bacteria | 1225 |
| 59 | Ga0070700_100512018 | 3300005441 | Bacteria | 925 |
| 60 | Ga0070700_101103784 | 3300005441 | Bacteria | 658 |
| 61 | Ga0070694_100127943 | 3300005444 | Bacteria | 1831 |
| 62 | Ga0070694_101064416 | 3300005444 | Bacteria | 673 |
| 63 | Ga0070694_101125809 | 3300005444 | Bacteria | 656 |
| 64 | Ga0070694_101566094 | 3300005444 | Unclassified | 559 |
| 65 | Ga0070694_101686978 | 3300005444 | Unclassified | 539 |
| 66 | Ga0070708_100904442 | 3300005445 | Bacteria | 829 |
| 67 | Ga0070708_101668294 | 3300005445 | Bacteria | 593 |
| 68 | Ga0070663_101826592 | 3300005455 | Bacteria | 545 |
| 69 | Ga0070678_100302376 | 3300005456 | Bacteria | 1360 |
| 70 | Ga0070678_100392908 | 3300005456 | Bacteria | 1203 |
| 71 | Ga0070678_100556655 | 3300005456 | Bacteria | 1019 |
| 72 | Ga0070678_101649091 | 3300005456 | Bacteria | 603 |
| 73 | Ga0070662_101112748 | 3300005457 | Bacteria | 678 |
| 74 | Ga0070681_10020205 | 3300005458 | Bacteria | 6676 |
| 75 | Ga0070681_10070711 | 3300005458 | Bacteria | 3455 |
| 76 | Ga0070681_10540625 | 3300005458 | Unclassified | 1079 |
| 77 | Ga0068867_100000729 | 3300005459 | Bacteria | 22020 |
| 78 | Ga0068867_100012294 | 3300005459 | Bacteria | 6054 |
| 79 | Ga0068867_100085715 | 3300005459 | Bacteria | 2382 |
| 80 | Ga0070706_100177584 | 3300005467 | Bacteria | 1988 |
| 81 | Ga0070699_100017541 | 3300005518 | Bacteria | 6146 |
| 82 | Ga0070699_100097770 | 3300005518 | Bacteria | 2572 |
| 83 | Ga0070679_100141101 | 3300005530 | Bacteria | 2389 |
| 84 | Ga0070697_100189249 | 3300005536 | Bacteria | 1746 |
| 85 | Ga0070672_100434306 | 3300005543 | Bacteria | 1129 |
| 86 | Ga0070672_101839839 | 3300005543 | Bacteria | 545 |
| 87 | Ga0070695_100059544 | 3300005545 | Bacteria | 2473 |
| 88 | Ga0070695_100102066 | 3300005545 | Bacteria | 1933 |
| 89 | Ga0070696_100088550 | 3300005546 | Bacteria | 2200 |
| 90 | Ga0070696_100222857 | 3300005546 | Bacteria | 1416 |
| 91 | Ga0070696_100342358 | 3300005546 | Bacteria | 1156 |
| 92 | Ga0070696_100360207 | 3300005546 | Bacteria | 1128 |
| 93 | Ga0070696_100613220 | 3300005546 | Bacteria | 878 |
| 94 | Ga0070696_101903533 | 3300005546 | Bacteria | 515 |
| 95 | Ga0070665_100009397 | 3300005548 | Bacteria | 9895 |
| 96 | Ga0070665_100083934 | 3300005548 | Bacteria | 3190 |
| 97 | Ga0070665_100452033 | 3300005548 | Bacteria | 1294 |
| 98 | Ga0070665_101603816 | 3300005548 | Bacteria | 659 |
| 99 | Ga0070704_100129198 | 3300005549 | Bacteria | 1955 |
| 100 | Ga0070704_100479581 | 3300005549 | Bacteria | 1076 |
| 101 | Ga0070704_100835754 | 3300005549 | Bacteria | 825 |
| 102 | Ga0070704_101136050 | 3300005549 | Bacteria | 711 |
| 103 | Ga0068855_100058069 | 3300005563 | Bacteria | 4533 |
| 104 | Ga0068857_100209841 | 3300005577 | Unclassified | 1777 |
| 105 | Ga0068854_100073499 | 3300005578 | Bacteria | 2506 |
| 106 | Ga0070702_100436117 | 3300005615 | Bacteria | 947 |
| 107 | Ga0070702_100562185 | 3300005615 | Bacteria | 849 |
| 108 | Ga0070702_101294085 | 3300005615 | Bacteria | 592 |
| 109 | Ga0070702_101759084 | 3300005615 | Bacteria | 517 |
| 110 | Ga0068852_101437392 | 3300005616 | Bacteria | 712 |
| 111 | Ga0068859_100122921 | 3300005617 | Bacteria | 2663 |
| 112 | Ga0068859_101628296 | 3300005617 | Bacteria | 713 |
| 113 | Ga0068864_101172485 | 3300005618 | Unclassified | 766 |
| 114 | Ga0068864_101617432 | 3300005618 | Unclassified | 652 |
| 115 | Ga0068866_10011132 | 3300005718 | Bacteria | 3880 |
| 116 | Ga0068861_100001358 | 3300005719 | Bacteria | 15388 |
| 117 | Ga0068861_100592126 | 3300005719 | Bacteria | 1016 |
| 118 | Ga0068861_102621968 | 3300005719 | Unclassified | 508 |
| 119 | Ga0068851_10337002 | 3300005834 | Bacteria | 875 |
| 120 | Ga0068870_10074676 | 3300005840 | Bacteria | 1858 |
| 121 | Ga0068870_10488857 | 3300005840 | Bacteria | 818 |
| 122 | Ga0068870_10855702 | 3300005840 | Bacteria | 639 |
| 123 | Ga0068863_100615008 | 3300005841 | Bacteria | 1076 |
| 124 | Ga0068863_102101096 | 3300005841 | Bacteria | 575 |
| 125 | Ga0068858_100636857 | 3300005842 | Bacteria | 1036 |
| 126 | Ga0068858_101727801 | 3300005842 | Bacteria | 618 |
| 127 | Ga0068858_102518932 | 3300005842 | Bacteria | 508 |
| 128 | Ga0068860_100550606 | 3300005843 | Bacteria | 1156 |
| 129 | Ga0068860_101077138 | 3300005843 | Bacteria | 823 |
| 130 | Ga0068860_101318383 | 3300005843 | Bacteria | 743 |
| 131 | Ga0068862_100003042 | 3300005844 | Bacteria | 14608 |
| 132 | Ga0068862_100557848 | 3300005844 | Bacteria | 1094 |
| 133 | Ga0081538_10129875 | 3300005981 | Bacteria | 1187 |
| 134 | Ga0081540_1000883 | 3300005983 | Bacteria | 27092 |
| 135 | Ga0070717_11072783 | 3300006028 | Bacteria | 734 |
| 136 | Ga0070717_11229111 | 3300006028 | Bacteria | 682 |
| 137 | Ga0075365_10005585 | 3300006038 | Bacteria | 6801 |
| 138 | Ga0075365_10583654 | 3300006038 | Bacteria | 790 |
| 139 | Ga0075368_10211734 | 3300006042 | Bacteria | 822 |
| 140 | Ga0075363_100211303 | 3300006048 | Bacteria | 1111 |
| 141 | Ga0075363_100546363 | 3300006048 | Bacteria | 691 |
| 142 | Ga0075432_10223472 | 3300006058 | Bacteria | 754 |
| 143 | Ga0075432_10325190 | 3300006058 | Bacteria | 645 |
| 144 | Ga0070715_10125740 | 3300006163 | Bacteria | 1228 |
| 145 | Ga0070716_101192180 | 3300006173 | Unclassified | 611 |
| 146 | Ga0070712_100574179 | 3300006175 | Unclassified | 952 |
| 147 | Ga0075362_10151578 | 3300006177 | Bacteria | 1112 |
| 148 | Ga0075367_10134948 | 3300006178 | Bacteria | 1527 |
| 149 | Ga0075366_10135469 | 3300006195 | Bacteria | 1487 |
| 150 | Ga0075370_10448050 | 3300006353 | Unclassified | 777 |
| 151 | Ga0075370_10756301 | 3300006353 | Bacteria | 592 |
| 152 | Ga0068871_101183046 | 3300006358 | Bacteria | 717 |
| 153 | Ga0075428_100066543 | 3300006844 | Bacteria | 3945 |
| 154 | Ga0075428_102168622 | 3300006844 | Bacteria | 574 |
| 155 | Ga0075428_102454265 | 3300006844 | Unclassified | 534 |
| 156 | Ga0075430_100002561 | 3300006846 | Bacteria | 15154 |
| 157 | Ga0075430_100063087 | 3300006846 | Bacteria | 3113 |
| 158 | Ga0075430_100067513 | 3300006846 | Bacteria | 3002 |
| 159 | Ga0075430_101778504 | 3300006846 | Unclassified | 505 |
| 160 | Ga0075430_101801605 | 3300006846 | Bacteria | 502 |
| 161 | Ga0075431_100072277 | 3300006847 | Bacteria | 3560 |
| 162 | Ga0075431_100597506 | 3300006847 | Bacteria | 1088 |
| 163 | Ga0075431_100943146 | 3300006847 | Bacteria | 831 |
| 164 | Ga0075431_101001670 | 3300006847 | Bacteria | 802 |
| 165 | Ga0075431_101448038 | 3300006847 | Bacteria | 646 |
| 166 | Ga0075433_10001521 | 3300006852 | Bacteria | 17136 |
| 167 | Ga0075434_100001305 | 3300006871 | Bacteria | 20812 |
| 168 | Ga0075434_101588945 | 3300006871 | Bacteria | 662 |
| 169 | Ga0075429_100009998 | 3300006880 | Bacteria | 8224 |
| 170 | Ga0075429_100549168 | 3300006880 | Bacteria | 1012 |
| 171 | Ga0075429_101194192 | 3300006880 | Unclassified | 664 |
| 172 | Ga0068865_100694774 | 3300006881 | Bacteria | 869 |
| 173 | Ga0068865_101636566 | 3300006881 | Unclassified | 579 |
| 174 | Ga0068865_102017179 | 3300006881 | Bacteria | 524 |
| 175 | Ga0075436_100004325 | 3300006914 | Bacteria | 9747 |
| 176 | Ga0075436_100288247 | 3300006914 | Bacteria | 1175 |
| 177 | Ga0097620_100122912 | 3300006931 | Bacteria | 2663 |
| 178 | Ga0097620_101628519 | 3300006931 | Bacteria | 713 |
| 179 | Ga0075435_100022245 | 3300007076 | Bacteria | 4889 |
| 180 | Ga0099794_10265274 | 3300007265 | Bacteria | 887 |
| 181 | Ga0099795_10000584 | 3300007788 | Bacteria | 6944 |
| 182 | Ga0105240_10018552 | 3300009093 | Bacteria | 9338 |
| 183 | Ga0105240_10453255 | 3300009093 | Bacteria | 1435 |
| 184 | Ga0105240_12079028 | 3300009093 | Bacteria | 590 |
| 185 | Ga0111539_10173839 | 3300009094 | Bacteria | 2516 |
| 186 | Ga0111539_10324651 | 3300009094 | Bacteria | 1791 |
| 187 | Ga0111539_10378186 | 3300009094 | Bacteria | 1649 |
| 188 | Ga0111539_10498854 | 3300009094 | Unclassified | 1418 |
| 189 | Ga0111539_10519283 | 3300009094 | Bacteria | 1387 |
| 190 | Ga0111539_11424578 | 3300009094 | Bacteria | 804 |
| 191 | Ga0111539_12667854 | 3300009094 | Bacteria | 579 |
| 192 | Ga0105245_10550981 | 3300009098 | Bacteria | 1175 |
| 193 | Ga0105245_11590194 | 3300009098 | Bacteria | 705 |
| 194 | Ga0105245_12631305 | 3300009098 | Bacteria | 556 |
| 195 | Ga0105247_11238024 | 3300009101 | Bacteria | 596 |
| 196 | Ga0114129_10005727 | 3300009147 | Bacteria | 17603 |
| 197 | Ga0114129_10518750 | 3300009147 | Bacteria | 1554 |
| 198 | Ga0114129_10934941 | 3300009147 | Bacteria | 1096 |
| 199 | Ga0114129_12445779 | 3300009147 | Bacteria | 625 |
| 200 | Ga0105243_10011238 | 3300009148 | Bacteria | 6773 |
| 201 | Ga0105243_10202946 | 3300009148 | Bacteria | 1740 |
| 202 | Ga0105241_12255230 | 3300009174 | Bacteria | 541 |
| 203 | Ga0105242_10782362 | 3300009176 | Bacteria | 943 |
| 204 | Ga0105242_11272519 | 3300009176 | Bacteria | 758 |
| 205 | Ga0105248_10128976 | 3300009177 | Bacteria | 2853 |
| 206 | Ga0105248_10398623 | 3300009177 | Bacteria | 1549 |
| 207 | Ga0105248_11919889 | 3300009177 | Unclassified | 672 |
| 208 | Ga0105237_10193303 | 3300009545 | Bacteria | 2034 |
| 209 | Ga0105237_10454041 | 3300009545 | Bacteria | 1287 |
| 210 | Ga0105237_11620597 | 3300009545 | Bacteria | 654 |
| 211 | Ga0105238_10629703 | 3300009551 | Bacteria | 1082 |
| 212 | Ga0105249_10105216 | 3300009553 | Bacteria | 2660 |
| 213 | Ga0105249_11872936 | 3300009553 | Unclassified | 672 |
| 214 | Ga0099796_10014201 | 3300010159 | Bacteria | 2295 |
| 215 | Ga0099796_10016453 | 3300010159 | Bacteria | 2184 |
| 216 | Ga0105239_10028369 | 3300010375 | Bacteria | 6157 |
| 217 | Ga0105239_10690798 | 3300010375 | Bacteria | 1166 |
| 218 | Ga0105239_13432763 | 3300010375 | Bacteria | 515 |
| 219 | Ga0157369_10298752 | 3300013105 | Bacteria | 1675 |
| 220 | Ga0157378_11894851 | 3300013297 | Bacteria | 645 |
| 221 | Ga0163162_10270093 | 3300013306 | Bacteria | 1832 |
| 222 | Ga0163162_10753941 | 3300013306 | Bacteria | 1092 |
| 223 | Ga0163162_10852372 | 3300013306 | Bacteria | 1026 |
| 224 | Ga0163162_11178817 | 3300013306 | Bacteria | 869 |
| 225 | Ga0163162_12361661 | 3300013306 | Bacteria | 611 |
| 226 | Ga0157375_10315645 | 3300013308 | Bacteria | 1727 |
| 227 | Ga0157375_10460721 | 3300013308 | Bacteria | 1437 |
| 228 | Ga0157375_11206622 | 3300013308 | Bacteria | 888 |
| 229 | Ga0163163_11091324 | 3300014325 | Bacteria | 861 |
| 230 | Ga0157380_10026934 | 3300014326 | Bacteria | 4368 |
| 231 | Ga0157380_11082628 | 3300014326 | Bacteria | 840 |
| 232 | Ga0157377_10708722 | 3300014745 | Bacteria | 732 |
| 233 | Ga0157377_11429995 | 3300014745 | Unclassified | 547 |
| 234 | Ga0157379_10047671 | 3300014968 | Bacteria | 3823 |
| 235 | Ga0157379_10572108 | 3300014968 | Bacteria | 1053 |
| 236 | Ga0157379_11240400 | 3300014968 | Unclassified | 718 |
| 237 | Ga0157376_10350807 | 3300014969 | Bacteria | 1412 |
| 238 | Ga0157376_11404991 | 3300014969 | Bacteria | 730 |
| 239 | Ga0163161_10043810 | 3300017792 | Bacteria | 3223 |
| 240 | Ga0209758_1000074 | 3300025297 | Bacteria | 275577 |
| 241 | Ga0209758_1059403 | 3300025297 | Bacteria | 1272 |
| 242 | Ga0207426_1059685 | 3300025302 | Bacteria | 1102 |
| 243 | Ga0207697_10249301 | 3300025315 | Bacteria | 785 |
| 244 | Ga0207656_10193017 | 3300025321 | Bacteria | 981 |
| 245 | Ga0207682_10097232 | 3300025893 | Bacteria | 1283 |
| 246 | Ga0207682_10189728 | 3300025893 | Bacteria | 941 |
| 247 | Ga0207682_10313784 | 3300025893 | Bacteria | 736 |
| 248 | Ga0207642_10098190 | 3300025899 | Bacteria | 1464 |
| 249 | Ga0207680_10075371 | 3300025903 | Bacteria | 2104 |
| 250 | Ga0207685_10034499 | 3300025905 | Bacteria | 1839 |
| 251 | Ga0207699_11307376 | 3300025906 | Bacteria | 537 |
| 252 | Ga0207645_10011013 | 3300025907 | Bacteria | 6189 |
| 253 | Ga0207645_10195172 | 3300025907 | Unclassified | 1331 |
| 254 | Ga0207643_10078476 | 3300025908 | Bacteria | 1910 |
| 255 | Ga0207643_10380630 | 3300025908 | Bacteria | 890 |
| 256 | Ga0207705_10060690 | 3300025909 | Bacteria | 2731 |
| 257 | Ga0207684_10653024 | 3300025910 | Bacteria | 896 |
| 258 | Ga0207707_10026379 | 3300025912 | Bacteria | 5078 |
| 259 | Ga0207695_10021125 | 3300025913 | Bacteria | 7435 |
| 260 | Ga0207695_10397809 | 3300025913 | Bacteria | 1262 |
| 261 | Ga0207695_11580092 | 3300025913 | Bacteria | 536 |
| 262 | Ga0207671_10137346 | 3300025914 | Bacteria | 1881 |
| 263 | Ga0207663_10144681 | 3300025916 | Unclassified | 1660 |
| 264 | Ga0207660_10060868 | 3300025917 | Bacteria | 2716 |
| 265 | Ga0207662_10099427 | 3300025918 | Bacteria | 1801 |
| 266 | Ga0207662_10101120 | 3300025918 | Bacteria | 1786 |
| 267 | Ga0207662_10131102 | 3300025918 | Bacteria | 1580 |
| 268 | Ga0207649_10672431 | 3300025920 | Bacteria | 801 |
| 269 | Ga0207652_10128781 | 3300025921 | Bacteria | 2256 |
| 270 | Ga0207652_11076784 | 3300025921 | Unclassified | 704 |
| 271 | Ga0207681_10010837 | 3300025923 | Bacteria | 5600 |
| 272 | Ga0207694_10400159 | 3300025924 | Bacteria | 1142 |
| 273 | Ga0207650_10068257 | 3300025925 | Bacteria | 2669 |
| 274 | Ga0207650_11740453 | 3300025925 | Bacteria | 528 |
| 275 | Ga0207659_10026847 | 3300025926 | Bacteria | 3891 |
| 276 | Ga0207659_10068106 | 3300025926 | Bacteria | 2588 |
| 277 | Ga0207664_10048812 | 3300025929 | Bacteria | 3330 |
| 278 | Ga0207644_10104786 | 3300025931 | Bacteria | 2130 |
| 279 | Ga0207644_10568725 | 3300025931 | Bacteria | 939 |
| 280 | Ga0207690_10460100 | 3300025932 | Bacteria | 1024 |
| 281 | Ga0207706_10225684 | 3300025933 | Bacteria | 1639 |
| 282 | Ga0207706_10426837 | 3300025933 | Bacteria | 1148 |
| 283 | Ga0207686_10089150 | 3300025934 | Bacteria | 2033 |
| 284 | Ga0207686_10349998 | 3300025934 | Bacteria | 1112 |
| 285 | Ga0207709_10011819 | 3300025935 | Bacteria | 4814 |
| 286 | Ga0207709_10134301 | 3300025935 | Bacteria | 1691 |
| 287 | Ga0207670_11267413 | 3300025936 | Bacteria | 625 |
| 288 | Ga0207670_11624516 | 3300025936 | Bacteria | 550 |
| 289 | Ga0207670_11685527 | 3300025936 | Bacteria | 539 |
| 290 | Ga0207669_10123112 | 3300025937 | Bacteria | 1765 |
| 291 | Ga0207669_10197186 | 3300025937 | Bacteria | 1458 |
| 292 | Ga0207669_11006416 | 3300025937 | Bacteria | 700 |
| 293 | Ga0207669_11298435 | 3300025937 | Unclassified | 618 |
| 294 | Ga0207704_10142295 | 3300025938 | Bacteria | 1680 |
| 295 | Ga0207704_10604325 | 3300025938 | Bacteria | 898 |
| 296 | Ga0207704_11320514 | 3300025938 | Unclassified | 617 |
| 297 | Ga0207704_11793166 | 3300025938 | Bacteria | 528 |
| 298 | Ga0207665_10167239 | 3300025939 | Unclassified | 1586 |
| 299 | Ga0207665_10277061 | 3300025939 | Bacteria | 1247 |
| 300 | Ga0207665_11147144 | 3300025939 | Unclassified | 620 |
| 301 | Ga0207691_10149998 | 3300025940 | Bacteria | 2050 |
| 302 | Ga0207691_10237865 | 3300025940 | Bacteria | 1575 |
| 303 | Ga0207691_10399034 | 3300025940 | Bacteria | 1173 |
| 304 | Ga0207691_10490869 | 3300025940 | Bacteria | 1043 |
| 305 | Ga0207711_10259112 | 3300025941 | Bacteria | 1598 |
| 306 | Ga0207711_11141657 | 3300025941 | Bacteria | 720 |
| 307 | Ga0207689_10044224 | 3300025942 | Bacteria | 3681 |
| 308 | Ga0207689_10740281 | 3300025942 | Bacteria | 829 |
| 309 | Ga0207679_11759844 | 3300025945 | Bacteria | 567 |
| 310 | Ga0207667_10045834 | 3300025949 | Bacteria | 4630 |
| 311 | Ga0207651_10188337 | 3300025960 | Bacteria | 1644 |
| 312 | Ga0207651_11213655 | 3300025960 | Bacteria | 677 |
| 313 | Ga0207712_10268361 | 3300025961 | Unclassified | 1387 |
| 314 | Ga0207668_10017408 | 3300025972 | Bacteria | 4503 |
| 315 | Ga0207668_10246172 | 3300025972 | Bacteria | 1449 |
| 316 | Ga0207668_10475885 | 3300025972 | Bacteria | 1070 |
| 317 | Ga0207668_10869781 | 3300025972 | Bacteria | 801 |
| 318 | Ga0207640_10084581 | 3300025981 | Bacteria | 2179 |
| 319 | Ga0207658_10096783 | 3300025986 | Bacteria | 2303 |
| 320 | Ga0207658_10241333 | 3300025986 | Bacteria | 1531 |
| 321 | Ga0207677_10324556 | 3300026023 | Unclassified | 1280 |
| 322 | Ga0207677_11811479 | 3300026023 | Unclassified | 567 |
| 323 | Ga0207703_10895872 | 3300026035 | Bacteria | 849 |
| 324 | Ga0207678_10259942 | 3300026067 | Bacteria | 1488 |
| 325 | Ga0207678_10431628 | 3300026067 | Bacteria | 1143 |
| 326 | Ga0207708_10015956 | 3300026075 | Bacteria | 5640 |
| 327 | Ga0207708_10113037 | 3300026075 | Bacteria | 2110 |
| 328 | Ga0207708_10273928 | 3300026075 | Bacteria | 1366 |
| 329 | Ga0207708_11219826 | 3300026075 | Bacteria | 658 |
| 330 | Ga0207641_10835025 | 3300026088 | Bacteria | 913 |
| 331 | Ga0207648_10001462 | 3300026089 | Bacteria | 25984 |
| 332 | Ga0207648_10002985 | 3300026089 | Bacteria | 17880 |
| 333 | Ga0207648_10108137 | 3300026089 | Bacteria | 2441 |
| 334 | Ga0207648_10291304 | 3300026089 | Bacteria | 1462 |
| 335 | Ga0207648_10339374 | 3300026089 | Bacteria | 1353 |
| 336 | Ga0207676_12136003 | 3300026095 | Unclassified | 558 |
| 337 | Ga0207675_100001475 | 3300026118 | Bacteria | 23622 |
| 338 | Ga0207675_100240718 | 3300026118 | Bacteria | 1748 |
| 339 | Ga0207675_100278196 | 3300026118 | Bacteria | 1625 |
| 340 | Ga0207675_100591668 | 3300026118 | Bacteria | 1112 |
| 341 | Ga0207683_10026920 | 3300026121 | Bacteria | 4968 |
| 342 | Ga0207683_10329268 | 3300026121 | Unclassified | 1400 |
| 343 | Ga0207683_11151746 | 3300026121 | Bacteria | 719 |
| 344 | Ga0207698_10244145 | 3300026142 | Bacteria | 1639 |
| 345 | Ga0207698_10312885 | 3300026142 | Bacteria | 1467 |
| 346 | Ga0207698_12422609 | 3300026142 | Bacteria | 536 |
| 347 | Ga0209969_1018846 | 3300027360 | Bacteria | 1021 |
| 348 | Ga0209981_1033831 | 3300027378 | Unclassified | 754 |
| 349 | Ga0209981_1048638 | 3300027378 | Unclassified | 640 |
| 350 | Ga0209996_1024381 | 3300027395 | Unclassified | 862 |
| 351 | Ga0209984_1050273 | 3300027424 | Bacteria | 609 |
| 352 | Ga0210000_1060171 | 3300027462 | Bacteria | 615 |
| 353 | Ga0209995_1000904 | 3300027471 | Bacteria | 4604 |
| 354 | Ga0209968_1018379 | 3300027526 | Bacteria | 1119 |
| 355 | Ga0209999_1001577 | 3300027543 | Bacteria | 3922 |
| 356 | Ga0209999_1050335 | 3300027543 | Unclassified | 786 |
| 357 | Ga0209970_1017346 | 3300027614 | Bacteria | 1205 |
| 358 | Ga0209970_1061785 | 3300027614 | Unclassified | 688 |
| 359 | Ga0209983_1011704 | 3300027665 | Bacteria | 1796 |
| 360 | Ga0209971_1009679 | 3300027682 | Bacteria | 2283 |
| 361 | Ga0209971_1025164 | 3300027682 | Bacteria | 1422 |
| 362 | Ga0209971_1193430 | 3300027682 | Unclassified | 501 |
| 363 | Ga0209813_10100811 | 3300027866 | Bacteria | 982 |
| 364 | Ga0209974_10003351 | 3300027876 | Bacteria | 5787 |
| 365 | Ga0209974_10153898 | 3300027876 | Unclassified | 831 |
| 366 | Ga0209974_10250489 | 3300027876 | Bacteria | 666 |
| 367 | Ga0207428_10087450 | 3300027907 | Bacteria | 2424 |
| 368 | Ga0207428_10320466 | 3300027907 | Bacteria | 1145 |
| 369 | Ga0207428_11049042 | 3300027907 | Bacteria | 571 |
| 370 | Ga0207428_11176903 | 3300027907 | Bacteria | 534 |
| 371 | Ga0265357_1001280 | 3300028023 | Bacteria | 1804 |
| 372 | Ga0268266_10004786 | 3300028379 | Bacteria | 12859 |
| 373 | Ga0268266_10029056 | 3300028379 | Bacteria | 4699 |
| 374 | Ga0268266_10363748 | 3300028379 | Bacteria | 1362 |
| 375 | Ga0268266_11166981 | 3300028379 | Unclassified | 745 |
| 376 | Ga0268265_10004164 | 3300028380 | Bacteria | 10135 |
| 377 | Ga0268265_10181017 | 3300028380 | Bacteria | 1811 |
| 378 | Ga0268265_10271889 | 3300028380 | Bacteria | 1512 |
| 379 | Ga0268264_10244950 | 3300028381 | Bacteria | 1662 |
| 380 | Ga0265334_10002880 | 3300028573 | Bacteria | 7892 |
| 381 | Ga0265322_10206210 | 3300028654 | Bacteria | 563 |
| 382 | Ga0265338_10052453 | 3300028800 | Bacteria | 3658 |
| 383 | Ga0265338_10257015 | 3300028800 | Unclassified | 1286 |
| 384 | Ga0265320_10069871 | 3300031240 | Bacteria | 1657 |
| 385 | Ga0265320_10126853 | 3300031240 | Bacteria | 1160 |
| 386 | Ga0265325_10065772 | 3300031241 | Bacteria | 1830 |
| 387 | Ga0265339_10027544 | 3300031249 | Bacteria | 3243 |
| 388 | Ga0307408_102385831 | 3300031548 | Bacteria | 513 |
| 389 | Ga0265313_10030461 | 3300031595 | Bacteria | 2778 |
| 390 | Ga0265313_10034299 | 3300031595 | Bacteria | 2568 |
| 391 | Ga0307405_11277335 | 3300031731 | Bacteria | 638 |
| 392 | Ga0307405_11346035 | 3300031731 | Bacteria | 623 |
| 393 | Ga0307410_12025921 | 3300031852 | Unclassified | 514 |
| 394 | Ga0307406_10388025 | 3300031901 | Bacteria | 1103 |
| 395 | Ga0307412_10384001 | 3300031911 | Bacteria | 1138 |
| 396 | Ga0307409_100448831 | 3300031995 | Bacteria | 1244 |
| 397 | Ga0307416_101407697 | 3300032002 | Bacteria | 803 |
| 398 | Ga0307416_103018253 | 3300032002 | Bacteria | 563 |
| 399 | Ga0307414_10555685 | 3300032004 | Bacteria | 1024 |
| 400 | Ga0307411_10132689 | 3300032005 | Bacteria | 1823 |
| 401 | Ga0307411_11315769 | 3300032005 | Unclassified | 659 |
| 402 | Ga0307510_10249853 | 3300033180 | Unclassified | 1262 |
| 403 | Ga0373930_0102276 | 3300034816 | Bacteria | 682 |
| 404 | Ga0373950_0046128 | 3300034818 | Bacteria | 846 |
| 405 | Ga0373958_0096614 | 3300034819 | Bacteria | 688 |
| 406 | Ga0373926_0028063 | 3300035083 | Bacteria | 1975 |
| 407 | Ga0373926_0263483 | 3300035083 | Bacteria | 669 |
| 408 | Ga0373934_0112667 | 3300035086 | Bacteria | 1104 |
| 409 | Ga0373940_0315390 | 3300035088 | Bacteria | 541 |
| 410 | Ga0373932_0120925 | 3300035112 | Bacteria | 873 |
| 411 | Ga0373932_0390867 | 3300035112 | Bacteria | 536 |
| 412 | Ga0373945_0192524 | 3300035116 | Unclassified | 844 |
| 413 | Ga0373945_0349944 | 3300035116 | Bacteria | 641 |
| 414 | Ga0373956_0080206 | 3300035119 | Bacteria | 1497 |
| 415 | Ga0373957_0561347 | 3300035120 | Unclassified | 500 |
| 416 | Ga0373946_0028836 | 3300035171 | Bacteria | 2204 |
| 417 | Ga0373946_0628728 | 3300035171 | Bacteria | 558 |
| 418 | Ga0373955_0038176 | 3300035172 | Bacteria | 2558 |
| 419 | Ga0373955_0185026 | 3300035172 | Bacteria | 1237 |
| 420 | Ga0373955_0270877 | 3300035172 | Bacteria | 1020 |
| 421 | Ga0373931_0002612 | 3300035691 | Bacteria | 8014 |
| 422 | Ga0373935_0304146 | 3300035692 | Bacteria | 1128 |
| 423 | Ga0373935_0927876 | 3300035692 | Bacteria | 645 |
| 424 | Ga0373927_0201101 | 3300035695 | Bacteria | 1308 |
| 425 | Ga0373927_0421065 | 3300035695 | Bacteria | 881 |
| 426 | Ga0373933_0404199 | 3300035724 | Bacteria | 891 |
| 427 | Ga0373933_0417977 | 3300035724 | Unclassified | 876 |
| 428 | Ga0373947_0139592 | 3300035725 | Bacteria | 1553 |
| 429 | Ga0373947_0272514 | 3300035725 | Bacteria | 1124 |
| 430 | Ga0373947_0407283 | 3300035725 | Bacteria | 918 |
| 431 | Ga0373947_0846487 | 3300035725 | Bacteria | 624 |
| 432 | Ga0373937_0019421 | 3300036401 | Bacteria | 6083 |
| 433 | Ga0373937_0208163 | 3300036401 | Bacteria | 1840 |
| 434 | Ga0373937_0316570 | 3300036401 | Bacteria | 1476 |
| 435 | Ga0373925_0020491 | 3300037068 | Bacteria | 4814 |
| 436 | Ga0373925_0207970 | 3300037068 | Bacteria | 1558 |
| 437 | Ga0373925_1416279 | 3300037068 | Unclassified | 569 |
| 438 | Ga0436365_0514370 | 3300039437 | Bacteria | 546 |
| 439 | Ga0436363_1416401 | 3300039450 | Unclassified | 1967 |
| 440 | Ga0436363_1611588 | 3300039450 | Bacteria | 813 |
| 441 | Ga0439436_0111736 | 3300041404 | Bacteria | 763 |
| 442 | Ga0439436_0173384 | 3300041404 | Unclassified | 612 |
| 443 | Ga0451853_0745474 | 3300041512 | Bacteria | 517 |
| 444 | Ga0439441_034380 | 3300042001 | Bacteria | 995 |
| 445 | Ga0439441_114393 | 3300042001 | Unclassified | 614 |
| 446 | Ga0439456_016347 | 3300042013 | Bacteria | 1552 |
| 447 | Ga0439462_0231460 | 3300042015 | Bacteria | 529 |
| 448 | Ga0439446_0048257 | 3300042156 | Bacteria | 1267 |
| 449 | Ga0439446_0102642 | 3300042156 | Unclassified | 906 |
| 450 | Ga0439458_0231599 | 3300042157 | Bacteria | 511 |
| 451 | Ga0439434_0150154 | 3300042435 | Unclassified | 771 |
| 452 | Ga0439435_0001802 | 3300042436 | Bacteria | 4086 |
| 453 | Ga0439435_0003371 | 3300042436 | Bacteria | 3317 |
| 454 | Ga0439460_0011547 | 3300042461 | Bacteria | 2279 |
| 455 | Ga0451577_1275894 | 3300042876 | Unclassified | 654 |
| 456 | Ga0466970_0554623 | 3300044765 | Bacteria | 664 |
| 457 | Ga0466960_0998384 | 3300044901 | Unclassified | 514 |
| 458 | Ga0466959_0632330 | 3300045049 | Unclassified | 719 |
| 459 | Ga0451576_0130939 | 3300045051 | Bacteria | 2615 |
| 460 | Ga0495592_0212786 | 3300046454 | Bacteria | 1297 |
| 461 | Ga0495651_0526571 | 3300046462 | Bacteria | 754 |
| 462 | Ga0495664_0315388 | 3300046477 | Bacteria | 943 |
| 463 | Ga0495584_0435476 | 3300046491 | Bacteria | 667 |
| 464 | Ga0495584_0561565 | 3300046491 | Bacteria | 582 |
| 465 | Ga0495606_0114983 | 3300046507 | Unclassified | 1618 |
| 466 | Ga0495620_0117633 | 3300046515 | Bacteria | 1050 |
| 467 | Ga0495628_0180049 | 3300046516 | Bacteria | 1599 |
| 468 | Ga0495644_0154555 | 3300046523 | Bacteria | 879 |
| 469 | Ga0495642_0226442 | 3300046528 | Bacteria | 817 |
| 470 | Ga0495652_0702548 | 3300046529 | Bacteria | 680 |
| 471 | Ga0495640_0187672 | 3300046533 | Bacteria | 1315 |
| 472 | Ga0495656_0672921 | 3300046615 | Bacteria | 556 |
| 473 | Ga0495634_0677340 | 3300046642 | Bacteria | 594 |
| 474 | Ga0495599_0531934 | 3300046678 | Unclassified | 690 |
| 475 | Ga0495599_0811585 | 3300046678 | Bacteria | 534 |
| 476 | Ga0495646_0053643 | 3300046680 | Bacteria | 2430 |
| 477 | Ga0495647_0295472 | 3300046681 | Unclassified | 729 |
| 478 | Ga0495669_0237677 | 3300046684 | Bacteria | 874 |
| 479 | Ga0495669_0443997 | 3300046684 | Bacteria | 630 |
| 480 | Ga0495613_0370523 | 3300046689 | Bacteria | 981 |
| 481 | Ga0495671_0274347 | 3300046692 | Bacteria | 813 |
| 482 | Ga0495649_0306544 | 3300046694 | Bacteria | 808 |
| 483 | Ga0495604_0076963 | 3300047317 | Bacteria | 2509 |
| 484 | Ga0495674_0136111 | 3300047319 | Bacteria | 2067 |
| 485 | Ga0495675_0293101 | 3300047444 | Bacteria | 968 |
| 486 | Ga0495686_0700547 | 3300047472 | Bacteria | 517 |
| 487 | Ga0495602_0254267 | 3300048088 | Bacteria | 1307 |
| 488 | Ga0496100_0003275 | 3300048903 | Bacteria | 8416 |
| 489 | Ga0496100_0512477 | 3300048903 | Unclassified | 925 |
| 490 | Ga0496104_0108167 | 3300048907 | Unclassified | 2664 |
| 491 | Ga0496104_0276361 | 3300048907 | Bacteria | 1592 |
| 492 | Ga0496105_0023306 | 3300048908 | Bacteria | 5018 |
| 493 | Ga0496105_0307858 | 3300048908 | Bacteria | 1272 |
| 494 | Ga0496106_1269567 | 3300048909 | Bacteria | 572 |
| 495 | Ga0496107_0065291 | 3300048910 | Bacteria | 2638 |
| 496 | Ga0496107_0282922 | 3300048910 | Unclassified | 1234 |
| 497 | Ga0496108_0195181 | 3300048911 | Bacteria | 1755 |
| 498 | Ga0496111_0101576 | 3300048914 | Bacteria | 2113 |
| 499 | Ga0496112_0121484 | 3300048915 | Bacteria | 2582 |
| 500 | Ga0496112_0170056 | 3300048915 | Bacteria | 2145 |
| 501 | Ga0496114_0036965 | 3300048917 | Unclassified | 4037 |
| 502 | Ga0496114_0072416 | 3300048917 | Bacteria | 2898 |
| 503 | Ga0496114_0805501 | 3300048917 | Bacteria | 818 |
| 504 | Ga0496115_0007210 | 3300048918 | Bacteria | 8168 |
| 505 | Ga0496115_0055854 | 3300048918 | Bacteria | 3172 |
| 506 | Ga0496125_0193172 | 3300048928 | Bacteria | 1342 |
| 507 | Ga0496126_0002340 | 3300048929 | Bacteria | 25952 |
| 508 | Ga0496126_0732282 | 3300048929 | Unclassified | 765 |
| 509 | Ga0496126_1033051 | 3300048929 | Bacteria | 615 |
| 510 | Ga0501031_0421370 | 3300049568 | Bacteria | 863 |
| 511 | Ga0501031_0690061 | 3300049568 | Bacteria | 656 |
| 512 | Ga0501033_0210297 | 3300049570 | Bacteria | 1387 |
| 513 | Ga0501036_0432108 | 3300049572 | Bacteria | 1098 |
| 514 | Ga0501037_0570711 | 3300049573 | Bacteria | 762 |
| 515 | Ga0501038_0082989 | 3300049574 | Bacteria | 2698 |
| 516 | Ga0501038_0927366 | 3300049574 | Bacteria | 642 |
| 517 | Ga0501039_0663385 | 3300049575 | Bacteria | 816 |
| 518 | Ga0501040_0023359 | 3300049576 | Bacteria | 4146 |
| 519 | Ga0501040_0082537 | 3300049576 | Bacteria | 2228 |
| 520 | Ga0501040_0737416 | 3300049576 | Bacteria | 713 |
| 521 | Ga0501040_0850548 | 3300049576 | Unclassified | 660 |
| 522 | Ga0501041_0029174 | 3300049577 | Bacteria | 3328 |
| 523 | Ga0501041_0033160 | 3300049577 | Bacteria | 3123 |
| 524 | Ga0501041_0078476 | 3300049577 | Bacteria | 2032 |
| 525 | Ga0501042_0021872 | 3300049578 | Bacteria | 4463 |
| 526 | Ga0501042_0049425 | 3300049578 | Bacteria | 3000 |
| 527 | Ga0501042_0329666 | 3300049578 | Bacteria | 1103 |
| 528 | Ga0501042_1081471 | 3300049578 | Bacteria | 585 |
| 529 | Ga0501043_0874152 | 3300049579 | Bacteria | 646 |
| 530 | Ga0501046_0204857 | 3300049580 | Bacteria | 1467 |
| 531 | Ga0501046_0466767 | 3300049580 | Bacteria | 907 |
| 532 | Ga0501048_0072325 | 3300049582 | Bacteria | 2434 |
| 533 | Ga0501048_0147095 | 3300049582 | Bacteria | 1666 |
| 534 | Ga0501048_0347122 | 3300049582 | Bacteria | 1058 |
| 535 | Ga0501069_0025011 | 3300049585 | Bacteria | 3261 |
| 536 | Ga0501070_0466955 | 3300049586 | Bacteria | 1016 |
| 537 | Ga0501071_0025464 | 3300049587 | Bacteria | 4145 |
| 538 | Ga0501071_0470003 | 3300049587 | Bacteria | 963 |
| 539 | Ga0501071_0511017 | 3300049587 | Bacteria | 922 |
| 540 | Ga0501071_1586460 | 3300049587 | Unclassified | 505 |
| 541 | Ga0501072_0005763 | 3300049588 | Bacteria | 9432 |
| 542 | Ga0501072_0166260 | 3300049588 | Bacteria | 1760 |
| 543 | Ga0501072_0411107 | 3300049588 | Bacteria | 1073 |
| 544 | Ga0501072_0636200 | 3300049588 | Bacteria | 840 |
| 545 | Ga0501072_1480176 | 3300049588 | Bacteria | 524 |
| 546 | Ga0501073_0177174 | 3300049589 | Bacteria | 1476 |
| 547 | Ga0501074_0110619 | 3300049590 | Bacteria | 1966 |
| 548 | Ga0501074_0185786 | 3300049590 | Bacteria | 1482 |
| 549 | Ga0501074_1132363 | 3300049590 | Bacteria | 549 |
| 550 | Ga0501075_0003753 | 3300049591 | Bacteria | 10205 |
| 551 | Ga0501075_0512467 | 3300049591 | Bacteria | 915 |
| 552 | Ga0501076_0001091 | 3300049592 | Bacteria | 17844 |
| 553 | Ga0501076_0414015 | 3300049592 | Bacteria | 1109 |
| 554 | Ga0501076_0499990 | 3300049592 | Bacteria | 1002 |
| 555 | Ga0501076_0788933 | 3300049592 | Bacteria | 784 |
| 556 | Ga0501077_0040472 | 3300049593 | Bacteria | 2969 |
| 557 | Ga0501077_0372546 | 3300049593 | Bacteria | 912 |
| 558 | Ga0501079_0011674 | 3300049741 | Bacteria | 6711 |
| 559 | Ga0501080_1074185 | 3300049742 | Archaea | 696 |
| 560 | Ga0501081_0006843 | 3300049743 | Bacteria | 7414 |
| 561 | Ga0501081_0660066 | 3300049743 | Bacteria | 784 |
| 562 | Ga0501081_1258973 | 3300049743 | Bacteria | 561 |
| 563 | Ga0501083_0123211 | 3300049744 | Bacteria | 1700 |
| 564 | Ga0501035_0249388 | 3300049822 | Bacteria | 1508 |
| 565 | Ga0501035_0375746 | 3300049822 | Bacteria | 1186 |
| 566 | Ga0501045_0007341 | 3300049824 | Bacteria | 7664 |
| 567 | Ga0501045_0558252 | 3300049824 | Bacteria | 849 |
| 568 | nmdc:mga03n38_149604_c1 | 3300050490 | Bacteria | 1173 |
| 569 | nmdc:mga0yw44_1924_c1 | 3300050492 | Bacteria | 8583 |
| 570 | nmdc:mga0yw44_84473_c1 | 3300050492 | Bacteria | 1996 |
| 571 | nmdc:mga0k408_35870_c1 | 3300050493 | Bacteria | 1645 |
| 572 | nmdc:mga0k408_659226_c1 | 3300050493 | Bacteria | 615 |
| 573 | nmdc:mga06z11_182705_c1 | 3300050494 | Bacteria | 1210 |
| 574 | nmdc:mga06z11_506526_c1 | 3300050494 | Bacteria | 731 |
| 575 | nmdc:mga06z11_776454_c1 | 3300050494 | Unclassified | 584 |
| 576 | nmdc:mga04h51_172925_c1 | 3300050495 | Bacteria | 837 |
| 577 | nmdc:mga07m45_556158_c1 | 3300050496 | Unclassified | 663 |
| 578 | nmdc:mga05p37_318473_c1 | 3300050507 | Bacteria | 1842 |
| 579 | nmdc:mga09592_1056472_c1 | 3300050508 | Unclassified | 677 |
| 580 | nmdc:mga09592_18107_c1 | 3300050508 | Bacteria | 5776 |
| 581 | nmdc:mga09592_831534_c1 | 3300050508 | Bacteria | 780 |
| 582 | nmdc:mga09592_919371_c1 | 3300050508 | Bacteria | 735 |
| 583 | nmdc:mga09592_979138_c1 | 3300050508 | Unclassified | 708 |
| 584 | nmdc:mga0qj67_1566764_c1 | 3300050509 | Bacteria | 506 |
| 585 | nmdc:mga0qj67_30276_c1 | 3300050509 | Bacteria | 4211 |
| 586 | nmdc:mga0qj67_630801_c1 | 3300050509 | Bacteria | 856 |
| 587 | nmdc:mga0qj67_653699_c1 | 3300050509 | Bacteria | 839 |
| 588 | nmdc:mga0qj67_725446_c1 | 3300050509 | Unclassified | 790 |
| 589 | nmdc:mga06r32_106764_c1 | 3300050510 | Bacteria | 2751 |
| 590 | nmdc:mga06r32_1150486_c1 | 3300050510 | Unclassified | 724 |
| 591 | nmdc:mga06r32_1889735_c1 | 3300050510 | Bacteria | 532 |
| 592 | nmdc:mga06r32_96527_c1 | 3300050510 | Bacteria | 2895 |
| 593 | nmdc:mga08y16_208263_c1 | 3300050511 | Bacteria | 2025 |
| 594 | nmdc:mga08y16_270673_c1 | 3300050511 | Bacteria | 1754 |
| 595 | nmdc:mga08y16_33511_c1 | 3300050511 | Bacteria | 5394 |
| 596 | nmdc:mga08y16_429976_c1 | 3300050511 | Bacteria | 1348 |
| 597 | nmdc:mga0n895_160009_c1 | 3300050512 | Bacteria | 2283 |
| 598 | nmdc:mga0n895_1838237_c1 | 3300050512 | Bacteria | 566 |
| 599 | nmdc:mga0n895_4031_c1 | 3300050512 | Bacteria | 11953 |
| 600 | nmdc:mga0rr50_8806_c1 | 3300050513 | Bacteria | 6297 |
| 601 | nmdc:mga08x19_1704_c1 | 3300050514 | Bacteria | 13531 |
| 602 | nmdc:mga08x19_20400_c1 | 3300050514 | Bacteria | 4080 |
| 603 | nmdc:mga08x19_769303_c1 | 3300050514 | Bacteria | 684 |
| 604 | nmdc:mga0a205_173_c1 | 3300050515 | Bacteria | 11499 |
| 605 | Ga0495601_0078981 | 3300053077 | Bacteria | 2109 |
| 606 | Ga0495612_0117070 | 3300053078 | Bacteria | 1144 |
| 607 | Ga0495619_0277421 | 3300053085 | Bacteria | 1161 |
| 608 | Ga0500556_0169826 | 3300053104 | Bacteria | 862 |
| 609 | Ga0500642_0022849 | 3300053130 | Bacteria | 2502 |
| 610 | Ga0500568_0083696 | 3300053139 | Bacteria | 1209 |
| 611 | Ga0500588_0143199 | 3300053146 | Unclassified | 860 |
| 612 | Ga0500588_0261081 | 3300053146 | Bacteria | 652 |
| 613 | Ga0500616_0007590 | 3300053153 | Bacteria | 6857 |
| 614 | Ga0500616_0057208 | 3300053153 | Bacteria | 2032 |
| 615 | Ga0501084_0085086 | 3300054114 | Bacteria | 2655 |
| 616 | Ga0501084_0894195 | 3300054114 | Bacteria | 747 |
| 617 | Ga0501084_1381017 | 3300054114 | Bacteria | 590 |
| 618 | Ga0590071_012909 | 3300059421 | Bacteria | 1957 |
| 619 | Ga0590075_023523 | 3300059424 | Bacteria | 1545 |
| 620 | Ga0501082_0003995 | 3300060353 | Bacteria | 12872 |
| 621 | Ga0501082_0311786 | 3300060353 | Bacteria | 1370 |
| 622 | Ga0501082_1419964 | 3300060353 | Bacteria | 606 |
| 623 | Ga0530510_0002851 | 3300061734 | Bacteria | 11883 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014745 | Ga0157377_11429995 | Ga0157377_114299951 | 81 |
| 2 | 3300026023 | Ga0207677_11811479 | Ga0207677_118114791 | 89 |
| 3 | 3300039450 | Ga0436363_1611588 | Ga0436363_1611588_95_388 | 89 |
| 4 | 3300045049 | Ga0466959_0632330 | Ga0466959_0632330_435_704 | 89 |
| 5 | 3300025981 | Ga0207640_10084581 | Ga0207640_100845812 | 91 |
| 6 | 3300002244 | JGI24742J22300_10068105 | JGI24742J22300_100681052 | 96 |
| 7 | 3300003323 | rootH1_10037109 | rootH1_100371095 | 96 |
| 8 | 3300003323 | rootH1_10221863 | rootH1_102218632 | 96 |
| 9 | 3300005328 | Ga0070676_10450801 | Ga0070676_104508011 | 96 |
| 10 | 3300005331 | Ga0070670_100086582 | Ga0070670_1000865825 | 96 |
| 11 | 3300005333 | Ga0070677_10217563 | Ga0070677_102175632 | 96 |
| 12 | 3300005334 | Ga0068869_100226418 | Ga0068869_1002264181 | 96 |
| 13 | 3300005334 | Ga0068869_101311364 | Ga0068869_1013113642 | 96 |
| 14 | 3300005335 | Ga0070666_10048909 | Ga0070666_100489096 | 96 |
| 15 | 3300005336 | Ga0070680_100054066 | Ga0070680_1000540663 | 96 |
| 16 | 3300005338 | Ga0068868_100914845 | Ga0068868_1009148452 | 96 |
| 17 | 3300005343 | Ga0070687_100055332 | Ga0070687_1000553321 | 96 |
| 18 | 3300005345 | Ga0070692_10014768 | Ga0070692_100147683 | 96 |
| 19 | 3300005347 | Ga0070668_100015073 | Ga0070668_1000150735 | 96 |
| 20 | 3300005347 | Ga0070668_100023324 | Ga0070668_1000233243 | 96 |
| 21 | 3300005353 | Ga0070669_100001513 | Ga0070669_10000151310 | 96 |
| 22 | 3300005354 | Ga0070675_100023953 | Ga0070675_1000239536 | 96 |
| 23 | 3300005355 | Ga0070671_100422036 | Ga0070671_1004220361 | 96 |
| 24 | 3300005356 | Ga0070674_100934199 | Ga0070674_1009341992 | 96 |
| 25 | 3300005364 | Ga0070673_100051114 | Ga0070673_1000511144 | 96 |
| 26 | 3300005364 | Ga0070673_101879356 | Ga0070673_1018793561 | 96 |
| 27 | 3300005364 | Ga0070673_102075607 | Ga0070673_1020756071 | 96 |
| 28 | 3300005367 | Ga0070667_100117970 | Ga0070667_1001179702 | 96 |
| 29 | 3300005367 | Ga0070667_101514344 | Ga0070667_1015143441 | 96 |
| 30 | 3300005367 | Ga0070667_101579826 | Ga0070667_1015798262 | 96 |
| 31 | 3300005441 | Ga0070700_100041008 | Ga0070700_1000410085 | 96 |
| 32 | 3300005441 | Ga0070700_100512018 | Ga0070700_1005120182 | 96 |
| 33 | 3300005444 | Ga0070694_101064416 | Ga0070694_1010644162 | 96 |
| 34 | 3300005444 | Ga0070694_101125809 | Ga0070694_1011258092 | 96 |
| 35 | 3300005444 | Ga0070694_101566094 | Ga0070694_1015660942 | 96 |
| 36 | 3300005445 | Ga0070708_100904442 | Ga0070708_1009044422 | 96 |
| 37 | 3300005455 | Ga0070663_101826592 | Ga0070663_1018265922 | 96 |
| 38 | 3300005456 | Ga0070678_100302376 | Ga0070678_1003023762 | 96 |
| 39 | 3300005457 | Ga0070662_101112748 | Ga0070662_1011127481 | 96 |
| 40 | 3300005458 | Ga0070681_10020205 | Ga0070681_100202054 | 96 |
| 41 | 3300005458 | Ga0070681_10070711 | Ga0070681_100707112 | 96 |
| 42 | 3300005458 | Ga0070681_10540625 | Ga0070681_105406252 | 96 |
| 43 | 3300005459 | Ga0068867_100000729 | Ga0068867_1000007294 | 96 |
| 44 | 3300005459 | Ga0068867_100085715 | Ga0068867_1000857155 | 96 |
| 45 | 3300005530 | Ga0070679_100141101 | Ga0070679_1001411014 | 96 |
| 46 | 3300005543 | Ga0070672_100434306 | Ga0070672_1004343063 | 96 |
| 47 | 3300005543 | Ga0070672_101839839 | Ga0070672_1018398392 | 96 |
| 48 | 3300005548 | Ga0070665_100009397 | Ga0070665_1000093972 | 96 |
| 49 | 3300005548 | Ga0070665_100083934 | Ga0070665_1000839345 | 96 |
| 50 | 3300005548 | Ga0070665_100452033 | Ga0070665_1004520332 | 96 |
| 51 | 3300005549 | Ga0070704_100129198 | Ga0070704_1001291982 | 96 |
| 52 | 3300005577 | Ga0068857_100209841 | Ga0068857_1002098412 | 96 |
| 53 | 3300005578 | Ga0068854_100073499 | Ga0068854_1000734991 | 96 |
| 54 | 3300005615 | Ga0070702_100436117 | Ga0070702_1004361172 | 96 |
| 55 | 3300005615 | Ga0070702_100562185 | Ga0070702_1005621852 | 96 |
| 56 | 3300005616 | Ga0068852_101437392 | Ga0068852_1014373922 | 96 |
| 57 | 3300005617 | Ga0068859_100122921 | Ga0068859_1001229215 | 96 |
| 58 | 3300005617 | Ga0068859_101628296 | Ga0068859_1016282961 | 96 |
| 59 | 3300005618 | Ga0068864_101172485 | Ga0068864_1011724851 | 96 |
| 60 | 3300005718 | Ga0068866_10011132 | Ga0068866_100111323 | 96 |
| 61 | 3300005719 | Ga0068861_100001358 | Ga0068861_1000013584 | 96 |
| 62 | 3300005719 | Ga0068861_100592126 | Ga0068861_1005921262 | 96 |
| 63 | 3300005719 | Ga0068861_102621968 | Ga0068861_1026219681 | 96 |
| 64 | 3300005834 | Ga0068851_10337002 | Ga0068851_103370022 | 96 |
| 65 | 3300005840 | Ga0068870_10074676 | Ga0068870_100746762 | 96 |
| 66 | 3300005840 | Ga0068870_10488857 | Ga0068870_104888572 | 96 |
| 67 | 3300005840 | Ga0068870_10855702 | Ga0068870_108557022 | 96 |
| 68 | 3300005841 | Ga0068863_102101096 | Ga0068863_1021010961 | 96 |
| 69 | 3300005842 | Ga0068858_102518932 | Ga0068858_1025189321 | 96 |
| 70 | 3300005843 | Ga0068860_100550606 | Ga0068860_1005506062 | 96 |
| 71 | 3300005844 | Ga0068862_100003042 | Ga0068862_10000304210 | 96 |
| 72 | 3300006173 | Ga0070716_101192180 | Ga0070716_1011921802 | 96 |
| 73 | 3300006844 | Ga0075428_102168622 | Ga0075428_1021686222 | 96 |
| 74 | 3300006846 | Ga0075430_100002561 | Ga0075430_10000256115 | 96 |
| 75 | 3300006847 | Ga0075431_100072277 | Ga0075431_1000722777 | 96 |
| 76 | 3300006847 | Ga0075431_100597506 | Ga0075431_1005975062 | 96 |
| 77 | 3300006871 | Ga0075434_101588945 | Ga0075434_1015889452 | 96 |
| 78 | 3300006880 | Ga0075429_101194192 | Ga0075429_1011941921 | 96 |
| 79 | 3300006881 | Ga0068865_101636566 | Ga0068865_1016365662 | 96 |
| 80 | 3300006881 | Ga0068865_102017179 | Ga0068865_1020171792 | 96 |
| 81 | 3300006931 | Ga0097620_100122912 | Ga0097620_1001229125 | 96 |
| 82 | 3300006931 | Ga0097620_101628519 | Ga0097620_1016285191 | 96 |
| 83 | 3300007265 | Ga0099794_10265274 | Ga0099794_102652741 | 96 |
| 84 | 3300007788 | Ga0099795_10000584 | Ga0099795_100005848 | 96 |
| 85 | 3300009093 | Ga0105240_10453255 | Ga0105240_104532552 | 96 |
| 86 | 3300009093 | Ga0105240_12079028 | Ga0105240_120790281 | 96 |
| 87 | 3300009094 | Ga0111539_10324651 | Ga0111539_103246512 | 96 |
| 88 | 3300009094 | Ga0111539_10498854 | Ga0111539_104988543 | 96 |
| 89 | 3300009101 | Ga0105247_11238024 | Ga0105247_112380241 | 96 |
| 90 | 3300009148 | Ga0105243_10011238 | Ga0105243_1001123810 | 96 |
| 91 | 3300009174 | Ga0105241_12255230 | Ga0105241_122552301 | 96 |
| 92 | 3300009545 | Ga0105237_10193303 | Ga0105237_101933034 | 96 |
| 93 | 3300009545 | Ga0105237_10454041 | Ga0105237_104540412 | 96 |
| 94 | 3300009551 | Ga0105238_10629703 | Ga0105238_106297032 | 96 |
| 95 | 3300009553 | Ga0105249_10105216 | Ga0105249_101052166 | 96 |
| 96 | 3300010159 | Ga0099796_10014201 | Ga0099796_100142014 | 96 |
| 97 | 3300010159 | Ga0099796_10016453 | Ga0099796_100164533 | 96 |
| 98 | 3300010375 | Ga0105239_10028369 | Ga0105239_100283694 | 96 |
| 99 | 3300013306 | Ga0163162_10753941 | Ga0163162_107539412 | 96 |
| 100 | 3300013306 | Ga0163162_10852372 | Ga0163162_108523722 | 96 |
| 101 | 3300013308 | Ga0157375_10315645 | Ga0157375_103156452 | 96 |
| 102 | 3300013308 | Ga0157375_10460721 | Ga0157375_104607211 | 96 |
| 103 | 3300014325 | Ga0163163_11091324 | Ga0163163_110913242 | 96 |
| 104 | 3300014326 | Ga0157380_11082628 | Ga0157380_110826281 | 96 |
| 105 | 3300014745 | Ga0157377_10708722 | Ga0157377_107087222 | 96 |
| 106 | 3300014968 | Ga0157379_10572108 | Ga0157379_105721083 | 96 |
| 107 | 3300014968 | Ga0157379_11240400 | Ga0157379_112404002 | 96 |
| 108 | 3300025315 | Ga0207697_10249301 | Ga0207697_102493011 | 96 |
| 109 | 3300025321 | Ga0207656_10193017 | Ga0207656_101930172 | 96 |
| 110 | 3300025893 | Ga0207682_10189728 | Ga0207682_101897281 | 96 |
| 111 | 3300025893 | Ga0207682_10313784 | Ga0207682_103137842 | 96 |
| 112 | 3300025903 | Ga0207680_10075371 | Ga0207680_100753713 | 96 |
| 113 | 3300025907 | Ga0207645_10195172 | Ga0207645_101951722 | 96 |
| 114 | 3300025908 | Ga0207643_10078476 | Ga0207643_100784763 | 96 |
| 115 | 3300025908 | Ga0207643_10380630 | Ga0207643_103806302 | 96 |
| 116 | 3300025912 | Ga0207707_10026379 | Ga0207707_100263794 | 96 |
| 117 | 3300025913 | Ga0207695_10397809 | Ga0207695_103978091 | 96 |
| 118 | 3300025913 | Ga0207695_11580092 | Ga0207695_115800921 | 96 |
| 119 | 3300025914 | Ga0207671_10137346 | Ga0207671_101373462 | 96 |
| 120 | 3300025917 | Ga0207660_10060868 | Ga0207660_100608682 | 96 |
| 121 | 3300025918 | Ga0207662_10099427 | Ga0207662_100994272 | 96 |
| 122 | 3300025920 | Ga0207649_10672431 | Ga0207649_106724311 | 96 |
| 123 | 3300025921 | Ga0207652_10128781 | Ga0207652_101287813 | 96 |
| 124 | 3300025923 | Ga0207681_10010837 | Ga0207681_1001083710 | 96 |
| 125 | 3300025924 | Ga0207694_10400159 | Ga0207694_104001592 | 96 |
| 126 | 3300025925 | Ga0207650_10068257 | Ga0207650_100682572 | 96 |
| 127 | 3300025925 | Ga0207650_11740453 | Ga0207650_117404531 | 96 |
| 128 | 3300025926 | Ga0207659_10068106 | Ga0207659_100681065 | 96 |
| 129 | 3300025933 | Ga0207706_10225684 | Ga0207706_102256842 | 96 |
| 130 | 3300025933 | Ga0207706_10426837 | Ga0207706_104268371 | 96 |
| 131 | 3300025935 | Ga0207709_10011819 | Ga0207709_100118195 | 96 |
| 132 | 3300025936 | Ga0207670_11624516 | Ga0207670_116245162 | 96 |
| 133 | 3300025937 | Ga0207669_10197186 | Ga0207669_101971861 | 96 |
| 134 | 3300025938 | Ga0207704_10604325 | Ga0207704_106043252 | 96 |
| 135 | 3300025938 | Ga0207704_11320514 | Ga0207704_113205141 | 96 |
| 136 | 3300025938 | Ga0207704_11793166 | Ga0207704_117931661 | 96 |
| 137 | 3300025939 | Ga0207665_11147144 | Ga0207665_111471442 | 96 |
| 138 | 3300025940 | Ga0207691_10149998 | Ga0207691_101499982 | 96 |
| 139 | 3300025940 | Ga0207691_10237865 | Ga0207691_102378651 | 96 |
| 140 | 3300025940 | Ga0207691_10490869 | Ga0207691_104908692 | 96 |
| 141 | 3300025945 | Ga0207679_11759844 | Ga0207679_117598442 | 96 |
| 142 | 3300025960 | Ga0207651_10188337 | Ga0207651_101883373 | 96 |
| 143 | 3300025961 | Ga0207712_10268361 | Ga0207712_102683611 | 96 |
| 144 | 3300025972 | Ga0207668_10017408 | Ga0207668_100174086 | 96 |
| 145 | 3300025972 | Ga0207668_10246172 | Ga0207668_102461722 | 96 |
| 146 | 3300025972 | Ga0207668_10475885 | Ga0207668_104758851 | 96 |
| 147 | 3300025986 | Ga0207658_10096783 | Ga0207658_100967834 | 96 |
| 148 | 3300025986 | Ga0207658_10241333 | Ga0207658_102413331 | 96 |
| 149 | 3300026023 | Ga0207677_10324556 | Ga0207677_103245563 | 96 |
| 150 | 3300026067 | Ga0207678_10431628 | Ga0207678_104316281 | 96 |
| 151 | 3300026075 | Ga0207708_10015956 | Ga0207708_100159563 | 96 |
| 152 | 3300026075 | Ga0207708_10273928 | Ga0207708_102739282 | 96 |
| 153 | 3300026089 | Ga0207648_10001462 | Ga0207648_1000146216 | 96 |
| 154 | 3300026089 | Ga0207648_10108137 | Ga0207648_101081375 | 96 |
| 155 | 3300026089 | Ga0207648_10339374 | Ga0207648_103393743 | 96 |
| 156 | 3300026095 | Ga0207676_12136003 | Ga0207676_121360032 | 96 |
| 157 | 3300026118 | Ga0207675_100001475 | Ga0207675_10000147522 | 96 |
| 158 | 3300026118 | Ga0207675_100278196 | Ga0207675_1002781964 | 96 |
| 159 | 3300026118 | Ga0207675_100591668 | Ga0207675_1005916682 | 96 |
| 160 | 3300026121 | Ga0207683_11151746 | Ga0207683_111517462 | 96 |
| 161 | 3300026142 | Ga0207698_10244145 | Ga0207698_102441452 | 96 |
| 162 | 3300026142 | Ga0207698_10312885 | Ga0207698_103128852 | 96 |
| 163 | 3300026142 | Ga0207698_12422609 | Ga0207698_124226092 | 96 |
| 164 | 3300027462 | Ga0210000_1060171 | Ga0210000_10601712 | 96 |
| 165 | 3300027907 | Ga0207428_10320466 | Ga0207428_103204661 | 96 |
| 166 | 3300028023 | Ga0265357_1001280 | Ga0265357_10012802 | 96 |
| 167 | 3300028379 | Ga0268266_10004786 | Ga0268266_1000478610 | 96 |
| 168 | 3300028379 | Ga0268266_10029056 | Ga0268266_100290561 | 96 |
| 169 | 3300028379 | Ga0268266_11166981 | Ga0268266_111669811 | 96 |
| 170 | 3300028380 | Ga0268265_10004164 | Ga0268265_100041646 | 96 |
| 171 | 3300028380 | Ga0268265_10181017 | Ga0268265_101810171 | 96 |
| 172 | 3300028573 | Ga0265334_10002880 | Ga0265334_100028808 | 96 |
| 173 | 3300028654 | Ga0265322_10206210 | Ga0265322_102062102 | 96 |
| 174 | 3300028800 | Ga0265338_10052453 | Ga0265338_100524535 | 96 |
| 175 | 3300028800 | Ga0265338_10257015 | Ga0265338_102570152 | 96 |
| 176 | 3300031240 | Ga0265320_10069871 | Ga0265320_100698712 | 96 |
| 177 | 3300031240 | Ga0265320_10126853 | Ga0265320_101268532 | 96 |
| 178 | 3300031249 | Ga0265339_10027544 | Ga0265339_100275444 | 96 |
| 179 | 3300031595 | Ga0265313_10030461 | Ga0265313_100304613 | 96 |
| 180 | 3300031852 | Ga0307410_12025921 | Ga0307410_120259211 | 96 |
| 181 | 3300031901 | Ga0307406_10388025 | Ga0307406_103880252 | 96 |
| 182 | 3300035083 | Ga0373926_0028063 | Ga0373926_0028063_397_687 | 96 |
| 183 | 3300035086 | Ga0373934_0112667 | Ga0373934_0112667_224_514 | 96 |
| 184 | 3300035116 | Ga0373945_0192524 | Ga0373945_0192524_128_418 | 96 |
| 185 | 3300035119 | Ga0373956_0080206 | Ga0373956_0080206_200_490 | 96 |
| 186 | 3300035172 | Ga0373955_0185026 | Ga0373955_0185026_111_401 | 96 |
| 187 | 3300035172 | Ga0373955_0270877 | Ga0373955_0270877_384_674 | 96 |
| 188 | 3300035692 | Ga0373935_0927876 | Ga0373935_0927876_205_495 | 96 |
| 189 | 3300035724 | Ga0373933_0404199 | Ga0373933_0404199_84_374 | 96 |
| 190 | 3300035725 | Ga0373947_0139592 | Ga0373947_0139592_124_414 | 96 |
| 191 | 3300036401 | Ga0373937_0019421 | Ga0373937_0019421_3218_3508 | 96 |
| 192 | 3300036401 | Ga0373937_0316570 | Ga0373937_0316570_90_380 | 96 |
| 193 | 3300037068 | Ga0373925_0207970 | Ga0373925_0207970_1128_1418 | 96 |
| 194 | 3300039437 | Ga0436365_0514370 | Ga0436365_0514370_209_499 | 96 |
| 195 | 3300041512 | Ga0451853_0745474 | Ga0451853_0745474_161_451 | 96 |
| 196 | 3300042876 | Ga0451577_1275894 | Ga0451577_1275894_222_518 | 96 |
| 197 | 3300044765 | Ga0466970_0554623 | Ga0466970_0554623_244_534 | 96 |
| 198 | 3300044901 | Ga0466960_0998384 | Ga0466960_0998384_98_388 | 96 |
| 199 | 3300046462 | Ga0495651_0526571 | Ga0495651_0526571_27_317 | 96 |
| 200 | 3300046491 | Ga0495584_0435476 | Ga0495584_0435476_32_322 | 96 |
| 201 | 3300046507 | Ga0495606_0114983 | Ga0495606_0114983_26_316 | 96 |
| 202 | 3300046684 | Ga0495669_0237677 | Ga0495669_0237677_435_725 | 96 |
| 203 | 3300048928 | Ga0496125_0193172 | Ga0496125_0193172_372_662 | 96 |
| 204 | 3300048929 | Ga0496126_0002340 | Ga0496126_0002340_3915_4205 | 96 |
| 205 | 3300048929 | Ga0496126_0732282 | Ga0496126_0732282_155_445 | 96 |
| 206 | 3300048929 | Ga0496126_1033051 | Ga0496126_1033051_181_471 | 96 |
| 207 | 3300049570 | Ga0501033_0210297 | Ga0501033_0210297_743_1033 | 96 |
| 208 | 3300049572 | Ga0501036_0432108 | Ga0501036_0432108_700_990 | 96 |
| 209 | 3300049574 | Ga0501038_0082989 | Ga0501038_0082989_357_647 | 96 |
| 210 | 3300049576 | Ga0501040_0023359 | Ga0501040_0023359_2002_2292 | 96 |
| 211 | 3300049576 | Ga0501040_0082537 | Ga0501040_0082537_919_1209 | 96 |
| 212 | 3300049577 | Ga0501041_0029174 | Ga0501041_0029174_2889_3179 | 96 |
| 213 | 3300049577 | Ga0501041_0033160 | Ga0501041_0033160_958_1248 | 96 |
| 214 | 3300049578 | Ga0501042_0021872 | Ga0501042_0021872_3389_3679 | 96 |
| 215 | 3300049578 | Ga0501042_0049425 | Ga0501042_0049425_45_335 | 96 |
| 216 | 3300049578 | Ga0501042_1081471 | Ga0501042_1081471_273_563 | 96 |
| 217 | 3300049580 | Ga0501046_0466767 | Ga0501046_0466767_32_322 | 96 |
| 218 | 3300049582 | Ga0501048_0072325 | Ga0501048_0072325_492_782 | 96 |
| 219 | 3300049582 | Ga0501048_0147095 | Ga0501048_0147095_371_661 | 96 |
| 220 | 3300049585 | Ga0501069_0025011 | Ga0501069_0025011_2120_2410 | 96 |
| 221 | 3300049586 | Ga0501070_0466955 | Ga0501070_0466955_230_520 | 96 |
| 222 | 3300049587 | Ga0501071_0025464 | Ga0501071_0025464_1743_2033 | 96 |
| 223 | 3300049588 | Ga0501072_0005763 | Ga0501072_0005763_3424_3714 | 96 |
| 224 | 3300049588 | Ga0501072_0636200 | Ga0501072_0636200_51_341 | 96 |
| 225 | 3300049589 | Ga0501073_0177174 | Ga0501073_0177174_260_550 | 96 |
| 226 | 3300049590 | Ga0501074_0110619 | Ga0501074_0110619_1427_1717 | 96 |
| 227 | 3300049590 | Ga0501074_0185786 | Ga0501074_0185786_985_1275 | 96 |
| 228 | 3300049591 | Ga0501075_0003753 | Ga0501075_0003753_7899_8189 | 96 |
| 229 | 3300049592 | Ga0501076_0001091 | Ga0501076_0001091_12180_12470 | 96 |
| 230 | 3300049593 | Ga0501077_0040472 | Ga0501077_0040472_2151_2441 | 96 |
| 231 | 3300049741 | Ga0501079_0011674 | Ga0501079_0011674_3205_3495 | 96 |
| 232 | 3300049742 | Ga0501080_1074185 | Ga0501080_1074185_352_642 | 96 |
| 233 | 3300049743 | Ga0501081_0006843 | Ga0501081_0006843_4685_4975 | 96 |
| 234 | 3300049743 | Ga0501081_1258973 | Ga0501081_1258973_215_505 | 96 |
| 235 | 3300049744 | Ga0501083_0123211 | Ga0501083_0123211_625_915 | 96 |
| 236 | 3300049822 | Ga0501035_0249388 | Ga0501035_0249388_412_702 | 96 |
| 237 | 3300049824 | Ga0501045_0007341 | Ga0501045_0007341_5024_5314 | 96 |
| 238 | 3300050508 | nmdc:mga09592_1056472_c1 | nmdc:mga09592_1056472_c1_78_368 | 96 |
| 239 | 3300050510 | nmdc:mga06r32_106764_c1 | nmdc:mga06r32_106764_c1_983_1273 | 96 |
| 240 | 3300050511 | nmdc:mga08y16_270673_c1 | nmdc:mga08y16_270673_c1_780_1070 | 96 |
| 241 | 3300050512 | nmdc:mga0n895_160009_c1 | nmdc:mga0n895_160009_c1_1672_1962 | 96 |
| 242 | 3300050512 | nmdc:mga0n895_1838237_c1 | nmdc:mga0n895_1838237_c1_66_356 | 96 |
| 243 | 3300053146 | Ga0500588_0143199 | Ga0500588_0143199_132_422 | 96 |
| 244 | 3300053153 | Ga0500616_0007590 | Ga0500616_0007590_4294_4584 | 96 |
| 245 | 3300054114 | Ga0501084_0085086 | Ga0501084_0085086_577_867 | 96 |
| 246 | 3300054114 | Ga0501084_0894195 | Ga0501084_0894195_42_332 | 96 |
| 247 | 3300060353 | Ga0501082_0003995 | Ga0501082_0003995_10853_11143 | 96 |
| 248 | 3300061734 | Ga0530510_0002851 | Ga0530510_0002851_2970_3260 | 96 |
| 249 | 3300002070 | JGI24750J21931_1071966 | JGI24750J21931_10719661 | 97 |
| 250 | 3300003215 | JGI25153J46596_10000650 | JGI25153J46596_1000065017 | 97 |
| 251 | 3300003215 | JGI25153J46596_10138998 | JGI25153J46596_101389981 | 97 |
| 252 | 3300003322 | rootL2_10030195 | rootL2_100301954 | 97 |
| 253 | 3300005293 | Ga0065715_10979403 | Ga0065715_109794031 | 97 |
| 254 | 3300005328 | Ga0070676_10058415 | Ga0070676_100584152 | 97 |
| 255 | 3300005334 | Ga0068869_100030710 | Ga0068869_1000307102 | 97 |
| 256 | 3300005334 | Ga0068869_100265826 | Ga0068869_1002658262 | 97 |
| 257 | 3300005340 | Ga0070689_100781394 | Ga0070689_1007813942 | 97 |
| 258 | 3300005340 | Ga0070689_101194229 | Ga0070689_1011942291 | 97 |
| 259 | 3300005343 | Ga0070687_100943973 | Ga0070687_1009439732 | 97 |
| 260 | 3300005345 | Ga0070692_10393159 | Ga0070692_103931592 | 97 |
| 261 | 3300005345 | Ga0070692_11007017 | Ga0070692_110070171 | 97 |
| 262 | 3300005353 | Ga0070669_100576354 | Ga0070669_1005763542 | 97 |
| 263 | 3300005353 | Ga0070669_101372647 | Ga0070669_1013726472 | 97 |
| 264 | 3300005354 | Ga0070675_100073810 | Ga0070675_1000738102 | 97 |
| 265 | 3300005356 | Ga0070674_100027958 | Ga0070674_1000279583 | 97 |
| 266 | 3300005356 | Ga0070674_100560701 | Ga0070674_1005607012 | 97 |
| 267 | 3300005356 | Ga0070674_100670116 | Ga0070674_1006701162 | 97 |
| 268 | 3300005364 | Ga0070673_101129652 | Ga0070673_1011296522 | 97 |
| 269 | 3300005364 | Ga0070673_101534127 | Ga0070673_1015341271 | 97 |
| 270 | 3300005365 | Ga0070688_100091243 | Ga0070688_1000912433 | 97 |
| 271 | 3300005366 | Ga0070659_101442986 | Ga0070659_1014429861 | 97 |
| 272 | 3300005367 | Ga0070667_101086173 | Ga0070667_1010861732 | 97 |
| 273 | 3300005437 | Ga0070710_10751865 | Ga0070710_107518652 | 97 |
| 274 | 3300005438 | Ga0070701_10117592 | Ga0070701_101175922 | 97 |
| 275 | 3300005439 | Ga0070711_100218166 | Ga0070711_1002181662 | 97 |
| 276 | 3300005439 | Ga0070711_101288261 | Ga0070711_1012882612 | 97 |
| 277 | 3300005440 | Ga0070705_100363085 | Ga0070705_1003630852 | 97 |
| 278 | 3300005440 | Ga0070705_100438709 | Ga0070705_1004387092 | 97 |
| 279 | 3300005440 | Ga0070705_101477116 | Ga0070705_1014771162 | 97 |
| 280 | 3300005441 | Ga0070700_100271855 | Ga0070700_1002718552 | 97 |
| 281 | 3300005441 | Ga0070700_101103784 | Ga0070700_1011037842 | 97 |
| 282 | 3300005444 | Ga0070694_100127943 | Ga0070694_1001279432 | 97 |
| 283 | 3300005444 | Ga0070694_101686978 | Ga0070694_1016869781 | 97 |
| 284 | 3300005445 | Ga0070708_101668294 | Ga0070708_1016682941 | 97 |
| 285 | 3300005456 | Ga0070678_100392908 | Ga0070678_1003929082 | 97 |
| 286 | 3300005456 | Ga0070678_100556655 | Ga0070678_1005566551 | 97 |
| 287 | 3300005456 | Ga0070678_101649091 | Ga0070678_1016490911 | 97 |
| 288 | 3300005459 | Ga0068867_100012294 | Ga0068867_1000122949 | 97 |
| 289 | 3300005467 | Ga0070706_100177584 | Ga0070706_1001775843 | 97 |
| 290 | 3300005518 | Ga0070699_100017541 | Ga0070699_1000175415 | 97 |
| 291 | 3300005518 | Ga0070699_100097770 | Ga0070699_1000977703 | 97 |
| 292 | 3300005536 | Ga0070697_100189249 | Ga0070697_1001892491 | 97 |
| 293 | 3300005545 | Ga0070695_100059544 | Ga0070695_1000595443 | 97 |
| 294 | 3300005545 | Ga0070695_100102066 | Ga0070695_1001020662 | 97 |
| 295 | 3300005546 | Ga0070696_100088550 | Ga0070696_1000885504 | 97 |
| 296 | 3300005546 | Ga0070696_100222857 | Ga0070696_1002228572 | 97 |
| 297 | 3300005546 | Ga0070696_100342358 | Ga0070696_1003423582 | 97 |
| 298 | 3300005546 | Ga0070696_100360207 | Ga0070696_1003602072 | 97 |
| 299 | 3300005546 | Ga0070696_100613220 | Ga0070696_1006132202 | 97 |
| 300 | 3300005546 | Ga0070696_101903533 | Ga0070696_1019035331 | 97 |
| 301 | 3300005548 | Ga0070665_101603816 | Ga0070665_1016038162 | 97 |
| 302 | 3300005549 | Ga0070704_100479581 | Ga0070704_1004795812 | 97 |
| 303 | 3300005549 | Ga0070704_100835754 | Ga0070704_1008357542 | 97 |
| 304 | 3300005549 | Ga0070704_101136050 | Ga0070704_1011360502 | 97 |
| 305 | 3300005563 | Ga0068855_100058069 | Ga0068855_1000580699 | 97 |
| 306 | 3300005615 | Ga0070702_101294085 | Ga0070702_1012940851 | 97 |
| 307 | 3300005615 | Ga0070702_101759084 | Ga0070702_1017590841 | 97 |
| 308 | 3300005618 | Ga0068864_101617432 | Ga0068864_1016174322 | 97 |
| 309 | 3300005841 | Ga0068863_100615008 | Ga0068863_1006150082 | 97 |
| 310 | 3300005842 | Ga0068858_100636857 | Ga0068858_1006368572 | 97 |
| 311 | 3300005842 | Ga0068858_101727801 | Ga0068858_1017278012 | 97 |
| 312 | 3300005843 | Ga0068860_101077138 | Ga0068860_1010771383 | 97 |
| 313 | 3300005843 | Ga0068860_101318383 | Ga0068860_1013183832 | 97 |
| 314 | 3300005844 | Ga0068862_100557848 | Ga0068862_1005578482 | 97 |
| 315 | 3300005981 | Ga0081538_10129875 | Ga0081538_101298752 | 97 |
| 316 | 3300005983 | Ga0081540_1000883 | Ga0081540_100088324 | 97 |
| 317 | 3300006028 | Ga0070717_11072783 | Ga0070717_110727832 | 97 |
| 318 | 3300006028 | Ga0070717_11229111 | Ga0070717_112291112 | 97 |
| 319 | 3300006038 | Ga0075365_10005585 | Ga0075365_100055856 | 97 |
| 320 | 3300006038 | Ga0075365_10583654 | Ga0075365_105836542 | 97 |
| 321 | 3300006042 | Ga0075368_10211734 | Ga0075368_102117342 | 97 |
| 322 | 3300006048 | Ga0075363_100211303 | Ga0075363_1002113032 | 97 |
| 323 | 3300006048 | Ga0075363_100546363 | Ga0075363_1005463631 | 97 |
| 324 | 3300006058 | Ga0075432_10223472 | Ga0075432_102234722 | 97 |
| 325 | 3300006058 | Ga0075432_10325190 | Ga0075432_103251902 | 97 |
| 326 | 3300006163 | Ga0070715_10125740 | Ga0070715_101257402 | 97 |
| 327 | 3300006175 | Ga0070712_100574179 | Ga0070712_1005741793 | 97 |
| 328 | 3300006177 | Ga0075362_10151578 | Ga0075362_101515781 | 97 |
| 329 | 3300006178 | Ga0075367_10134948 | Ga0075367_101349482 | 97 |
| 330 | 3300006195 | Ga0075366_10135469 | Ga0075366_101354693 | 97 |
| 331 | 3300006353 | Ga0075370_10448050 | Ga0075370_104480501 | 97 |
| 332 | 3300006353 | Ga0075370_10756301 | Ga0075370_107563012 | 97 |
| 333 | 3300006358 | Ga0068871_101183046 | Ga0068871_1011830462 | 97 |
| 334 | 3300006844 | Ga0075428_100066543 | Ga0075428_1000665435 | 97 |
| 335 | 3300006844 | Ga0075428_102454265 | Ga0075428_1024542652 | 97 |
| 336 | 3300006846 | Ga0075430_100063087 | Ga0075430_1000630873 | 97 |
| 337 | 3300006846 | Ga0075430_100067513 | Ga0075430_1000675132 | 97 |
| 338 | 3300006846 | Ga0075430_101778504 | Ga0075430_1017785042 | 97 |
| 339 | 3300006846 | Ga0075430_101801605 | Ga0075430_1018016052 | 97 |
| 340 | 3300006847 | Ga0075431_100943146 | Ga0075431_1009431462 | 97 |
| 341 | 3300006847 | Ga0075431_101001670 | Ga0075431_1010016702 | 97 |
| 342 | 3300006847 | Ga0075431_101448038 | Ga0075431_1014480381 | 97 |
| 343 | 3300006852 | Ga0075433_10001521 | Ga0075433_100015213 | 97 |
| 344 | 3300006871 | Ga0075434_100001305 | Ga0075434_1000013059 | 97 |
| 345 | 3300006880 | Ga0075429_100009998 | Ga0075429_1000099982 | 97 |
| 346 | 3300006880 | Ga0075429_100549168 | Ga0075429_1005491682 | 97 |
| 347 | 3300006881 | Ga0068865_100694774 | Ga0068865_1006947742 | 97 |
| 348 | 3300006914 | Ga0075436_100004325 | Ga0075436_10000432511 | 97 |
| 349 | 3300006914 | Ga0075436_100288247 | Ga0075436_1002882472 | 97 |
| 350 | 3300007076 | Ga0075435_100022245 | Ga0075435_1000222453 | 97 |
| 351 | 3300009093 | Ga0105240_10018552 | Ga0105240_1001855217 | 97 |
| 352 | 3300009094 | Ga0111539_10173839 | Ga0111539_101738393 | 97 |
| 353 | 3300009094 | Ga0111539_10378186 | Ga0111539_103781862 | 97 |
| 354 | 3300009094 | Ga0111539_10519283 | Ga0111539_105192832 | 97 |
| 355 | 3300009094 | Ga0111539_11424578 | Ga0111539_114245782 | 97 |
| 356 | 3300009094 | Ga0111539_12667854 | Ga0111539_126678542 | 97 |
| 357 | 3300009098 | Ga0105245_10550981 | Ga0105245_105509812 | 97 |
| 358 | 3300009098 | Ga0105245_11590194 | Ga0105245_115901942 | 97 |
| 359 | 3300009098 | Ga0105245_12631305 | Ga0105245_126313051 | 97 |
| 360 | 3300009147 | Ga0114129_10005727 | Ga0114129_100057278 | 97 |
| 361 | 3300009147 | Ga0114129_10518750 | Ga0114129_105187502 | 97 |
| 362 | 3300009147 | Ga0114129_10934941 | Ga0114129_109349412 | 97 |
| 363 | 3300009147 | Ga0114129_12445779 | Ga0114129_124457792 | 97 |
| 364 | 3300009148 | Ga0105243_10202946 | Ga0105243_102029462 | 97 |
| 365 | 3300009176 | Ga0105242_10782362 | Ga0105242_107823622 | 97 |
| 366 | 3300009176 | Ga0105242_11272519 | Ga0105242_112725192 | 97 |
| 367 | 3300009177 | Ga0105248_10128976 | Ga0105248_101289762 | 97 |
| 368 | 3300009177 | Ga0105248_10398623 | Ga0105248_103986233 | 97 |
| 369 | 3300009177 | Ga0105248_11919889 | Ga0105248_119198892 | 97 |
| 370 | 3300009545 | Ga0105237_11620597 | Ga0105237_116205972 | 97 |
| 371 | 3300009553 | Ga0105249_11872936 | Ga0105249_118729362 | 97 |
| 372 | 3300010375 | Ga0105239_10690798 | Ga0105239_106907981 | 97 |
| 373 | 3300010375 | Ga0105239_13432763 | Ga0105239_134327632 | 97 |
| 374 | 3300013105 | Ga0157369_10298752 | Ga0157369_102987521 | 97 |
| 375 | 3300013297 | Ga0157378_11894851 | Ga0157378_118948511 | 97 |
| 376 | 3300013306 | Ga0163162_10270093 | Ga0163162_102700934 | 97 |
| 377 | 3300013306 | Ga0163162_11178817 | Ga0163162_111788172 | 97 |
| 378 | 3300013306 | Ga0163162_12361661 | Ga0163162_123616611 | 97 |
| 379 | 3300013308 | Ga0157375_11206622 | Ga0157375_112066222 | 97 |
| 380 | 3300014326 | Ga0157380_10026934 | Ga0157380_100269345 | 97 |
| 381 | 3300014968 | Ga0157379_10047671 | Ga0157379_100476714 | 97 |
| 382 | 3300014969 | Ga0157376_10350807 | Ga0157376_103508073 | 97 |
| 383 | 3300014969 | Ga0157376_11404991 | Ga0157376_114049912 | 97 |
| 384 | 3300017792 | Ga0163161_10043810 | Ga0163161_100438102 | 97 |
| 385 | 3300025297 | Ga0209758_1000074 | Ga0209758_1000074177 | 97 |
| 386 | 3300025297 | Ga0209758_1059403 | Ga0209758_10594033 | 97 |
| 387 | 3300025302 | Ga0207426_1059685 | Ga0207426_10596853 | 97 |
| 388 | 3300025893 | Ga0207682_10097232 | Ga0207682_100972322 | 97 |
| 389 | 3300025899 | Ga0207642_10098190 | Ga0207642_100981902 | 97 |
| 390 | 3300025905 | Ga0207685_10034499 | Ga0207685_100344995 | 97 |
| 391 | 3300025906 | Ga0207699_11307376 | Ga0207699_113073761 | 97 |
| 392 | 3300025907 | Ga0207645_10011013 | Ga0207645_1001101311 | 97 |
| 393 | 3300025909 | Ga0207705_10060690 | Ga0207705_100606903 | 97 |
| 394 | 3300025910 | Ga0207684_10653024 | Ga0207684_106530242 | 97 |
| 395 | 3300025913 | Ga0207695_10021125 | Ga0207695_100211251 | 97 |
| 396 | 3300025916 | Ga0207663_10144681 | Ga0207663_101446813 | 97 |
| 397 | 3300025918 | Ga0207662_10101120 | Ga0207662_101011202 | 97 |
| 398 | 3300025918 | Ga0207662_10131102 | Ga0207662_101311021 | 97 |
| 399 | 3300025921 | Ga0207652_11076784 | Ga0207652_110767842 | 97 |
| 400 | 3300025926 | Ga0207659_10026847 | Ga0207659_100268472 | 97 |
| 401 | 3300025929 | Ga0207664_10048812 | Ga0207664_100488123 | 97 |
| 402 | 3300025931 | Ga0207644_10104786 | Ga0207644_101047864 | 97 |
| 403 | 3300025931 | Ga0207644_10568725 | Ga0207644_105687252 | 97 |
| 404 | 3300025932 | Ga0207690_10460100 | Ga0207690_104601002 | 97 |
| 405 | 3300025934 | Ga0207686_10089150 | Ga0207686_100891502 | 97 |
| 406 | 3300025934 | Ga0207686_10349998 | Ga0207686_103499981 | 97 |
| 407 | 3300025935 | Ga0207709_10134301 | Ga0207709_101343012 | 97 |
| 408 | 3300025936 | Ga0207670_11267413 | Ga0207670_112674132 | 97 |
| 409 | 3300025936 | Ga0207670_11685527 | Ga0207670_116855271 | 97 |
| 410 | 3300025937 | Ga0207669_10123112 | Ga0207669_101231122 | 97 |
| 411 | 3300025937 | Ga0207669_11006416 | Ga0207669_110064162 | 97 |
| 412 | 3300025937 | Ga0207669_11298435 | Ga0207669_112984352 | 97 |
| 413 | 3300025938 | Ga0207704_10142295 | Ga0207704_101422952 | 97 |
| 414 | 3300025939 | Ga0207665_10167239 | Ga0207665_101672392 | 97 |
| 415 | 3300025939 | Ga0207665_10277061 | Ga0207665_102770613 | 97 |
| 416 | 3300025940 | Ga0207691_10399034 | Ga0207691_103990342 | 97 |
| 417 | 3300025941 | Ga0207711_10259112 | Ga0207711_102591122 | 97 |
| 418 | 3300025941 | Ga0207711_11141657 | Ga0207711_111416572 | 97 |
| 419 | 3300025942 | Ga0207689_10044224 | Ga0207689_100442242 | 97 |
| 420 | 3300025942 | Ga0207689_10740281 | Ga0207689_107402811 | 97 |
| 421 | 3300025949 | Ga0207667_10045834 | Ga0207667_100458342 | 97 |
| 422 | 3300025960 | Ga0207651_11213655 | Ga0207651_112136552 | 97 |
| 423 | 3300025972 | Ga0207668_10869781 | Ga0207668_108697812 | 97 |
| 424 | 3300026035 | Ga0207703_10895872 | Ga0207703_108958722 | 97 |
| 425 | 3300026067 | Ga0207678_10259942 | Ga0207678_102599422 | 97 |
| 426 | 3300026075 | Ga0207708_10113037 | Ga0207708_101130374 | 97 |
| 427 | 3300026075 | Ga0207708_11219826 | Ga0207708_112198262 | 97 |
| 428 | 3300026088 | Ga0207641_10835025 | Ga0207641_108350251 | 97 |
| 429 | 3300026089 | Ga0207648_10002985 | Ga0207648_1000298511 | 97 |
| 430 | 3300026089 | Ga0207648_10291304 | Ga0207648_102913041 | 97 |
| 431 | 3300026118 | Ga0207675_100240718 | Ga0207675_1002407182 | 97 |
| 432 | 3300026121 | Ga0207683_10026920 | Ga0207683_100269202 | 97 |
| 433 | 3300026121 | Ga0207683_10329268 | Ga0207683_103292682 | 97 |
| 434 | 3300027360 | Ga0209969_1018846 | Ga0209969_10188462 | 97 |
| 435 | 3300027378 | Ga0209981_1033831 | Ga0209981_10338312 | 97 |
| 436 | 3300027378 | Ga0209981_1048638 | Ga0209981_10486382 | 97 |
| 437 | 3300027395 | Ga0209996_1024381 | Ga0209996_10243812 | 97 |
| 438 | 3300027424 | Ga0209984_1050273 | Ga0209984_10502732 | 97 |
| 439 | 3300027471 | Ga0209995_1000904 | Ga0209995_10009044 | 97 |
| 440 | 3300027526 | Ga0209968_1018379 | Ga0209968_10183791 | 97 |
| 441 | 3300027543 | Ga0209999_1001577 | Ga0209999_10015773 | 97 |
| 442 | 3300027543 | Ga0209999_1050335 | Ga0209999_10503352 | 97 |
| 443 | 3300027614 | Ga0209970_1017346 | Ga0209970_10173462 | 97 |
| 444 | 3300027614 | Ga0209970_1061785 | Ga0209970_10617851 | 97 |
| 445 | 3300027665 | Ga0209983_1011704 | Ga0209983_10117042 | 97 |
| 446 | 3300027682 | Ga0209971_1009679 | Ga0209971_10096793 | 97 |
| 447 | 3300027682 | Ga0209971_1025164 | Ga0209971_10251642 | 97 |
| 448 | 3300027682 | Ga0209971_1193430 | Ga0209971_11934302 | 97 |
| 449 | 3300027866 | Ga0209813_10100811 | Ga0209813_101008112 | 97 |
| 450 | 3300027876 | Ga0209974_10003351 | Ga0209974_100033513 | 97 |
| 451 | 3300027876 | Ga0209974_10153898 | Ga0209974_101538982 | 97 |
| 452 | 3300027876 | Ga0209974_10250489 | Ga0209974_102504891 | 97 |
| 453 | 3300027907 | Ga0207428_10087450 | Ga0207428_100874503 | 97 |
| 454 | 3300027907 | Ga0207428_11049042 | Ga0207428_110490422 | 97 |
| 455 | 3300027907 | Ga0207428_11176903 | Ga0207428_111769032 | 97 |
| 456 | 3300028379 | Ga0268266_10363748 | Ga0268266_103637482 | 97 |
| 457 | 3300028380 | Ga0268265_10271889 | Ga0268265_102718892 | 97 |
| 458 | 3300028381 | Ga0268264_10244950 | Ga0268264_102449503 | 97 |
| 459 | 3300031241 | Ga0265325_10065772 | Ga0265325_100657722 | 97 |
| 460 | 3300031548 | Ga0307408_102385831 | Ga0307408_1023858311 | 97 |
| 461 | 3300031595 | Ga0265313_10034299 | Ga0265313_100342992 | 97 |
| 462 | 3300031731 | Ga0307405_11277335 | Ga0307405_112773352 | 97 |
| 463 | 3300031731 | Ga0307405_11346035 | Ga0307405_113460352 | 97 |
| 464 | 3300031911 | Ga0307412_10384001 | Ga0307412_103840012 | 97 |
| 465 | 3300031995 | Ga0307409_100448831 | Ga0307409_1004488312 | 97 |
| 466 | 3300032002 | Ga0307416_101407697 | Ga0307416_1014076972 | 97 |
| 467 | 3300032002 | Ga0307416_103018253 | Ga0307416_1030182532 | 97 |
| 468 | 3300032004 | Ga0307414_10555685 | Ga0307414_105556852 | 97 |
| 469 | 3300032005 | Ga0307411_10132689 | Ga0307411_101326892 | 97 |
| 470 | 3300032005 | Ga0307411_11315769 | Ga0307411_113157692 | 97 |
| 471 | 3300033180 | Ga0307510_10249853 | Ga0307510_102498532 | 97 |
| 472 | 3300034816 | Ga0373930_0102276 | Ga0373930_0102276_116_412 | 97 |
| 473 | 3300034818 | Ga0373950_0046128 | Ga0373950_0046128_295_591 | 97 |
| 474 | 3300034819 | Ga0373958_0096614 | Ga0373958_0096614_272_568 | 97 |
| 475 | 3300035083 | Ga0373926_0263483 | Ga0373926_0263483_178_474 | 97 |
| 476 | 3300035088 | Ga0373940_0315390 | Ga0373940_0315390_83_379 | 97 |
| 477 | 3300035112 | Ga0373932_0120925 | Ga0373932_0120925_420_713 | 97 |
| 478 | 3300035112 | Ga0373932_0390867 | Ga0373932_0390867_155_481 | 97 |
| 479 | 3300035116 | Ga0373945_0349944 | Ga0373945_0349944_10_306 | 97 |
| 480 | 3300035120 | Ga0373957_0561347 | Ga0373957_0561347_56_361 | 97 |
| 481 | 3300035171 | Ga0373946_0028836 | Ga0373946_0028836_1033_1329 | 97 |
| 482 | 3300035171 | Ga0373946_0628728 | Ga0373946_0628728_41_337 | 97 |
| 483 | 3300035172 | Ga0373955_0038176 | Ga0373955_0038176_1463_1759 | 97 |
| 484 | 3300035691 | Ga0373931_0002612 | Ga0373931_0002612_6885_7181 | 97 |
| 485 | 3300035692 | Ga0373935_0304146 | Ga0373935_0304146_758_1054 | 97 |
| 486 | 3300035695 | Ga0373927_0201101 | Ga0373927_0201101_317_613 | 97 |
| 487 | 3300035695 | Ga0373927_0421065 | Ga0373927_0421065_480_776 | 97 |
| 488 | 3300035724 | Ga0373933_0417977 | Ga0373933_0417977_400_705 | 97 |
| 489 | 3300035725 | Ga0373947_0272514 | Ga0373947_0272514_709_1005 | 97 |
| 490 | 3300035725 | Ga0373947_0407283 | Ga0373947_0407283_106_399 | 97 |
| 491 | 3300035725 | Ga0373947_0846487 | Ga0373947_0846487_124_420 | 97 |
| 492 | 3300036401 | Ga0373937_0208163 | Ga0373937_0208163_834_1130 | 97 |
| 493 | 3300037068 | Ga0373925_0020491 | Ga0373925_0020491_941_1237 | 97 |
| 494 | 3300037068 | Ga0373925_1416279 | Ga0373925_1416279_80_385 | 97 |
| 495 | 3300039450 | Ga0436363_1416401 | Ga0436363_1416401_781_1074 | 97 |
| 496 | 3300041404 | Ga0439436_0111736 | Ga0439436_0111736_132_425 | 97 |
| 497 | 3300041404 | Ga0439436_0173384 | Ga0439436_0173384_190_483 | 97 |
| 498 | 3300042001 | Ga0439441_034380 | Ga0439441_034380_284_583 | 97 |
| 499 | 3300042001 | Ga0439441_114393 | Ga0439441_114393_86_379 | 97 |
| 500 | 3300042013 | Ga0439456_016347 | Ga0439456_016347_177_470 | 97 |
| 501 | 3300042015 | Ga0439462_0231460 | Ga0439462_0231460_93_386 | 97 |
| 502 | 3300042156 | Ga0439446_0048257 | Ga0439446_0048257_916_1209 | 97 |
| 503 | 3300042156 | Ga0439446_0102642 | Ga0439446_0102642_186_479 | 97 |
| 504 | 3300042157 | Ga0439458_0231599 | Ga0439458_0231599_206_499 | 97 |
| 505 | 3300042435 | Ga0439434_0150154 | Ga0439434_0150154_198_491 | 97 |
| 506 | 3300042436 | Ga0439435_0001802 | Ga0439435_0001802_196_489 | 97 |
| 507 | 3300042436 | Ga0439435_0003371 | Ga0439435_0003371_1835_2134 | 97 |
| 508 | 3300042461 | Ga0439460_0011547 | Ga0439460_0011547_316_615 | 97 |
| 509 | 3300045051 | Ga0451576_0130939 | Ga0451576_0130939_210_503 | 97 |
| 510 | 3300046454 | Ga0495592_0212786 | Ga0495592_0212786_26_322 | 97 |
| 511 | 3300046477 | Ga0495664_0315388 | Ga0495664_0315388_31_327 | 97 |
| 512 | 3300046491 | Ga0495584_0561565 | Ga0495584_0561565_134_427 | 97 |
| 513 | 3300046515 | Ga0495620_0117633 | Ga0495620_0117633_464_760 | 97 |
| 514 | 3300046516 | Ga0495628_0180049 | Ga0495628_0180049_1101_1397 | 97 |
| 515 | 3300046523 | Ga0495644_0154555 | Ga0495644_0154555_140_436 | 97 |
| 516 | 3300046528 | Ga0495642_0226442 | Ga0495642_0226442_67_360 | 97 |
| 517 | 3300046529 | Ga0495652_0702548 | Ga0495652_0702548_313_609 | 97 |
| 518 | 3300046533 | Ga0495640_0187672 | Ga0495640_0187672_564_860 | 97 |
| 519 | 3300046615 | Ga0495656_0672921 | Ga0495656_0672921_25_321 | 97 |
| 520 | 3300046642 | Ga0495634_0677340 | Ga0495634_0677340_14_310 | 97 |
| 521 | 3300046678 | Ga0495599_0531934 | Ga0495599_0531934_248_553 | 97 |
| 522 | 3300046678 | Ga0495599_0811585 | Ga0495599_0811585_226_522 | 97 |
| 523 | 3300046680 | Ga0495646_0053643 | Ga0495646_0053643_1625_1921 | 97 |
| 524 | 3300046681 | Ga0495647_0295472 | Ga0495647_0295472_72_377 | 97 |
| 525 | 3300046684 | Ga0495669_0443997 | Ga0495669_0443997_180_473 | 97 |
| 526 | 3300046689 | Ga0495613_0370523 | Ga0495613_0370523_82_378 | 97 |
| 527 | 3300046692 | Ga0495671_0274347 | Ga0495671_0274347_57_356 | 97 |
| 528 | 3300046694 | Ga0495649_0306544 | Ga0495649_0306544_465_761 | 97 |
| 529 | 3300047317 | Ga0495604_0076963 | Ga0495604_0076963_1386_1682 | 97 |
| 530 | 3300047319 | Ga0495674_0136111 | Ga0495674_0136111_482_778 | 97 |
| 531 | 3300047444 | Ga0495675_0293101 | Ga0495675_0293101_73_369 | 97 |
| 532 | 3300047472 | Ga0495686_0700547 | Ga0495686_0700547_50_346 | 97 |
| 533 | 3300048088 | Ga0495602_0254267 | Ga0495602_0254267_467_763 | 97 |
| 534 | 3300048903 | Ga0496100_0003275 | Ga0496100_0003275_7302_7598 | 97 |
| 535 | 3300048903 | Ga0496100_0512477 | Ga0496100_0512477_597_902 | 97 |
| 536 | 3300048907 | Ga0496104_0108167 | Ga0496104_0108167_1233_1538 | 97 |
| 537 | 3300048907 | Ga0496104_0276361 | Ga0496104_0276361_90_386 | 97 |
| 538 | 3300048908 | Ga0496105_0023306 | Ga0496105_0023306_380_685 | 97 |
| 539 | 3300048908 | Ga0496105_0307858 | Ga0496105_0307858_400_696 | 97 |
| 540 | 3300048909 | Ga0496106_1269567 | Ga0496106_1269567_30_326 | 97 |
| 541 | 3300048910 | Ga0496107_0065291 | Ga0496107_0065291_2171_2467 | 97 |
| 542 | 3300048910 | Ga0496107_0282922 | Ga0496107_0282922_613_918 | 97 |
| 543 | 3300048911 | Ga0496108_0195181 | Ga0496108_0195181_327_623 | 97 |
| 544 | 3300048914 | Ga0496111_0101576 | Ga0496111_0101576_1616_1912 | 97 |
| 545 | 3300048915 | Ga0496112_0121484 | Ga0496112_0121484_849_1145 | 97 |
| 546 | 3300048915 | Ga0496112_0170056 | Ga0496112_0170056_32_331 | 97 |
| 547 | 3300048917 | Ga0496114_0036965 | Ga0496114_0036965_312_617 | 97 |
| 548 | 3300048917 | Ga0496114_0072416 | Ga0496114_0072416_1137_1433 | 97 |
| 549 | 3300048917 | Ga0496114_0805501 | Ga0496114_0805501_506_805 | 97 |
| 550 | 3300048918 | Ga0496115_0007210 | Ga0496115_0007210_3309_3614 | 97 |
| 551 | 3300048918 | Ga0496115_0055854 | Ga0496115_0055854_2802_3098 | 97 |
| 552 | 3300049568 | Ga0501031_0421370 | Ga0501031_0421370_306_599 | 97 |
| 553 | 3300049568 | Ga0501031_0690061 | Ga0501031_0690061_163_456 | 97 |
| 554 | 3300049573 | Ga0501037_0570711 | Ga0501037_0570711_162_455 | 97 |
| 555 | 3300049574 | Ga0501038_0927366 | Ga0501038_0927366_117_410 | 97 |
| 556 | 3300049575 | Ga0501039_0663385 | Ga0501039_0663385_431_724 | 97 |
| 557 | 3300049576 | Ga0501040_0737416 | Ga0501040_0737416_106_399 | 97 |
| 558 | 3300049576 | Ga0501040_0850548 | Ga0501040_0850548_234_527 | 97 |
| 559 | 3300049577 | Ga0501041_0078476 | Ga0501041_0078476_940_1233 | 97 |
| 560 | 3300049578 | Ga0501042_0329666 | Ga0501042_0329666_616_909 | 97 |
| 561 | 3300049579 | Ga0501043_0874152 | Ga0501043_0874152_339_632 | 97 |
| 562 | 3300049580 | Ga0501046_0204857 | Ga0501046_0204857_25_318 | 97 |
| 563 | 3300049582 | Ga0501048_0347122 | Ga0501048_0347122_689_982 | 97 |
| 564 | 3300049587 | Ga0501071_0470003 | Ga0501071_0470003_247_540 | 97 |
| 565 | 3300049587 | Ga0501071_0511017 | Ga0501071_0511017_378_674 | 97 |
| 566 | 3300049587 | Ga0501071_1586460 | Ga0501071_1586460_194_487 | 97 |
| 567 | 3300049588 | Ga0501072_0166260 | Ga0501072_0166260_829_1122 | 97 |
| 568 | 3300049588 | Ga0501072_0411107 | Ga0501072_0411107_714_1007 | 97 |
| 569 | 3300049588 | Ga0501072_1480176 | Ga0501072_1480176_67_360 | 97 |
| 570 | 3300049590 | Ga0501074_1132363 | Ga0501074_1132363_114_407 | 97 |
| 571 | 3300049591 | Ga0501075_0512467 | Ga0501075_0512467_610_903 | 97 |
| 572 | 3300049592 | Ga0501076_0414015 | Ga0501076_0414015_291_584 | 97 |
| 573 | 3300049592 | Ga0501076_0499990 | Ga0501076_0499990_94_387 | 97 |
| 574 | 3300049592 | Ga0501076_0788933 | Ga0501076_0788933_348_641 | 97 |
| 575 | 3300049593 | Ga0501077_0372546 | Ga0501077_0372546_187_480 | 97 |
| 576 | 3300049743 | Ga0501081_0660066 | Ga0501081_0660066_89_382 | 97 |
| 577 | 3300049822 | Ga0501035_0375746 | Ga0501035_0375746_55_348 | 97 |
| 578 | 3300049824 | Ga0501045_0558252 | Ga0501045_0558252_248_541 | 97 |
| 579 | 3300050490 | nmdc:mga03n38_149604_c1 | nmdc:mga03n38_149604_c1_36_335 | 97 |
| 580 | 3300050492 | nmdc:mga0yw44_1924_c1 | nmdc:mga0yw44_1924_c1_446_745 | 97 |
| 581 | 3300050492 | nmdc:mga0yw44_84473_c1 | nmdc:mga0yw44_84473_c1_253_552 | 97 |
| 582 | 3300050493 | nmdc:mga0k408_35870_c1 | nmdc:mga0k408_35870_c1_700_996 | 97 |
| 583 | 3300050493 | nmdc:mga0k408_659226_c1 | nmdc:mga0k408_659226_c1_127_423 | 97 |
| 584 | 3300050494 | nmdc:mga06z11_182705_c1 | nmdc:mga06z11_182705_c1_32_331 | 97 |
| 585 | 3300050494 | nmdc:mga06z11_506526_c1 | nmdc:mga06z11_506526_c1_182_478 | 97 |
| 586 | 3300050494 | nmdc:mga06z11_776454_c1 | nmdc:mga06z11_776454_c1_257_556 | 97 |
| 587 | 3300050495 | nmdc:mga04h51_172925_c1 | nmdc:mga04h51_172925_c1_165_464 | 97 |
| 588 | 3300050496 | nmdc:mga07m45_556158_c1 | nmdc:mga07m45_556158_c1_70_369 | 97 |
| 589 | 3300050507 | nmdc:mga05p37_318473_c1 | nmdc:mga05p37_318473_c1_154_447 | 97 |
| 590 | 3300050508 | nmdc:mga09592_18107_c1 | nmdc:mga09592_18107_c1_1030_1323 | 97 |
| 591 | 3300050508 | nmdc:mga09592_831534_c1 | nmdc:mga09592_831534_c1_433_726 | 97 |
| 592 | 3300050508 | nmdc:mga09592_919371_c1 | nmdc:mga09592_919371_c1_413_706 | 97 |
| 593 | 3300050508 | nmdc:mga09592_979138_c1 | nmdc:mga09592_979138_c1_328_624 | 97 |
| 594 | 3300050509 | nmdc:mga0qj67_1566764_c1 | nmdc:mga0qj67_1566764_c1_61_354 | 97 |
| 595 | 3300050509 | nmdc:mga0qj67_30276_c1 | nmdc:mga0qj67_30276_c1_2141_2434 | 97 |
| 596 | 3300050509 | nmdc:mga0qj67_630801_c1 | nmdc:mga0qj67_630801_c1_318_614 | 97 |
| 597 | 3300050509 | nmdc:mga0qj67_653699_c1 | nmdc:mga0qj67_653699_c1_18_311 | 97 |
| 598 | 3300050509 | nmdc:mga0qj67_725446_c1 | nmdc:mga0qj67_725446_c1_421_714 | 97 |
| 599 | 3300050510 | nmdc:mga06r32_1150486_c1 | nmdc:mga06r32_1150486_c1_322_615 | 97 |
| 600 | 3300050510 | nmdc:mga06r32_1889735_c1 | nmdc:mga06r32_1889735_c1_203_496 | 97 |
| 601 | 3300050510 | nmdc:mga06r32_96527_c1 | nmdc:mga06r32_96527_c1_2046_2339 | 97 |
| 602 | 3300050511 | nmdc:mga08y16_208263_c1 | nmdc:mga08y16_208263_c1_1539_1865 | 97 |
| 603 | 3300050511 | nmdc:mga08y16_33511_c1 | nmdc:mga08y16_33511_c1_1862_2188 | 97 |
| 604 | 3300050511 | nmdc:mga08y16_429976_c1 | nmdc:mga08y16_429976_c1_329_622 | 97 |
| 605 | 3300050512 | nmdc:mga0n895_4031_c1 | nmdc:mga0n895_4031_c1_3814_4107 | 97 |
| 606 | 3300050513 | nmdc:mga0rr50_8806_c1 | nmdc:mga0rr50_8806_c1_3742_4035 | 97 |
| 607 | 3300050514 | nmdc:mga08x19_1704_c1 | nmdc:mga08x19_1704_c1_4517_4810 | 97 |
| 608 | 3300050514 | nmdc:mga08x19_20400_c1 | nmdc:mga08x19_20400_c1_598_891 | 97 |
| 609 | 3300050514 | nmdc:mga08x19_769303_c1 | nmdc:mga08x19_769303_c1_85_378 | 97 |
| 610 | 3300050515 | nmdc:mga0a205_173_c1 | nmdc:mga0a205_173_c1_4510_4803 | 97 |
| 611 | 3300053077 | Ga0495601_0078981 | Ga0495601_0078981_846_1142 | 97 |
| 612 | 3300053078 | Ga0495612_0117070 | Ga0495612_0117070_10_306 | 97 |
| 613 | 3300053085 | Ga0495619_0277421 | Ga0495619_0277421_287_583 | 97 |
| 614 | 3300053104 | Ga0500556_0169826 | Ga0500556_0169826_230_526 | 97 |
| 615 | 3300053130 | Ga0500642_0022849 | Ga0500642_0022849_1934_2230 | 97 |
| 616 | 3300053139 | Ga0500568_0083696 | Ga0500568_0083696_772_1068 | 97 |
| 617 | 3300053146 | Ga0500588_0261081 | Ga0500588_0261081_323_619 | 97 |
| 618 | 3300053153 | Ga0500616_0057208 | Ga0500616_0057208_751_1047 | 97 |
| 619 | 3300054114 | Ga0501084_1381017 | Ga0501084_1381017_185_478 | 97 |
| 620 | 3300059421 | Ga0590071_012909 | Ga0590071_012909_1184_1477 | 97 |
| 621 | 3300059424 | Ga0590075_023523 | Ga0590075_023523_291_584 | 97 |
| 622 | 3300060353 | Ga0501082_0311786 | Ga0501082_0311786_902_1195 | 97 |
| 623 | 3300060353 | Ga0501082_1419964 | Ga0501082_1419964_299_592 | 97 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fiu-assembly1.cif.gz_B | crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens | 0.914 | 1 | 96 |
| 3lo3-assembly2.cif.gz_C | the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. | 0.9065 | 3 | 92 |
| 3lo3-assembly2.cif.gz_C | the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. | 0.8615 | 3 | 92 |
| 3dca-assembly2.cif.gz_D | crystal structure of the rpa0582- protein of unknown function from rhodopseudomonas palustris- a structural genomics target | 0.7153 | 2 | 96 |
| 3hhl-assembly2.cif.gz_C | crystal structure of methylated rpa0582 protein | 0.7115 | 2 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fiuB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.882 | 3 | 96 | 3.30.70.100 |
| 3lo3U00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8704 | 4 | 92 | 3.30.70.100 |
| 2fiuB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8646 | 3 | 96 | 3.30.70.100 |
| 3lo3U00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8282 | 4 | 92 | 3.30.70.100 |
| af_A0A0R0GC68_3_111_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7097 | 2 | 95 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I4AAT7-F1-model_v4 | Uncharacterized conserved protein, DUF1330 family | 0.9631 | 1 | 96 |
|
| AF-A0A358PEN8-F1-model_v4 | DUF1330 domain-containing protein | 0.9624 | 1 | 96 |
|
| AF-A0A6N4U901-F1-model_v4 | deleted | 0.9622 | 1 | 96 |
|
| AF-A0A7Y9J7Z7-F1-model_v4 | Uncharacterized protein (DUF1330 family) | 0.9589 | 3 | 95 |
|
| AF-A0A6J4NLL1-F1-model_v4 | DUF1330 domain-containing protein | 0.9589 | 3 | 95 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar