F470039

General Info

Members Datasets Scaffolds Average Seq Length
621 464 1242 379

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0048598|Ga0495606_0048598_652_1926
Length 424
Sequence VRECAPDGVPTIPKSNVDRFMVGTARRARLCPPYDSARVEKTMTALPDIPLPAGIRSRYVDGINGLRVHVLEAGFETKGRPCILLLHGFPELAFSWRKVMPRLAAAGYHVIAPDQRGYGRTTGWTADYDGDLTPFSLLNLARDALALVSAFGYKQVDLAGHDFGSPVAAWCALIRPDVFRSVTLMSAPFGGAPQLPFNTVDGPAKPVAEDPVHRDLAALPRPRIHYQWYYATRPANADMQHAPQGVHDFLRAYYHHKSADWIDNKPYPLKSWSAGELAKLPTYYVMDLGETMAETVAKEMPSPAAIAANQWLPDSDLAYYSAEYGRTGFQGGLQWYRYGTTGMLNSEMQLFAGRSIDVPSCFISGKQDWGTYQRPGVFEAMQGRGCTRMLGCHLVDGAGHWVQQEQPAEVSRLLLEFLEKARSA

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
45 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
63 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
64 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
65 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
100 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
101 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
102 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
103 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
188 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
246 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
249 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
252 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
253 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
254 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
255 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
256 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
257 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
258 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
259 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
260 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
261 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
262 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
263 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
264 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
265 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
269 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
270 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
271 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
272 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
273 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
274 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
275 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
276 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
277 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
278 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
279 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
283 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
284 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
285 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
286 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
287 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
288 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
289 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
290 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
291 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
292 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
293 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
294 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
295 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
296 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
297 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
298 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
299 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
300 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
301 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
302 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
303 2791355199
304 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
305 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
306 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
307 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
308 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
309 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
310 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
311 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
312 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
313 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
314 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
315 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
316 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
317 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
318 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
319 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
320 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
321 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
322 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
323 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
324 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
325 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
326 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
327 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
328 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
329 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
330 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
331 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
332 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
333 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
334 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
335 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
336 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
337 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
338 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
339 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
340 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
341 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
342 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
343 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
344 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
345 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
346 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
347 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
348 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
349 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
350 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
351 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
352 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
353 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
354 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
355 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
356 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
357 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
358 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
359 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
360 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
361 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
362 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
363 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
364 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
365 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
366 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
367 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
368 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
369 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
370 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
371 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
372 2922368715
373 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
374 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
375 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
376 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
377 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
378 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
379 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
380 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
381 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
382 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
383 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
384 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
385 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
386 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
387 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
388 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
389 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
390 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
391 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
392 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
393 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
394 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
395 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
396 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
397 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
398 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
399 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
400 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
401 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
402 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
403 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
404 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
405 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
406 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
407 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
408 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
409 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
410 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
411 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
412 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
413 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
414 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
415 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
416 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
417 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
418 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
419 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
420 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
421 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
422 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
423 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
424 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
425 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
426 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
427 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
428 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
429 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
430 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
431 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
432 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
433 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
434 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
435 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
436 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
437 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
438 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
439 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
440 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
441 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
442 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
443 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
444 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
445 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
446 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
447 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
448 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
449 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
450 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
451 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
452 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
453 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
454 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
455 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
456 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
457 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
458 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
459 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
460 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
461 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
462 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
463 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
464 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.76
Metatranscriptomes 0
Isolates 29.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.17
Nodule 22.87
Rhizoplane 4.99
Rhizosphere 43.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0048598 3300046507 Bacteria 2788
2 JGI25406J46586_10000089 3300003203 Bacteria 41556
3 JGI25153J46596_10002570 3300003215 Bacteria 10404
4 JGI25160J50197_1001023 3300003354 Bacteria 14494
5 JGI25160J50197_1005256 3300003354 Bacteria 5418
6 Ga0055531_10001777 3300003794 Bacteria 15317
7 Ga0065165_1000346 3300005262 Bacteria 76065
8 Ga0065165_1000785 3300005262 Bacteria 42533
9 Ga0065165_1005251 3300005262 Bacteria 7408
10 Ga0065165_1008537 3300005262 Bacteria 4767
11 Ga0065165_1019068 3300005262 Bacteria 2463
12 Ga0070680_100038146 3300005336 Bacteria 3885
13 Ga0070691_10107357 3300005341 Bacteria 1393
14 Ga0070668_100037930 3300005347 Bacteria 3681
15 Ga0070671_100016463 3300005355 Bacteria 5978
16 Ga0070709_10003777 3300005434 Bacteria 8140
17 Ga0070714_100002243 3300005435 Bacteria 14221
18 Ga0070714_100091552 3300005435 Bacteria 2665
19 Ga0070714_100273245 3300005435 Bacteria 1568
20 Ga0070713_100036876 3300005436 Bacteria 3949
21 Ga0070713_100118505 3300005436 Bacteria 2318
22 Ga0070711_100004173 3300005439 Bacteria 8490
23 Ga0070663_100123757 3300005455 Bacteria 1956
24 Ga0070663_100151646 3300005455 Bacteria 1778
25 Ga0070681_10051248 3300005458 Bacteria 4117
26 Ga0070706_100215575 3300005467 Bacteria 1792
27 Ga0070698_100045371 3300005471 Bacteria 4499
28 Ga0070699_100267950 3300005518 Bacteria 1528
29 Ga0070665_100031610 3300005548 Bacteria 5329
30 Ga0070665_100278184 3300005548 Bacteria 1675
31 Ga0070704_100003243 3300005549 Bacteria 9299
32 Ga0070664_100060470 3300005564 Bacteria 3226
33 Ga0068857_100129044 3300005577 Bacteria 2279
34 Ga0068857_100225027 3300005577 Bacteria 1714
35 Ga0068854_100162983 3300005578 Bacteria 1728
36 Ga0068856_100065919 3300005614 Bacteria 3578
37 Ga0068856_100127069 3300005614 Bacteria 2553
38 Ga0068852_100418261 3300005616 Bacteria 1322
39 Ga0068863_100079136 3300005841 Bacteria 3113
40 Ga0068858_100031611 3300005842 Bacteria 4917
41 Ga0068862_100127547 3300005844 Bacteria 2248
42 Ga0081455_10004122 3300005937 Bacteria 16435
43 Ga0081540_1040551 3300005983 Bacteria 2426
44 Ga0081539_10000461 3300005985 Bacteria 86158
45 Ga0070717_10013830 3300006028 Bacteria 6196
46 Ga0070717_10018539 3300006028 Bacteria 5437
47 Ga0075365_10016284 3300006038 Bacteria 4518
48 Ga0075365_10156483 3300006038 Bacteria 1586
49 Ga0075363_100008111 3300006048 Bacteria 4873
50 Ga0075364_10038091 3300006051 Bacteria 3115
51 Ga0070716_100001830 3300006173 Bacteria 9631
52 Ga0075369_10027275 3300006186 Bacteria 2387
53 Ga0075369_10036174 3300006186 Bacteria 2101
54 Ga0075366_10012418 3300006195 Bacteria 4831
55 Ga0075366_10062218 3300006195 Bacteria 2219
56 Ga0075370_10054429 3300006353 Bacteria 2272
57 Ga0075430_100011252 3300006846 Bacteria 7589
58 Ga0068865_100199420 3300006881 Bacteria 1553
59 Ga0097620_100207497 3300006931 Bacteria 2045
60 Ga0099825_1030002 3300006941 Bacteria 2456
61 Ga0099824_1020150 3300006942 Bacteria 4991
62 Ga0105240_10310376 3300009093 Bacteria 1801
63 Ga0111539_10034215 3300009094 Bacteria 6164
64 Ga0111539_10257105 3300009094 Bacteria 2033
65 Ga0111539_10320297 3300009094 Bacteria 1804
66 Ga0105245_10055811 3300009098 Bacteria 3549
67 Ga0114129_10059680 3300009147 Bacteria 5333
68 Ga0114129_10062708 3300009147 Bacteria 5192
69 Ga0114129_10289347 3300009147 Bacteria 2187
70 Ga0105248_10167244 3300009177 Bacteria 2478
71 Ga0105248_10361296 3300009177 Bacteria 1635
72 Ga0105237_10009221 3300009545 Bacteria 10589
73 Ga0105237_10041729 3300009545 Bacteria 4627
74 Ga0105237_10054774 3300009545 Bacteria 3996
75 Ga0105239_10031357 3300010375 Bacteria 5847
76 Ga0105239_10683538 3300010375 Bacteria 1173
77 Ga0105246_10228616 3300011119 Bacteria 1463
78 Ga0157369_10116773 3300013105 Bacteria 2833
79 Ga0157374_10308768 3300013296 Bacteria 1565
80 Ga0157378_10061841 3300013297 Bacteria 3343
81 Ga0163162_10063372 3300013306 Bacteria 3739
82 Ga0163162_10110429 3300013306 Bacteria 2847
83 Ga0157375_10074764 3300013308 Bacteria 3410
84 Ga0163163_10006627 3300014325 Bacteria 10142
85 Ga0163163_10016019 3300014325 Bacteria 6951
86 Ga0157379_10027048 3300014968 Bacteria 5105
87 Ga0157379_10084068 3300014968 Bacteria 2853
88 Ga0157376_10019556 3300014969 Bacteria 5223
89 Ga0214544_1000003 3300021320 Bacteria 643752
90 Ga0214544_1024941 3300021320 Bacteria 2977
91 Ga0214542_1000022 3300021321 Bacteria 193578
92 Ga0214545_1000010 3300021324 Bacteria 193578
93 Ga0214545_1021054 3300021324 Bacteria 5002
94 Ga0214543_1000035 3300021327 Bacteria 183100
95 Ga0214543_1024629 3300021327 Bacteria 3672
96 Ga0213876_10005900 3300021384 Bacteria 6696
97 Ga0213875_10008253 3300021388 Bacteria 5341
98 Ga0228598_1000267 3300024227 Bacteria 10004
99 Ga0209677_105501 3300025253 Bacteria 3283
100 Ga0209148_1001229 3300025254 Bacteria 14397
101 Ga0209233_1005322 3300025261 Bacteria 4283
102 Ga0209233_1015872 3300025261 Bacteria 2086
103 Ga0209455_1001113 3300025272 Bacteria 13163
104 Ga0209564_1000865 3300025295 Bacteria 40348
105 Ga0209564_1006566 3300025295 Bacteria 6242
106 Ga0209564_1032250 3300025295 Bacteria 1582
107 Ga0209758_1000015 3300025297 Bacteria 851943
108 Ga0209758_1000306 3300025297 Bacteria 95362
109 Ga0209758_1000976 3300025297 Bacteria 38509
110 Ga0209758_1003668 3300025297 Bacteria 13667
111 Ga0209758_1006330 3300025297 Bacteria 8580
112 Ga0209758_1014947 3300025297 Bacteria 4067
113 Ga0209758_1020436 3300025297 Bacteria 3132
114 Ga0207426_1000217 3300025302 Bacteria 136180
115 Ga0207426_1001146 3300025302 Bacteria 23889
116 Ga0207426_1009602 3300025302 Bacteria 3814
117 Ga0207426_1038383 3300025302 Bacteria 1509
118 Ga0209257_1001620 3300025304 Bacteria 25806
119 Ga0207692_10001222 3300025898 Bacteria 9523
120 Ga0207647_10011601 3300025904 Bacteria 6171
121 Ga0207699_10023472 3300025906 Bacteria 3357
122 Ga0207684_10130497 3300025910 Bacteria 2157
123 Ga0207654_10025070 3300025911 Bacteria 3213
124 Ga0207695_10000059 3300025913 Bacteria 363920
125 Ga0207695_10016201 3300025913 Bacteria 8736
126 Ga0207671_10006959 3300025914 Bacteria 9946
127 Ga0207693_10005104 3300025915 Bacteria 11006
128 Ga0207693_10040907 3300025915 Bacteria 3651
129 Ga0207663_10002795 3300025916 Bacteria 8410
130 Ga0207657_10129009 3300025919 Bacteria 2074
131 Ga0207649_10074739 3300025920 Bacteria 2176
132 Ga0207652_10107982 3300025921 Bacteria 2466
133 Ga0207687_10043298 3300025927 Bacteria 3102
134 Ga0207700_10006776 3300025928 Bacteria 6961
135 Ga0207700_10162757 3300025928 Bacteria 1854
136 Ga0207664_10022864 3300025929 Bacteria 4676
137 Ga0207664_10209305 3300025929 Bacteria 1687
138 Ga0207706_10071644 3300025933 Bacteria 3048
139 Ga0207665_10000986 3300025939 Bacteria 19251
140 Ga0207665_10009446 3300025939 Bacteria 6400
141 Ga0207640_10163693 3300025981 Bacteria 1649
142 Ga0207678_10035256 3300026067 Bacteria 4356
143 Ga0207678_10051858 3300026067 Bacteria 3540
144 Ga0207678_10055568 3300026067 Bacteria 3410
145 Ga0207678_10096259 3300026067 Bacteria 2529
146 Ga0207678_10163233 3300026067 Bacteria 1902
147 Ga0207702_10070067 3300026078 Bacteria 3015
148 Ga0207641_10157891 3300026088 Bacteria 2059
149 Ga0207641_10434156 3300026088 Bacteria 1267
150 Ga0207674_10126051 3300026116 Bacteria 2526
151 Ga0209389_1000012 3300027296 Bacteria 213243
152 Ga0209389_1000052 3300027296 Bacteria 109624
153 Ga0209589_1000058 3300027357 Bacteria 109624
154 Ga0209489_100019 3300027361 Bacteria 213243
155 Ga0209700_100018 3300027363 Bacteria 238200
156 Ga0209813_10026880 3300027866 Bacteria 1667
157 Ga0207428_10010651 3300027907 Bacteria 8202
158 Ga0268266_10009025 3300028379 Bacteria 8814
159 Ga0268266_10054815 3300028379 Bacteria 3426
160 Ga0268266_10247266 3300028379 Bacteria 1648
161 Ga0268266_10354810 3300028379 Bacteria 1379
162 Ga0268265_10145901 3300028380 Bacteria 1988
163 Ga0307408_100018258 3300031548 Bacteria 4708
164 Ga0307508_10000715 3300031616 Bacteria 39415
165 Ga0307412_10064756 3300031911 Bacteria 2471
166 Ga0307510_10004729 3300033180 Bacteria 16101
167 Ga0373956_0056332 3300035119 Bacteria 1774
168 Ga0373946_0031330 3300035171 Bacteria 2128
169 Ga0373931_0012723 3300035691 Bacteria 4083
170 Ga0373935_0028043 3300035692 Bacteria 3480
171 Ga0373947_0058606 3300035725 Bacteria 2334
172 Ga0373937_0032709 3300036401 Bacteria 4718
173 Ga0373937_0142074 3300036401 Bacteria 2246
174 Ga0373925_0034632 3300037068 Bacteria 3722
175 Ga0373925_0095103 3300037068 Bacteria 2282
176 Ga0395899_0101230 3300037312 Bacteria 2080
177 Ga0395900_0005714 3300037418 Bacteria 12998
178 Ga0395898_0010560 3300037466 Bacteria 9644
179 Ga0395905_0080358 3300037471 Bacteria 3055
180 Ga0436364_0013924 3300037853 Bacteria 28152
181 Ga0436364_0185080 3300037853 Bacteria 45009
182 Ga0436364_0470674 3300037853 Bacteria 2819
183 Ga0436364_1030222 3300037853 Bacteria 2493
184 Ga0395901_0124914 3300038443 Bacteria 2704
185 Ga0436365_0733456 3300039437 Bacteria 4187
186 Ga0436365_1090930 3300039437 Bacteria 1802
187 Ga0436360_0451092 3300039438 Bacteria 1479
188 Ga0436360_0607803 3300039438 Bacteria 1534
189 Ga0436360_1120171 3300039438 Bacteria 2851
190 Ga0436363_0379319 3300039450 Bacteria 3361
191 Ga0436363_0411329 3300039450 Bacteria 1109
192 Ga0436363_1127020 3300039450 Bacteria 1465
193 Ga0451577_0016193 3300042876 Bacteria 6911
194 Ga0466969_0011805 3300044656 Bacteria 4621
195 Ga0466972_0000344 3300044658 Bacteria 25481
196 Ga0466972_0037585 3300044658 Bacteria 2366
197 Ga0466972_0094030 3300044658 Bacteria 1421
198 Ga0466966_0000563 3300044684 Bacteria 23663
199 Ga0466966_0047354 3300044684 Bacteria 2742
200 Ga0466961_0000087 3300044693 Bacteria 58547
201 Ga0466963_0004010 3300044694 Bacteria 8511
202 Ga0453684_0071677 3300044712 Bacteria 4380
203 Ga0466968_0038100 3300044735 Bacteria 2020
204 Ga0466960_0064917 3300044901 Bacteria 1801
205 Ga0466959_0000716 3300045049 Bacteria 19360
206 Ga0466959_0197387 3300045049 Bacteria 1402
207 Ga0466967_0046551 3300045976 Bacteria 3777
208 Ga0495592_0031905 3300046454 Bacteria 3979
209 Ga0495592_0045050 3300046454 Bacteria 3293
210 Ga0495592_0087540 3300046454 Bacteria 2240
211 Ga0495592_0182186 3300046454 Bacteria 1430
212 Ga0495603_0048952 3300046455 Bacteria 2516
213 Ga0495629_0053710 3300046459 Bacteria 2818
214 Ga0495638_0013722 3300046460 Bacteria 5504
215 Ga0495638_0013728 3300046460 Bacteria 5503
216 Ga0495638_0021048 3300046460 Bacteria 4302
217 Ga0495638_0076989 3300046460 Bacteria 2032
218 Ga0495651_0001016 3300046462 Bacteria 21736
219 Ga0495651_0015916 3300046462 Bacteria 5824
220 Ga0495651_0032987 3300046462 Bacteria 4039
221 Ga0495651_0097710 3300046462 Bacteria 2192
222 Ga0495653_0013450 3300046463 Bacteria 6667
223 Ga0495653_0071217 3300046463 Bacteria 2600
224 Ga0495653_0072968 3300046463 Bacteria 2562
225 Ga0495605_0104810 3300046474 Bacteria 1296
226 Ga0495639_0130155 3300046475 Bacteria 1204
227 Ga0495662_0025336 3300046476 Bacteria 2864
228 Ga0495664_0003213 3300046477 Bacteria 8868
229 Ga0495664_0046547 3300046477 Bacteria 2573
230 Ga0495607_0020669 3300046501 Bacteria 4156
231 Ga0495618_0108728 3300046514 Bacteria 1775
232 Ga0495628_0039169 3300046516 Bacteria 3791
233 Ga0495628_0058457 3300046516 Bacteria 3029
234 Ga0495628_0286426 3300046516 Bacteria 1222
235 Ga0495643_0025483 3300046522 Bacteria 3345
236 Ga0495648_0003274 3300046524 Bacteria 14332
237 Ga0495652_0014184 3300046529 Bacteria 7158
238 Ga0495652_0017357 3300046529 Bacteria 6422
239 Ga0495652_0104652 3300046529 Bacteria 2288
240 Ga0495652_0131879 3300046529 Bacteria 1977
241 Ga0495654_0081932 3300046530 Bacteria 1511
242 Ga0495640_0034183 3300046533 Bacteria 3608
243 Ga0495640_0059918 3300046533 Bacteria 2591
244 Ga0495640_0121186 3300046533 Bacteria 1700
245 Ga0495587_0025421 3300046536 Bacteria 3618
246 Ga0495598_0025143 3300046537 Bacteria 1621
247 Ga0495609_0040098 3300046538 Bacteria 2108
248 Ga0495645_0015540 3300046543 Bacteria 5414
249 Ga0495645_0038952 3300046543 Bacteria 3467
250 Ga0495622_0019442 3300046557 Bacteria 3161
251 Ga0495633_0064332 3300046558 Bacteria 1715
252 Ga0495667_0057214 3300046559 Bacteria 2564
253 Ga0495667_0061607 3300046559 Bacteria 2459
254 Ga0495667_0076788 3300046559 Bacteria 2173
255 Ga0495635_0024056 3300046663 Bacteria 4246
256 Ga0495635_0033607 3300046663 Bacteria 3557
257 Ga0495635_0138737 3300046663 Bacteria 1656
258 Ga0495659_0008329 3300046664 Bacteria 3300
259 Ga0495588_0016066 3300046674 Bacteria 3612
260 Ga0495588_0085913 3300046674 Bacteria 1645
261 Ga0495588_0105313 3300046674 Bacteria 1484
262 Ga0495657_0001266 3300046675 Bacteria 21999
263 Ga0495657_0014769 3300046675 Bacteria 5730
264 Ga0495599_0019821 3300046678 Bacteria 4189
265 Ga0495623_0001494 3300046679 Bacteria 15865
266 Ga0495623_0063328 3300046679 Bacteria 2316
267 Ga0495646_0016428 3300046680 Bacteria 4698
268 Ga0495646_0055751 3300046680 Bacteria 2372
269 Ga0495647_0015877 3300046681 Bacteria 2644
270 Ga0495613_0078923 3300046689 Bacteria 2394
271 Ga0495624_0087023 3300046690 Bacteria 1929
272 Ga0495670_0003464 3300046691 Bacteria 7752
273 Ga0495670_0033733 3300046691 Bacteria 2547
274 Ga0495600_0117490 3300046809 Bacteria 1730
275 Ga0495600_0149900 3300046809 Bacteria 1510
276 Ga0495581_0012343 3300047315 Bacteria 4950
277 Ga0495581_0018159 3300047315 Bacteria 4086
278 Ga0495604_0000470 3300047317 Bacteria 35601
279 Ga0495604_0036222 3300047317 Bacteria 3890
280 Ga0495674_0037144 3300047319 Bacteria 4378
281 Ga0495676_0044391 3300047321 Bacteria 3628
282 Ga0495680_0000546 3300047322 Bacteria 42342
283 Ga0495680_0109043 3300047322 Bacteria 2054
284 Ga0495687_015633 3300047443 Bacteria 3852
285 Ga0495675_0047628 3300047444 Bacteria 2727
286 Ga0495675_0061649 3300047444 Bacteria 2376
287 Ga0495673_0083447 3300047469 Bacteria 1319
288 Ga0495684_0029194 3300047471 Bacteria 4233
289 Ga0495686_0018718 3300047472 Bacteria 4639
290 Ga0495686_0022487 3300047472 Bacteria 4173
291 Ga0495686_0041944 3300047472 Bacteria 2912
292 Ga0495593_0014982 3300047673 Bacteria 4402
293 Ga0495602_0006281 3300048088 Bacteria 12466
294 Ga0495602_0181561 3300048088 Bacteria 1622
295 Ga0495615_0011412 3300048090 Bacteria 1805
296 Ga0495626_0022559 3300048091 Bacteria 3107
297 Ga0496101_0042711 3300048904 Bacteria 3237
298 Ga0496101_0268220 3300048904 Bacteria 1332
299 Ga0496102_0013319 3300048905 Bacteria 7123
300 Ga0496102_0160738 3300048905 Bacteria 2113
301 Ga0496103_0001777 3300048906 Bacteria 14064
302 Ga0496104_0005987 3300048907 Bacteria 10655
303 Ga0496104_0013573 3300048907 Bacteria 7342
304 Ga0496104_0032747 3300048907 Bacteria 4838
305 Ga0496105_0005035 3300048908 Bacteria 10006
306 Ga0496105_0014336 3300048908 Bacteria 6308
307 Ga0496105_0090637 3300048908 Bacteria 2525
308 Ga0496106_0128325 3300048909 Bacteria 1987
309 Ga0496106_0195702 3300048909 Bacteria 1608
310 Ga0496108_0004933 3300048911 Bacteria 10778
311 Ga0496109_0234562 3300048912 Bacteria 1727
312 Ga0496110_0010579 3300048913 Bacteria 7511
313 Ga0496110_0070053 3300048913 Bacteria 3106
314 Ga0496110_0212649 3300048913 Bacteria 1758
315 Ga0496110_0362069 3300048913 Bacteria 1321
316 Ga0496111_0061783 3300048914 Bacteria 2716
317 Ga0496112_0061460 3300048915 Bacteria 3703
318 Ga0496112_0102936 3300048915 Bacteria 2825
319 Ga0496112_0118450 3300048915 Bacteria 2618
320 Ga0496112_0399891 3300048915 Bacteria 1313
321 Ga0496113_0023194 3300048916 Bacteria 4400
322 Ga0496113_0108745 3300048916 Bacteria 2155
323 Ga0496113_0145603 3300048916 Bacteria 1866
324 Ga0496114_0247500 3300048917 Bacteria 1568
325 Ga0496115_0025598 3300048918 Bacteria 4596
326 Ga0496115_0095616 3300048918 Bacteria 2432
327 Ga0496116_0006870 3300048919 Bacteria 10220
328 Ga0496116_0045805 3300048919 Bacteria 2957
329 Ga0496118_0051010 3300048921 Bacteria 3169
330 Ga0496118_0051420 3300048921 Bacteria 3152
331 Ga0496118_0075116 3300048921 Bacteria 2412
332 Ga0496118_0078330 3300048921 Bacteria 2339
333 Ga0496118_0095886 3300048921 Bacteria 2023
334 Ga0496119_0040993 3300048922 Bacteria 2954
335 Ga0496119_0055520 3300048922 Bacteria 2406
336 Ga0496120_0089874 3300048923 Bacteria 1643
337 Ga0496121_0010297 3300048924 Bacteria 10577
338 Ga0496121_0023356 3300048924 Bacteria 5958
339 Ga0496121_0103447 3300048924 Bacteria 2191
340 Ga0496122_0016177 3300048925 Bacteria 7084
341 Ga0496124_0303524 3300048927 Bacteria 1152
342 Ga0496125_0001512 3300048928 Bacteria 33307
343 Ga0496125_0002212 3300048928 Bacteria 25927
344 Ga0496125_0005864 3300048928 Bacteria 13489
345 Ga0496125_0155016 3300048928 Bacteria 1566
346 Ga0496125_0212394 3300048928 Bacteria 1255
347 Ga0496126_0011588 3300048929 Bacteria 9100
348 Ga0496126_0023328 3300048929 Bacteria 5997
349 Ga0496126_0210520 3300048929 Bacteria 1637
350 Ga0501031_0000315 3300049568 Bacteria 27723
351 Ga0501032_0000040 3300049569 Bacteria 115662
352 Ga0501032_0072706 3300049569 Bacteria 2292
353 Ga0501033_0001665 3300049570 Bacteria 19454
354 Ga0501034_0028015 3300049571 Bacteria 5729
355 Ga0501036_0000977 3300049572 Bacteria 21586
356 Ga0501037_0000041 3300049573 Bacteria 118457
357 Ga0501038_0001897 3300049574 Bacteria 19339
358 Ga0501039_0001761 3300049575 Bacteria 15979
359 Ga0501042_0016391 3300049578 Bacteria 5085
360 Ga0501046_0000072 3300049580 Bacteria 106407
361 Ga0501047_0000044 3300049581 Bacteria 174789
362 Ga0501047_0228315 3300049581 Bacteria 1716
363 Ga0501047_0361993 3300049581 Bacteria 1286
364 Ga0501048_0002682 3300049582 Bacteria 13589
365 Ga0501067_0009477 3300049583 Bacteria 5394
366 Ga0501068_0003070 3300049584 Bacteria 8917
367 Ga0501069_0008511 3300049585 Bacteria 5395
368 Ga0501070_0012462 3300049586 Bacteria 7172
369 Ga0501070_0049834 3300049586 Bacteria 3477
370 Ga0501071_0067110 3300049587 Bacteria 2608
371 Ga0501072_0000657 3300049588 Bacteria 24920
372 Ga0501073_0005060 3300049589 Bacteria 9888
373 Ga0501074_0033664 3300049590 Bacteria 3713
374 Ga0501079_0006146 3300049741 Bacteria 9006
375 Ga0501080_0000820 3300049742 Bacteria 25379
376 Ga0501083_0002011 3300049744 Bacteria 13989
377 Ga0501035_0028653 3300049822 Bacteria 5082
378 Ga0501035_0166910 3300049822 Bacteria 1903
379 Ga0501044_0002869 3300049823 Bacteria 19629
380 nmdc:mga03n38_5033_c1 3300050490 Bacteria 4455
381 nmdc:mga00v17_193193_c1 3300050491 Bacteria 1315
382 nmdc:mga0k408_5183_c1 3300050493 Bacteria 6914
383 nmdc:mga0k408_86579_c1 3300050493 Bacteria 1839
384 nmdc:mga06z11_56677_c1 3300050494 Bacteria 2028
385 nmdc:mga04h51_21850_c1 3300050495 Bacteria 1929
386 nmdc:mga05p37_14694_c1 3300050507 Bacteria 9406
387 nmdc:mga05p37_289450_c1 3300050507 Bacteria 1950
388 nmdc:mga0qj67_19776_c1 3300050509 Bacteria 5150
389 nmdc:mga08y16_262385_c1 3300050511 Bacteria 1784
390 nmdc:mga0sz30_21283_c1 3300050516 Bacteria 2623
391 nmdc:mga0sz30_25108_c1 3300050516 Bacteria 2437
392 Ga0495595_0006438 3300053084 Bacteria 4790
393 Ga0495595_0036338 3300053084 Bacteria 2235
394 Ga0495619_0004136 3300053085 Bacteria 9274
395 Ga0495619_0017767 3300053085 Bacteria 4506
396 Ga0500578_0066973 3300053086 Bacteria 2290
397 Ga0500578_0074557 3300053086 Bacteria 2162
398 Ga0500643_000048 3300053087 Bacteria 147879
399 Ga0500651_0014520 3300053093 Bacteria 4821
400 Ga0500566_0025321 3300053094 Bacteria 3479
401 Ga0500641_0003349 3300053096 Bacteria 5674
402 Ga0500650_0000644 3300053098 Bacteria 9189
403 Ga0500556_0000003 3300053104 Bacteria 679379
404 Ga0500557_000097 3300053105 Bacteria 28812
405 Ga0500562_005225 3300053108 Bacteria 3260
406 Ga0500569_002859 3300053109 Bacteria 3453
407 Ga0500592_001789 3300053116 Bacteria 3473
408 Ga0500593_112500 3300053117 Bacteria 1116
409 Ga0500595_004037 3300053119 Bacteria 6691
410 Ga0500607_066495 3300053121 Bacteria 1870
411 Ga0500607_086993 3300053121 Bacteria 1581
412 Ga0500608_001738 3300053122 Bacteria 7783
413 Ga0500618_015815 3300053125 Bacteria 1899
414 Ga0500642_0000100 3300053130 Bacteria 41454
415 Ga0500642_0000104 3300053130 Bacteria 40747
416 Ga0500642_0003443 3300053130 Bacteria 4788
417 Ga0500642_0092719 3300053130 Bacteria 1397
418 Ga0500652_000968 3300053131 Bacteria 9486
419 Ga0500658_0013179 3300053134 Bacteria 3053
420 Ga0500559_0000117 3300053136 Bacteria 62940
421 Ga0500568_0000838 3300053139 Bacteria 21617
422 Ga0500568_0016791 3300053139 Bacteria 3244
423 Ga0500586_000325 3300053145 Bacteria 9490
424 Ga0500590_074241 3300053148 Bacteria 1684
425 Ga0500604_0002239 3300053151 Bacteria 5295
426 Ga0500616_0000033 3300053153 Bacteria 398830
427 Ga0500616_0036295 3300053153 Bacteria 2675
428 Ga0500622_0001002 3300053156 Bacteria 23819
429 Ga0500622_0009310 3300053156 Bacteria 5443
430 Ga0500633_0036023 3300053160 Bacteria 1634
431 Ga0500634_0046697 3300053161 Bacteria 2339
432 Ga0500638_038220 3300053162 Bacteria 2330
433 Ga0500638_094308 3300053162 Bacteria 1405
434 Ga0500636_0000016 3300053177 Bacteria 123469
435 Ga0500645_019526 3300053730 Bacteria 2107
436 Ga0500601_000237 3300053737 Bacteria 10803
437 Ga0501084_0026380 3300054114 Bacteria 4848
438 Ga0501082_0005729 3300060353 Bacteria 10776
439 2507505850 2507262055 Bacteria 8048963
440 2508540041 2508501009 Bacteria 7784016
441 2508696116 2508501042 Bacteria 8719808
442 2511397182 2511231028 Bacteria 8046582
443 2513626461 2513237092 Bacteria 8341956
444 2513638847 2513237094 Bacteria 8789602
445 2513649816 2513237095 Bacteria 8976980
446 2513694740 2513237101 Bacteria 7952346
447 2513704302 2513237102 Bacteria 7703324
448 2513715441 2513237104 Bacteria 10034502
449 2513875429 2513237139 Bacteria 8737671
450 2513891676 2513237141 Bacteria 8496279
451 2514011193 2513237161 Bacteria 8871253
452 2515630801 2515154112 Bacteria 8294334
453 2517105739 2517093001 Bacteria 9002274
454 2524435467 2524023205 Bacteria 8918781
455 2603860400 2602042107 Bacteria 6226103
456 2617347734 2617270735 Bacteria 9163226
457 2617374460 2617270741 Bacteria 8201522
458 2745081369 2744054633 Bacteria 8678936
459 2793061617 2791355196 Bacteria 7323613
460 2793078007
461 2805921654 2802429603 Bacteria 8777136
462 2818240816 2816332527 Bacteria 8933356
463 2824605579 2824600985 Bacteria 8488197
464 2824610877 2824609381 Bacteria 8672835
465 2824619402 2824617872 Bacteria 8814715
466 2824627857 2824626560 Bacteria 8813858
467 2824640324 2824635225 Bacteria 8785348
468 2824647193 2824644064 Bacteria 8743947
469 2824653928 2824653114 Bacteria 8493680
470 2824663660 2824661429 Bacteria 9877870
471 2824674969 2824671348 Bacteria 8369588
472 2824680271 2824679649 Bacteria 8248951
473 2824691391 2824687955 Bacteria 8360029
474 2824701465 2824696289 Bacteria 8335049
475 2824706339 2824704595 Bacteria 9667483
476 2824720784 2824714736 Bacteria 8717648
477 2824729338 2824723954 Bacteria 8758240
478 2824734929 2824732956 Bacteria 7810675
479 2824748076 2824746037 Bacteria 7911610
480 2824754980 2824753945 Bacteria 9787441
481 2824765166 2824763712 Bacteria 9792355
482 2824775792 2824773399 Bacteria 8360218
483 2838125163 2838122688 Bacteria 8803140
484 2841945904 2841941048 Bacteria 8688029
485 2841956772 2841949485 Bacteria 8680857
486 2841965255 2841957949 Bacteria 8652217
487 2841973289 2841966195 Bacteria 8673214
488 2841979552 2841974524 Bacteria 8931498
489 2841989327 2841983080 Bacteria 8395090
490 2842044318 2842038055 Bacteria 8002051
491 2842051693 2842045827 Bacteria 8006841
492 2844321549 2844315083 Bacteria 8138177
493 2847939522 2847930680 Bacteria 9342022
494 2847941329 2847939898 Bacteria 8606328
495 2849082256 2849076700 Bacteria 7039503
496 2857513273 2857509624 Bacteria 7472071
497 2857525347 2857524615 Bacteria 6615449
498 2874596414 2874590934 Bacteria 8299676
499 2874620176 2874612657 Bacteria 8252029
500 2874622389 2874620515 Bacteria 8290088
501 2874633034 2874628541 Bacteria 8630250
502 2874650401 2874645413 Bacteria 8214782
503 2876761722 2876761206 Bacteria 10111113
504 2876776879 2876771140 Bacteria 8287509
505 2876814014 2876808645 Bacteria 8824342
506 2876824669 2876818435 Bacteria 8274608
507 2879081016 2879074833 Bacteria 8279565
508 2879083203 2879083081 Bacteria 8587928
509 2879106539 2879099564 Bacteria 10442239
510 2879112451 2879110137 Bacteria 8907982
511 2879130359 2879127579 Bacteria 8294491
512 2879147219 2879142872 Bacteria 8267021
513 2881369670 2881364244 Bacteria 7710352
514 2881670224 2881665667 Bacteria 8175609
515 2885367675 2885366525 Bacteria 8326213
516 2888378696 2888378607 Bacteria 9652610
517 2888390015 2888388044 Bacteria 7304136
518 2888421037 2888419890 Bacteria 7857137
519 2889036337 2889033259 Bacteria 9099371
520 2893066293 2893066018 Bacteria 6158120
521 2903727877 2903727486 Bacteria 8281579
522 2904671604 2904666416 Bacteria 8226587
523 2904714354 2904711408 Bacteria 9771557
524 2906602639 2906602504 Bacteria 8295279
525 2906631952 2906626472 Bacteria 8826946
526 2906648620 2906643746 Bacteria 8722424
527 2908776940 2908775508 Bacteria 8092255
528 2919074962 2919073203 Bacteria 6531949
529 2922377567
530 2922393332 2922393267 Bacteria 8285685
531 2929622346 2929615660 Bacteria 9193770
532 2929630008 2929624759 Bacteria 9339455
533 2932788063 2932784394 Bacteria 9704911
534 2932794958 2932794094 Bacteria 7915132
535 2932805251 2932801729 Bacteria 7987968
536 2932813439 2932809354 Bacteria 9135765
537 2932820136 2932818245 Bacteria 9955613
538 2932832801 2932828146 Bacteria 9745859
539 2933584040 2933577622 Bacteria 9116884
540 2935613025 2935608549 Bacteria 8203142
541 2935620286 2935616580 Bacteria 9032984
542 2935640611 2935638405 Bacteria 10015038
543 2935649304 2935648319 Bacteria 8801166
544 2935657924 2935656913 Bacteria 8965014
545 2935668803 2935665750 Bacteria 9571747
546 2935681470 2935675223 Bacteria 9928132
547 2935687110 2935684952 Bacteria 9590419
548 2935696918 2935694250 Bacteria 9291695
549 2935708990 2935703347 Bacteria 10242284
550 2935716798 2935713505 Bacteria 9608509
551 2935723077 2935722832 Bacteria 9608746
552 2935734634 2935732158 Bacteria 9706831
553 2935744575 2935741537 Bacteria 9707219
554 2935753076 2935750917 Bacteria 9590372
555 2935766971 2935760218 Bacteria 9817913
556 2935777344 2935769743 Bacteria 7878163
557 2935777840 2935777560 Bacteria 8077691
558 2935793338 2935785616 Bacteria 7962367
559 2935801369 2935793552 Bacteria 8012592
560 2935804720 2935801545 Bacteria 9301974
561 2935815870 2935810662 Bacteria 9401221
562 2935825123 2935819856 Bacteria 8261050
563 2935832117 2935827899 Bacteria 10038562
564 2935841052 2935837841 Bacteria 9454360
565 2935852342 2935847175 Bacteria 8228321
566 2935859172 2935855204 Bacteria 9035059
567 2935864356 2935864058 Bacteria 9784707
568 2935875292 2935873716 Bacteria 9632195
569 2935887661 2935883170 Bacteria 7964738
570 2935910777 2935908558 Bacteria 8568796
571 2935921959 2935916978 Bacteria 9113783
572 2935929904 2935926038 Bacteria 8601059
573 2935937572 2935934488 Bacteria 8602579
574 2935948029 2935942939 Bacteria 8599779
575 2935956772 2935951376 Bacteria 8602333
576 2935963960 2935959822 Bacteria 7869783
577 2935970971 2935967501 Bacteria 8603075
578 2935978294 2935975950 Bacteria 8347125
579 2935985582 2935984226 Bacteria 8302647
580 2935995733 2935992306 Bacteria 9802711
581 2936005644 2936002035 Bacteria 9362176
582 2936012143 2936011229 Bacteria 8801034
583 2936020776 2936019824 Bacteria 8804134
584 2936029436 2936028420 Bacteria 8965941
585 2936041773 2936037263 Bacteria 9446081
586 2936048240 2936046547 Bacteria 8903709
587 2936056648 2936055302 Bacteria 8785755
588 2940558989 2940556831 Bacteria 9590747
589 2941532124 2941531003 Bacteria 7653939
590 2941541685 2941538514 Bacteria 9402094
591 3005485784 3005483717 Bacteria 7877331
592 3005510838 3005506211 Bacteria 6943378
593 3005588777 3005587118 Bacteria 7794411
594 3005601911 3005594810 Bacteria 8716512
595 3005717640 3005710791 Bacteria 7622528
596 3005724699 3005718088 Bacteria 8283608
597 8006987309 8006984368 Bacteria 9651211
598 8016517418 8016511872 Bacteria 9921665
599 8016556911 8016548790 Bacteria 8155074
600 8016570252 8016566248 Bacteria 8158151
601 8016585500 8016583857 Bacteria 10421953
602 8016602903 8016595262 Bacteria 8149947
603 8016605779 8016603502 Bacteria 8731218
604 8016617685 8016613128 Bacteria 8794220
605 8016623886 8016622563 Bacteria 7999408
606 8016634969 8016630954 Bacteria 9217207
607 8017059194 8017057580 Bacteria 10023680
608 8019531783 8019530166 Bacteria 8155624
609 8019539748 8019538911 Bacteria 7872763
610 8019550905 8019547302 Bacteria 7996444
611 8019576439 8019576017 Bacteria 10049540
612 8019594313 8019586578 Bacteria 10212056
613 8019607251 8019597564 Bacteria 10041141
614 8019611267 8019608314 Bacteria 10042931
615 8019622045 8019619141 Bacteria 9218857
616 8019639347 8019638758 Bacteria 9062356
617 8019677498 8019668869 Bacteria 8791617
618 8019687452 8019678201 Bacteria 8863603
619 8019695548 8019687851 Bacteria 8712826
620 8055743404 8055742211 Bacteria 9226248
621 8056975422 8056967851 Bacteria 9038162
622 Ga0495606_0048598
623 JGI25406J46586_10000089
624 JGI25153J46596_10002570
625 JGI25160J50197_1001023
626 JGI25160J50197_1005256
627 Ga0055531_10001777
628 Ga0065165_1000346
629 Ga0065165_1000785
630 Ga0065165_1005251
631 Ga0065165_1008537
632 Ga0065165_1019068
633 Ga0070680_100038146
634 Ga0070691_10107357
635 Ga0070668_100037930
636 Ga0070671_100016463
637 Ga0070709_10003777
638 Ga0070714_100002243
639 Ga0070714_100091552
640 Ga0070714_100273245
641 Ga0070713_100036876
642 Ga0070713_100118505
643 Ga0070711_100004173
644 Ga0070663_100123757
645 Ga0070663_100151646
646 Ga0070681_10051248
647 Ga0070706_100215575
648 Ga0070698_100045371
649 Ga0070699_100267950
650 Ga0070665_100031610
651 Ga0070665_100278184
652 Ga0070704_100003243
653 Ga0070664_100060470
654 Ga0068857_100129044
655 Ga0068857_100225027
656 Ga0068854_100162983
657 Ga0068856_100065919
658 Ga0068856_100127069
659 Ga0068852_100418261
660 Ga0068863_100079136
661 Ga0068858_100031611
662 Ga0068862_100127547
663 Ga0081455_10004122
664 Ga0081540_1040551
665 Ga0081539_10000461
666 Ga0070717_10013830
667 Ga0070717_10018539
668 Ga0075365_10016284
669 Ga0075365_10156483
670 Ga0075363_100008111
671 Ga0075364_10038091
672 Ga0070716_100001830
673 Ga0075369_10027275
674 Ga0075369_10036174
675 Ga0075366_10012418
676 Ga0075366_10062218
677 Ga0075370_10054429
678 Ga0075430_100011252
679 Ga0068865_100199420
680 Ga0097620_100207497
681 Ga0099825_1030002
682 Ga0099824_1020150
683 Ga0105240_10310376
684 Ga0111539_10034215
685 Ga0111539_10257105
686 Ga0111539_10320297
687 Ga0105245_10055811
688 Ga0114129_10059680
689 Ga0114129_10062708
690 Ga0114129_10289347
691 Ga0105248_10167244
692 Ga0105248_10361296
693 Ga0105237_10009221
694 Ga0105237_10041729
695 Ga0105237_10054774
696 Ga0105239_10031357
697 Ga0105239_10683538
698 Ga0105246_10228616
699 Ga0157369_10116773
700 Ga0157374_10308768
701 Ga0157378_10061841
702 Ga0163162_10063372
703 Ga0163162_10110429
704 Ga0157375_10074764
705 Ga0163163_10006627
706 Ga0163163_10016019
707 Ga0157379_10027048
708 Ga0157379_10084068
709 Ga0157376_10019556
710 Ga0214544_1000003
711 Ga0214544_1024941
712 Ga0214542_1000022
713 Ga0214545_1000010
714 Ga0214545_1021054
715 Ga0214543_1000035
716 Ga0214543_1024629
717 Ga0213876_10005900
718 Ga0213875_10008253
719 Ga0228598_1000267
720 Ga0209677_105501
721 Ga0209148_1001229
722 Ga0209233_1005322
723 Ga0209233_1015872
724 Ga0209455_1001113
725 Ga0209564_1000865
726 Ga0209564_1006566
727 Ga0209564_1032250
728 Ga0209758_1000015
729 Ga0209758_1000306
730 Ga0209758_1000976
731 Ga0209758_1003668
732 Ga0209758_1006330
733 Ga0209758_1014947
734 Ga0209758_1020436
735 Ga0207426_1000217
736 Ga0207426_1001146
737 Ga0207426_1009602
738 Ga0207426_1038383
739 Ga0209257_1001620
740 Ga0207692_10001222
741 Ga0207647_10011601
742 Ga0207699_10023472
743 Ga0207684_10130497
744 Ga0207654_10025070
745 Ga0207695_10000059
746 Ga0207695_10016201
747 Ga0207671_10006959
748 Ga0207693_10005104
749 Ga0207693_10040907
750 Ga0207663_10002795
751 Ga0207657_10129009
752 Ga0207649_10074739
753 Ga0207652_10107982
754 Ga0207687_10043298
755 Ga0207700_10006776
756 Ga0207700_10162757
757 Ga0207664_10022864
758 Ga0207664_10209305
759 Ga0207706_10071644
760 Ga0207665_10000986
761 Ga0207665_10009446
762 Ga0207640_10163693
763 Ga0207678_10035256
764 Ga0207678_10051858
765 Ga0207678_10055568
766 Ga0207678_10096259
767 Ga0207678_10163233
768 Ga0207702_10070067
769 Ga0207641_10157891
770 Ga0207641_10434156
771 Ga0207674_10126051
772 Ga0209389_1000012
773 Ga0209389_1000052
774 Ga0209589_1000058
775 Ga0209489_100019
776 Ga0209700_100018
777 Ga0209813_10026880
778 Ga0207428_10010651
779 Ga0268266_10009025
780 Ga0268266_10054815
781 Ga0268266_10247266
782 Ga0268266_10354810
783 Ga0268265_10145901
784 Ga0307408_100018258
785 Ga0307508_10000715
786 Ga0307412_10064756
787 Ga0307510_10004729
788 Ga0373956_0056332
789 Ga0373946_0031330
790 Ga0373931_0012723
791 Ga0373935_0028043
792 Ga0373947_0058606
793 Ga0373937_0032709
794 Ga0373937_0142074
795 Ga0373925_0034632
796 Ga0373925_0095103
797 Ga0395899_0101230
798 Ga0395900_0005714
799 Ga0395898_0010560
800 Ga0395905_0080358
801 Ga0436364_0013924
802 Ga0436364_0185080
803 Ga0436364_0470674
804 Ga0436364_1030222
805 Ga0395901_0124914
806 Ga0436365_0733456
807 Ga0436365_1090930
808 Ga0436360_0451092
809 Ga0436360_0607803
810 Ga0436360_1120171
811 Ga0436363_0379319
812 Ga0436363_0411329
813 Ga0436363_1127020
814 Ga0451577_0016193
815 Ga0466969_0011805
816 Ga0466972_0000344
817 Ga0466972_0037585
818 Ga0466972_0094030
819 Ga0466966_0000563
820 Ga0466966_0047354
821 Ga0466961_0000087
822 Ga0466963_0004010
823 Ga0453684_0071677
824 Ga0466968_0038100
825 Ga0466960_0064917
826 Ga0466959_0000716
827 Ga0466959_0197387
828 Ga0466967_0046551
829 Ga0495592_0031905
830 Ga0495592_0045050
831 Ga0495592_0087540
832 Ga0495592_0182186
833 Ga0495603_0048952
834 Ga0495629_0053710
835 Ga0495638_0013722
836 Ga0495638_0013728
837 Ga0495638_0021048
838 Ga0495638_0076989
839 Ga0495651_0001016
840 Ga0495651_0015916
841 Ga0495651_0032987
842 Ga0495651_0097710
843 Ga0495653_0013450
844 Ga0495653_0071217
845 Ga0495653_0072968
846 Ga0495605_0104810
847 Ga0495639_0130155
848 Ga0495662_0025336
849 Ga0495664_0003213
850 Ga0495664_0046547
851 Ga0495607_0020669
852 Ga0495618_0108728
853 Ga0495628_0039169
854 Ga0495628_0058457
855 Ga0495628_0286426
856 Ga0495643_0025483
857 Ga0495648_0003274
858 Ga0495652_0014184
859 Ga0495652_0017357
860 Ga0495652_0104652
861 Ga0495652_0131879
862 Ga0495654_0081932
863 Ga0495640_0034183
864 Ga0495640_0059918
865 Ga0495640_0121186
866 Ga0495587_0025421
867 Ga0495598_0025143
868 Ga0495609_0040098
869 Ga0495645_0015540
870 Ga0495645_0038952
871 Ga0495622_0019442
872 Ga0495633_0064332
873 Ga0495667_0057214
874 Ga0495667_0061607
875 Ga0495667_0076788
876 Ga0495635_0024056
877 Ga0495635_0033607
878 Ga0495635_0138737
879 Ga0495659_0008329
880 Ga0495588_0016066
881 Ga0495588_0085913
882 Ga0495588_0105313
883 Ga0495657_0001266
884 Ga0495657_0014769
885 Ga0495599_0019821
886 Ga0495623_0001494
887 Ga0495623_0063328
888 Ga0495646_0016428
889 Ga0495646_0055751
890 Ga0495647_0015877
891 Ga0495613_0078923
892 Ga0495624_0087023
893 Ga0495670_0003464
894 Ga0495670_0033733
895 Ga0495600_0117490
896 Ga0495600_0149900
897 Ga0495581_0012343
898 Ga0495581_0018159
899 Ga0495604_0000470
900 Ga0495604_0036222
901 Ga0495674_0037144
902 Ga0495676_0044391
903 Ga0495680_0000546
904 Ga0495680_0109043
905 Ga0495687_015633
906 Ga0495675_0047628
907 Ga0495675_0061649
908 Ga0495673_0083447
909 Ga0495684_0029194
910 Ga0495686_0018718
911 Ga0495686_0022487
912 Ga0495686_0041944
913 Ga0495593_0014982
914 Ga0495602_0006281
915 Ga0495602_0181561
916 Ga0495615_0011412
917 Ga0495626_0022559
918 Ga0496101_0042711
919 Ga0496101_0268220
920 Ga0496102_0013319
921 Ga0496102_0160738
922 Ga0496103_0001777
923 Ga0496104_0005987
924 Ga0496104_0013573
925 Ga0496104_0032747
926 Ga0496105_0005035
927 Ga0496105_0014336
928 Ga0496105_0090637
929 Ga0496106_0128325
930 Ga0496106_0195702
931 Ga0496108_0004933
932 Ga0496109_0234562
933 Ga0496110_0010579
934 Ga0496110_0070053
935 Ga0496110_0212649
936 Ga0496110_0362069
937 Ga0496111_0061783
938 Ga0496112_0061460
939 Ga0496112_0102936
940 Ga0496112_0118450
941 Ga0496112_0399891
942 Ga0496113_0023194
943 Ga0496113_0108745
944 Ga0496113_0145603
945 Ga0496114_0247500
946 Ga0496115_0025598
947 Ga0496115_0095616
948 Ga0496116_0006870
949 Ga0496116_0045805
950 Ga0496118_0051010
951 Ga0496118_0051420
952 Ga0496118_0075116
953 Ga0496118_0078330
954 Ga0496118_0095886
955 Ga0496119_0040993
956 Ga0496119_0055520
957 Ga0496120_0089874
958 Ga0496121_0010297
959 Ga0496121_0023356
960 Ga0496121_0103447
961 Ga0496122_0016177
962 Ga0496124_0303524
963 Ga0496125_0001512
964 Ga0496125_0002212
965 Ga0496125_0005864
966 Ga0496125_0155016
967 Ga0496125_0212394
968 Ga0496126_0011588
969 Ga0496126_0023328
970 Ga0496126_0210520
971 Ga0501031_0000315
972 Ga0501032_0000040
973 Ga0501032_0072706
974 Ga0501033_0001665
975 Ga0501034_0028015
976 Ga0501036_0000977
977 Ga0501037_0000041
978 Ga0501038_0001897
979 Ga0501039_0001761
980 Ga0501042_0016391
981 Ga0501046_0000072
982 Ga0501047_0000044
983 Ga0501047_0228315
984 Ga0501047_0361993
985 Ga0501048_0002682
986 Ga0501067_0009477
987 Ga0501068_0003070
988 Ga0501069_0008511
989 Ga0501070_0012462
990 Ga0501070_0049834
991 Ga0501071_0067110
992 Ga0501072_0000657
993 Ga0501073_0005060
994 Ga0501074_0033664
995 Ga0501079_0006146
996 Ga0501080_0000820
997 Ga0501083_0002011
998 Ga0501035_0028653
999 Ga0501035_0166910
1000 Ga0501044_0002869
1001 nmdc:mga03n38_5033_c1
1002 nmdc:mga00v17_193193_c1
1003 nmdc:mga0k408_5183_c1
1004 nmdc:mga0k408_86579_c1
1005 nmdc:mga06z11_56677_c1
1006 nmdc:mga04h51_21850_c1
1007 nmdc:mga05p37_14694_c1
1008 nmdc:mga05p37_289450_c1
1009 nmdc:mga0qj67_19776_c1
1010 nmdc:mga08y16_262385_c1
1011 nmdc:mga0sz30_21283_c1
1012 nmdc:mga0sz30_25108_c1
1013 Ga0495595_0006438
1014 Ga0495595_0036338
1015 Ga0495619_0004136
1016 Ga0495619_0017767
1017 Ga0500578_0066973
1018 Ga0500578_0074557
1019 Ga0500643_000048
1020 Ga0500651_0014520
1021 Ga0500566_0025321
1022 Ga0500641_0003349
1023 Ga0500650_0000644
1024 Ga0500556_0000003
1025 Ga0500557_000097
1026 Ga0500562_005225
1027 Ga0500569_002859
1028 Ga0500592_001789
1029 Ga0500593_112500
1030 Ga0500595_004037
1031 Ga0500607_066495
1032 Ga0500607_086993
1033 Ga0500608_001738
1034 Ga0500618_015815
1035 Ga0500642_0000100
1036 Ga0500642_0000104
1037 Ga0500642_0003443
1038 Ga0500642_0092719
1039 Ga0500652_000968
1040 Ga0500658_0013179
1041 Ga0500559_0000117
1042 Ga0500568_0000838
1043 Ga0500568_0016791
1044 Ga0500586_000325
1045 Ga0500590_074241
1046 Ga0500604_0002239
1047 Ga0500616_0000033
1048 Ga0500616_0036295
1049 Ga0500622_0001002
1050 Ga0500622_0009310
1051 Ga0500633_0036023
1052 Ga0500634_0046697
1053 Ga0500638_038220
1054 Ga0500638_094308
1055 Ga0500636_0000016
1056 Ga0500645_019526
1057 Ga0500601_000237
1058 Ga0501084_0026380
1059 Ga0501082_0005729
1060 2507505850
1061 2508540041
1062 2508696116
1063 2511397182
1064 2513626461
1065 2513638847
1066 2513649816
1067 2513694740
1068 2513704302
1069 2513715441
1070 2513875429
1071 2513891676
1072 2514011193
1073 2515630801
1074 2517105739
1075 2524435467
1076 2603860400
1077 2617347734
1078 2617374460
1079 2745081369
1080 2793061617
1081 2793078007
1082 2805921654
1083 2818240816
1084 2824605579
1085 2824610877
1086 2824619402
1087 2824627857
1088 2824640324
1089 2824647193
1090 2824653928
1091 2824663660
1092 2824674969
1093 2824680271
1094 2824691391
1095 2824701465
1096 2824706339
1097 2824720784
1098 2824729338
1099 2824734929
1100 2824748076
1101 2824754980
1102 2824765166
1103 2824775792
1104 2838125163
1105 2841945904
1106 2841956772
1107 2841965255
1108 2841973289
1109 2841979552
1110 2841989327
1111 2842044318
1112 2842051693
1113 2844321549
1114 2847939522
1115 2847941329
1116 2849082256
1117 2857513273
1118 2857525347
1119 2874596414
1120 2874620176
1121 2874622389
1122 2874633034
1123 2874650401
1124 2876761722
1125 2876776879
1126 2876814014
1127 2876824669
1128 2879081016
1129 2879083203
1130 2879106539
1131 2879112451
1132 2879130359
1133 2879147219
1134 2881369670
1135 2881670224
1136 2885367675
1137 2888378696
1138 2888390015
1139 2888421037
1140 2889036337
1141 2893066293
1142 2903727877
1143 2904671604
1144 2904714354
1145 2906602639
1146 2906631952
1147 2906648620
1148 2908776940
1149 2919074962
1150 2922377567
1151 2922393332
1152 2929622346
1153 2929630008
1154 2932788063
1155 2932794958
1156 2932805251
1157 2932813439
1158 2932820136
1159 2932832801
1160 2933584040
1161 2935613025
1162 2935620286
1163 2935640611
1164 2935649304
1165 2935657924
1166 2935668803
1167 2935681470
1168 2935687110
1169 2935696918
1170 2935708990
1171 2935716798
1172 2935723077
1173 2935734634
1174 2935744575
1175 2935753076
1176 2935766971
1177 2935777344
1178 2935777840
1179 2935793338
1180 2935801369
1181 2935804720
1182 2935815870
1183 2935825123
1184 2935832117
1185 2935841052
1186 2935852342
1187 2935859172
1188 2935864356
1189 2935875292
1190 2935887661
1191 2935910777
1192 2935921959
1193 2935929904
1194 2935937572
1195 2935948029
1196 2935956772
1197 2935963960
1198 2935970971
1199 2935978294
1200 2935985582
1201 2935995733
1202 2936005644
1203 2936012143
1204 2936020776
1205 2936029436
1206 2936041773
1207 2936048240
1208 2936056648
1209 2940558989
1210 2941532124
1211 2941541685
1212 3005485784
1213 3005510838
1214 3005588777
1215 3005601911
1216 3005717640
1217 3005724699
1218 8006987309
1219 8016517418
1220 8016556911
1221 8016570252
1222 8016585500
1223 8016602903
1224 8016605779
1225 8016617685
1226 8016623886
1227 8016634969
1228 8017059194
1229 8019531783
1230 8019539748
1231 8019550905
1232 8019576439
1233 8019594313
1234 8019607251
1235 8019611267
1236 8019622045
1237 8019639347
1238 8019677498
1239 8019687452
1240 8019695548
1241 8055743404
1242 8056975422

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

77

251

0.82

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

81

407

0.8

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

83

413

0.57

Structural Annotation

Top 5 Hits

ID Description Score Start End
6unw-assembly1.cif.gz_A epoxide hydrolase from an endophytic streptomyces 0.8951 13 380
4ufp-assembly2.cif.gz_B laboratory evolved variant r-c1b1d33 of potato epoxide hydrolase steh1 0.8699 16 381
3cxu-assembly2.cif.gz_B structure of a y149f mutant of epoxide hydrolase from solanum tuberosum 0.8673 16 381
7cg2-assembly1.cif.gz_B vigna radiata epoxide hydrolase mutant 0.8645 15 381
4uhb-assembly2.cif.gz_B laboratory evolved variant r-c1 of potato epoxide hydrolase steh1 0.8643 16 381
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9399 15 113 3.40.50.12270
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8948 17 141 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8919 15 113 3.40.50.12270
af_B6SUW2_10_323_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8626 16 381 3.40.50.1820
5cw2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8625 16 381 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V8KN06-F1-model_v4 Alpha/beta hydrolase 0.9883 175 381 GO:0016787
AF-A0A4Q4CVM9-F1-model_v4 Alpha/beta fold hydrolase 0.9863 12 380 GO:0016787
AF-A0A5B2TBR0-F1-model_v4 Alpha/beta fold hydrolase 0.9848 12 379 GO:0016787
AF-A0A847H2K3-F1-model_v4 Alpha/beta hydrolase 0.984 12 382 GO:0016787
AF-A0A6L7XQH9-F1-model_v4 Alpha/beta hydrolase 0.9838 33 380 GO:0016787

Map