F469895
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 620 | 282 | 620 | 309 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100011470|Ga0070698_1000114703 |
| Length | 371 |
| Sequence | MTDLDVVTGAFSYSGAAIATELQAAGRRVRTLTGHPGRVPKTGAASGIEVRPLDFTDPVLLAESMRGAETLYNTYWVRFAHGGVDHPVAVARSRVLFQAAAEAGVRRIVHVSITNPSADSPYPYFRGKAAVEQALGDLGVSHAVLRPAVLFGGNGVLINNIAWLLRRLPVFAVGGTGEYRIRPIHVDDLARLAVRAGRSEATEVIDAVGPERPAFGELVHTIRNLVGSRSRIVHVPGALLPVAARALGLVLRDTLLTADEYQGMADGLADTDGPATGDTRLTQWMADHKDALGRVYANELTRHFRASPAAQRLPEGAGVGGGVDLAEPVHGDQSVDLGSGDGRVAEQFLDHPDVGAAVEHVGGERVPQRVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 98 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 145 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 147 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 154 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 156 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 159 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 162 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 165 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 169 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 188 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 189 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 190 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 191 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 192 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 193 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 196 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 197 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 198 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 199 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 238 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 239 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 245 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 268 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 269 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 282 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.87 |
| Metatranscriptomes | 1.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.97 |
| Nodule | 0 |
| Rhizoplane | 4.19 |
| Rhizosphere | 93.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10095319 | 3300005295 | Unclassified | 3386 |
| 2 | Ga0070658_10020995 | 3300005327 | Bacteria | 5231 |
| 3 | Ga0070658_10037149 | 3300005327 | Bacteria | 3925 |
| 4 | Ga0070683_100050989 | 3300005329 | Bacteria | 3833 |
| 5 | Ga0070683_100239336 | 3300005329 | Bacteria | 1726 |
| 6 | Ga0070670_100016510 | 3300005331 | Bacteria | 6338 |
| 7 | Ga0070666_10212315 | 3300005335 | Bacteria | 1363 |
| 8 | Ga0070682_100062106 | 3300005337 | Bacteria | 2366 |
| 9 | Ga0070682_100248735 | 3300005337 | Bacteria | 1280 |
| 10 | Ga0068868_100086820 | 3300005338 | Bacteria | 2515 |
| 11 | Ga0070660_100016204 | 3300005339 | Bacteria | 5405 |
| 12 | Ga0070691_10014562 | 3300005341 | Bacteria | 3609 |
| 13 | Ga0070661_100016429 | 3300005344 | Bacteria | 5231 |
| 14 | Ga0070671_100042991 | 3300005355 | Bacteria | 3757 |
| 15 | Ga0070674_100139231 | 3300005356 | Bacteria | 1819 |
| 16 | Ga0070674_100158931 | 3300005356 | Bacteria | 1713 |
| 17 | Ga0070709_10171030 | 3300005434 | Bacteria | 1518 |
| 18 | Ga0070709_10241047 | 3300005434 | Bacteria | 1298 |
| 19 | Ga0070714_100004519 | 3300005435 | Bacteria | 10490 |
| 20 | Ga0070714_100110408 | 3300005435 | Bacteria | 2434 |
| 21 | Ga0070714_100195658 | 3300005435 | Unclassified | 1847 |
| 22 | Ga0070714_100397291 | 3300005435 | Bacteria | 1302 |
| 23 | Ga0070713_100000227 | 3300005436 | Bacteria | 37565 |
| 24 | Ga0070713_100041199 | 3300005436 | Bacteria | 3761 |
| 25 | Ga0070713_100547470 | 3300005436 | Bacteria | 1095 |
| 26 | Ga0070710_10009936 | 3300005437 | Unclassified | 4665 |
| 27 | Ga0070710_10033090 | 3300005437 | Bacteria | 2805 |
| 28 | Ga0070710_10193459 | 3300005437 | Bacteria | 1280 |
| 29 | Ga0070711_100002099 | 3300005439 | Bacteria | 11266 |
| 30 | Ga0070711_100077229 | 3300005439 | Bacteria | 2363 |
| 31 | Ga0070711_100082493 | 3300005439 | Unclassified | 2295 |
| 32 | Ga0070711_100210822 | 3300005439 | Bacteria | 1504 |
| 33 | Ga0070711_100276699 | 3300005439 | Bacteria | 1326 |
| 34 | Ga0070705_100002171 | 3300005440 | Bacteria | 9968 |
| 35 | Ga0070705_100025777 | 3300005440 | Bacteria | 3191 |
| 36 | Ga0070705_100311515 | 3300005440 | Bacteria | 1132 |
| 37 | Ga0070694_100258633 | 3300005444 | Unclassified | 1320 |
| 38 | Ga0070708_100000079 | 3300005445 | Bacteria | 62448 |
| 39 | Ga0070708_100006063 | 3300005445 | Bacteria | 9615 |
| 40 | Ga0070708_100010325 | 3300005445 | Bacteria | 7562 |
| 41 | Ga0070708_100010469 | 3300005445 | Bacteria | 7520 |
| 42 | Ga0070708_100016299 | 3300005445 | Bacteria | 6163 |
| 43 | Ga0070708_100082894 | 3300005445 | Bacteria | 2905 |
| 44 | Ga0070708_100125057 | 3300005445 | Bacteria | 2376 |
| 45 | Ga0070708_100151108 | 3300005445 | Bacteria | 2159 |
| 46 | Ga0070708_100152011 | 3300005445 | Bacteria | 2153 |
| 47 | Ga0070708_100531761 | 3300005445 | Bacteria | 1109 |
| 48 | Ga0070708_100592523 | 3300005445 | Bacteria | 1045 |
| 49 | Ga0070663_100006099 | 3300005455 | Bacteria | 7213 |
| 50 | Ga0070678_100015683 | 3300005456 | Bacteria | 4823 |
| 51 | Ga0070678_100017884 | 3300005456 | Bacteria | 4578 |
| 52 | Ga0070678_100496297 | 3300005456 | Bacteria | 1076 |
| 53 | Ga0070681_10052862 | 3300005458 | Bacteria | 4051 |
| 54 | Ga0070681_10084060 | 3300005458 | Bacteria | 3135 |
| 55 | Ga0070681_10108500 | 3300005458 | Bacteria | 2716 |
| 56 | Ga0070681_10244432 | 3300005458 | Bacteria | 1708 |
| 57 | Ga0070681_10451602 | 3300005458 | Bacteria | 1197 |
| 58 | Ga0070706_100000056 | 3300005467 | Bacteria | 137252 |
| 59 | Ga0070706_100000275 | 3300005467 | Bacteria | 62444 |
| 60 | Ga0070706_100000738 | 3300005467 | Bacteria | 36905 |
| 61 | Ga0070706_100002547 | 3300005467 | Bacteria | 18320 |
| 62 | Ga0070706_100003078 | 3300005467 | Bacteria | 16520 |
| 63 | Ga0070706_100031434 | 3300005467 | Bacteria | 4895 |
| 64 | Ga0070706_100052553 | 3300005467 | Unclassified | 3760 |
| 65 | Ga0070706_100084653 | 3300005467 | Bacteria | 2938 |
| 66 | Ga0070706_100106949 | 3300005467 | Bacteria | 2602 |
| 67 | Ga0070706_100143332 | 3300005467 | Bacteria | 2230 |
| 68 | Ga0070707_100000177 | 3300005468 | Bacteria | 62444 |
| 69 | Ga0070707_100000933 | 3300005468 | Bacteria | 29038 |
| 70 | Ga0070707_100003748 | 3300005468 | Bacteria | 14337 |
| 71 | Ga0070707_100014998 | 3300005468 | Bacteria | 7273 |
| 72 | Ga0070707_100017656 | 3300005468 | Bacteria | 6712 |
| 73 | Ga0070707_100020001 | 3300005468 | Bacteria | 6311 |
| 74 | Ga0070707_100076148 | 3300005468 | Bacteria | 3237 |
| 75 | Ga0070707_100086991 | 3300005468 | Unclassified | 3022 |
| 76 | Ga0070707_100109421 | 3300005468 | Bacteria | 2680 |
| 77 | Ga0070707_100157502 | 3300005468 | Bacteria | 2212 |
| 78 | Ga0070707_100212860 | 3300005468 | Bacteria | 1883 |
| 79 | Ga0070707_100275596 | 3300005468 | Bacteria | 1635 |
| 80 | Ga0070707_100305320 | 3300005468 | Bacteria | 1546 |
| 81 | Ga0070698_100000745 | 3300005471 | Bacteria | 35041 |
| 82 | Ga0070698_100001003 | 3300005471 | Bacteria | 31091 |
| 83 | Ga0070698_100004255 | 3300005471 | Bacteria | 15737 |
| 84 | Ga0070698_100011470 | 3300005471 | Bacteria | 9405 |
| 85 | Ga0070698_100049858 | 3300005471 | Bacteria | 4272 |
| 86 | Ga0070698_100097832 | 3300005471 | Bacteria | 2910 |
| 87 | Ga0070698_100104147 | 3300005471 | Bacteria | 2807 |
| 88 | Ga0070698_100132610 | 3300005471 | Bacteria | 2446 |
| 89 | Ga0070698_100142950 | 3300005471 | Bacteria | 2343 |
| 90 | Ga0070698_100153543 | 3300005471 | Bacteria | 2248 |
| 91 | Ga0070698_100272936 | 3300005471 | Bacteria | 1622 |
| 92 | Ga0070699_100000245 | 3300005518 | Bacteria | 53369 |
| 93 | Ga0070699_100000813 | 3300005518 | Bacteria | 28868 |
| 94 | Ga0070699_100000981 | 3300005518 | Bacteria | 26615 |
| 95 | Ga0070699_100005113 | 3300005518 | Bacteria | 11536 |
| 96 | Ga0070699_100013099 | 3300005518 | Bacteria | 7147 |
| 97 | Ga0070699_100025186 | 3300005518 | Bacteria | 5130 |
| 98 | Ga0070699_100026247 | 3300005518 | Bacteria | 5025 |
| 99 | Ga0070699_100060339 | 3300005518 | Bacteria | 3287 |
| 100 | Ga0070699_100113691 | 3300005518 | Bacteria | 2378 |
| 101 | Ga0070699_100142553 | 3300005518 | Bacteria | 2117 |
| 102 | Ga0070699_100219441 | 3300005518 | Bacteria | 1694 |
| 103 | Ga0070679_100032971 | 3300005530 | Bacteria | 5126 |
| 104 | Ga0070679_100051760 | 3300005530 | Bacteria | 4090 |
| 105 | Ga0070679_100105435 | 3300005530 | Bacteria | 2805 |
| 106 | Ga0070684_100072443 | 3300005535 | Bacteria | 3033 |
| 107 | Ga0070684_100164507 | 3300005535 | Bacteria | 2013 |
| 108 | Ga0070684_100279167 | 3300005535 | Bacteria | 1530 |
| 109 | Ga0070684_100318393 | 3300005535 | Bacteria | 1429 |
| 110 | Ga0070697_100002762 | 3300005536 | Bacteria | 13516 |
| 111 | Ga0070697_100021391 | 3300005536 | Bacteria | 5125 |
| 112 | Ga0070697_100037656 | 3300005536 | Bacteria | 3908 |
| 113 | Ga0070697_100040828 | 3300005536 | Unclassified | 3754 |
| 114 | Ga0068853_100066238 | 3300005539 | Bacteria | 3136 |
| 115 | Ga0070686_100006701 | 3300005544 | Bacteria | 6412 |
| 116 | Ga0070695_100010669 | 3300005545 | Bacteria | 5490 |
| 117 | Ga0070695_100096389 | 3300005545 | Unclassified | 1985 |
| 118 | Ga0070696_100013207 | 3300005546 | Bacteria | 5542 |
| 119 | Ga0070696_100117371 | 3300005546 | Bacteria | 1923 |
| 120 | Ga0070696_100129997 | 3300005546 | Bacteria | 1831 |
| 121 | Ga0070693_100230344 | 3300005547 | Bacteria | 1218 |
| 122 | Ga0070665_100000050 | 3300005548 | Bacteria | 250991 |
| 123 | Ga0070665_100212679 | 3300005548 | Bacteria | 1934 |
| 124 | Ga0070704_100003129 | 3300005549 | Bacteria | 9439 |
| 125 | Ga0068855_100065828 | 3300005563 | Bacteria | 4225 |
| 126 | Ga0068855_100483564 | 3300005563 | Bacteria | 1347 |
| 127 | Ga0068855_100553890 | 3300005563 | Bacteria | 1244 |
| 128 | Ga0070664_100009530 | 3300005564 | Bacteria | 7874 |
| 129 | Ga0068857_100009622 | 3300005577 | Bacteria | 8397 |
| 130 | Ga0068856_100446842 | 3300005614 | Bacteria | 1313 |
| 131 | Ga0070702_100029174 | 3300005615 | Bacteria | 2997 |
| 132 | Ga0070702_100029858 | 3300005615 | Bacteria | 2968 |
| 133 | Ga0068864_100223840 | 3300005618 | Bacteria | 1737 |
| 134 | Ga0068864_100539223 | 3300005618 | Bacteria | 1126 |
| 135 | Ga0068861_100141314 | 3300005719 | Bacteria | 1965 |
| 136 | Ga0068861_100169007 | 3300005719 | Bacteria | 1811 |
| 137 | Ga0068870_10017164 | 3300005840 | Unclassified | 3474 |
| 138 | Ga0068863_100011662 | 3300005841 | Bacteria | 8502 |
| 139 | Ga0068863_100552926 | 3300005841 | Bacteria | 1136 |
| 140 | Ga0081455_10087395 | 3300005937 | Bacteria | 2536 |
| 141 | Ga0081455_10221953 | 3300005937 | Unclassified | 1400 |
| 142 | Ga0081539_10007469 | 3300005985 | Bacteria | 9954 |
| 143 | Ga0070717_10000162 | 3300006028 | Bacteria | 50425 |
| 144 | Ga0070717_10007624 | 3300006028 | Bacteria | 8044 |
| 145 | Ga0070717_10055211 | 3300006028 | Bacteria | 3276 |
| 146 | Ga0070717_10099565 | 3300006028 | Unclassified | 2466 |
| 147 | Ga0070717_10103147 | 3300006028 | Bacteria | 2424 |
| 148 | Ga0070717_10136936 | 3300006028 | Bacteria | 2109 |
| 149 | Ga0070717_10220461 | 3300006028 | Bacteria | 1667 |
| 150 | Ga0070717_10359799 | 3300006028 | Bacteria | 1302 |
| 151 | Ga0075368_10027159 | 3300006042 | Unclassified | 2206 |
| 152 | Ga0070715_10015021 | 3300006163 | Bacteria | 2880 |
| 153 | Ga0070715_10020705 | 3300006163 | Bacteria | 2540 |
| 154 | Ga0070715_10048634 | 3300006163 | Bacteria | 1814 |
| 155 | Ga0070715_10065165 | 3300006163 | Bacteria | 1611 |
| 156 | Ga0070715_10082342 | 3300006163 | Bacteria | 1463 |
| 157 | Ga0070716_100002393 | 3300006173 | Bacteria | 8634 |
| 158 | Ga0070716_100106625 | 3300006173 | Bacteria | 1728 |
| 159 | Ga0070712_100000611 | 3300006175 | Bacteria | 20975 |
| 160 | Ga0070712_100101871 | 3300006175 | Bacteria | 2125 |
| 161 | Ga0075367_10024787 | 3300006178 | Unclassified | 3384 |
| 162 | Ga0075367_10056488 | 3300006178 | Bacteria | 2332 |
| 163 | Ga0097621_100403962 | 3300006237 | Bacteria | 1223 |
| 164 | Ga0068871_100282122 | 3300006358 | Bacteria | 1453 |
| 165 | Ga0068871_100343515 | 3300006358 | Bacteria | 1318 |
| 166 | Ga0075428_100000151 | 3300006844 | Bacteria | 62789 |
| 167 | Ga0075428_100309916 | 3300006844 | Unclassified | 1697 |
| 168 | Ga0075431_100016333 | 3300006847 | Bacteria | 7530 |
| 169 | Ga0075433_10040529 | 3300006852 | Unclassified | 4032 |
| 170 | Ga0075433_10185874 | 3300006852 | Unclassified | 1849 |
| 171 | Ga0075433_10246838 | 3300006852 | Bacteria | 1584 |
| 172 | Ga0075433_10330181 | 3300006852 | Bacteria | 1349 |
| 173 | Ga0075433_10404056 | 3300006852 | Unclassified | 1205 |
| 174 | Ga0075434_100049482 | 3300006871 | Bacteria | 4173 |
| 175 | Ga0075434_100140982 | 3300006871 | Unclassified | 2430 |
| 176 | Ga0075434_100366536 | 3300006871 | Bacteria | 1462 |
| 177 | Ga0075436_100007209 | 3300006914 | Bacteria | 7607 |
| 178 | Ga0075436_100020773 | 3300006914 | Bacteria | 4505 |
| 179 | Ga0075436_100168628 | 3300006914 | Bacteria | 1545 |
| 180 | Ga0075435_100264013 | 3300007076 | Bacteria | 1467 |
| 181 | Ga0099794_10004597 | 3300007265 | Bacteria | 5446 |
| 182 | Ga0099794_10072169 | 3300007265 | Bacteria | 1692 |
| 183 | Ga0105240_10024032 | 3300009093 | Bacteria | 8049 |
| 184 | Ga0105240_10070304 | 3300009093 | Unclassified | 4331 |
| 185 | Ga0105240_10565591 | 3300009093 | Bacteria | 1256 |
| 186 | Ga0111539_10247061 | 3300009094 | Bacteria | 2077 |
| 187 | Ga0111539_10390434 | 3300009094 | Bacteria | 1621 |
| 188 | Ga0105245_10089412 | 3300009098 | Bacteria | 2831 |
| 189 | Ga0105245_10473576 | 3300009098 | Bacteria | 1264 |
| 190 | Ga0105247_10048085 | 3300009101 | Bacteria | 2620 |
| 191 | Ga0114129_10007038 | 3300009147 | Bacteria | 16014 |
| 192 | Ga0114129_10228739 | 3300009147 | Bacteria | 2505 |
| 193 | Ga0114129_10857768 | 3300009147 | Unclassified | 1154 |
| 194 | Ga0105243_10031948 | 3300009148 | Bacteria | 4063 |
| 195 | Ga0105243_10145478 | 3300009148 | Bacteria | 2027 |
| 196 | Ga0105243_10550859 | 3300009148 | Bacteria | 1102 |
| 197 | Ga0105241_10120622 | 3300009174 | Bacteria | 2111 |
| 198 | Ga0105242_10203436 | 3300009176 | Bacteria | 1760 |
| 199 | Ga0105242_10259286 | 3300009176 | Bacteria | 1570 |
| 200 | Ga0105248_10152852 | 3300009177 | Bacteria | 2604 |
| 201 | Ga0105248_10686478 | 3300009177 | Bacteria | 1155 |
| 202 | Ga0105237_10404254 | 3300009545 | Bacteria | 1370 |
| 203 | Ga0105237_10599584 | 3300009545 | Bacteria | 1109 |
| 204 | Ga0105238_10365078 | 3300009551 | Bacteria | 1434 |
| 205 | Ga0105239_10438009 | 3300010375 | Bacteria | 1482 |
| 206 | Ga0105246_10034156 | 3300011119 | Bacteria | 3386 |
| 207 | Ga0157371_10246857 | 3300013102 | Bacteria | 1285 |
| 208 | Ga0157370_10031786 | 3300013104 | Bacteria | 5160 |
| 209 | Ga0157370_10380818 | 3300013104 | Bacteria | 1299 |
| 210 | Ga0157369_10038511 | 3300013105 | Bacteria | 5227 |
| 211 | Ga0157369_10039679 | 3300013105 | Bacteria | 5144 |
| 212 | Ga0157369_10089298 | 3300013105 | Bacteria | 3290 |
| 213 | Ga0157374_10087923 | 3300013296 | Bacteria | 2959 |
| 214 | Ga0157374_10208348 | 3300013296 | Bacteria | 1916 |
| 215 | Ga0157378_10207435 | 3300013297 | Bacteria | 1856 |
| 216 | Ga0157378_10339211 | 3300013297 | Bacteria | 1465 |
| 217 | Ga0163162_10062342 | 3300013306 | Bacteria | 3769 |
| 218 | Ga0163162_10245708 | 3300013306 | Bacteria | 1921 |
| 219 | Ga0163162_10276719 | 3300013306 | Bacteria | 1810 |
| 220 | Ga0157372_10682782 | 3300013307 | Bacteria | 1195 |
| 221 | Ga0157375_10152897 | 3300013308 | Bacteria | 2444 |
| 222 | Ga0163163_10000034 | 3300014325 | Bacteria | 161820 |
| 223 | Ga0163163_10047822 | 3300014325 | Bacteria | 4205 |
| 224 | Ga0157377_10213063 | 3300014745 | Bacteria | 1233 |
| 225 | Ga0157379_10183089 | 3300014968 | Bacteria | 1892 |
| 226 | Ga0157376_10054572 | 3300014969 | Bacteria | 3332 |
| 227 | Ga0157376_10541289 | 3300014969 | Bacteria | 1151 |
| 228 | Ga0157376_10616354 | 3300014969 | Bacteria | 1082 |
| 229 | Ga0163161_10027115 | 3300017792 | Bacteria | 4063 |
| 230 | Ga0206356_11840338 | 3300020070 | Bacteria | 1829 |
| 231 | Ga0206349_1309353 | 3300020075 | Bacteria | 2044 |
| 232 | Ga0206350_10254859 | 3300020080 | Bacteria | 2013 |
| 233 | Ga0206354_10453000 | 3300020081 | Bacteria | 2270 |
| 234 | Ga0206353_10888380 | 3300020082 | Bacteria | 7439 |
| 235 | Ga0213873_10039467 | 3300021358 | Bacteria | 1210 |
| 236 | Ga0213876_10065874 | 3300021384 | Bacteria | 1912 |
| 237 | Ga0213875_10091986 | 3300021388 | Unclassified | 1415 |
| 238 | Ga0224712_10000892 | 3300022467 | Bacteria | 6406 |
| 239 | Ga0207692_10016470 | 3300025898 | Bacteria | 3275 |
| 240 | Ga0207692_10071707 | 3300025898 | Bacteria | 1828 |
| 241 | Ga0207710_10030887 | 3300025900 | Bacteria | 2339 |
| 242 | Ga0207688_10077873 | 3300025901 | Bacteria | 1890 |
| 243 | Ga0207647_10087913 | 3300025904 | Bacteria | 1856 |
| 244 | Ga0207685_10016920 | 3300025905 | Bacteria | 2344 |
| 245 | Ga0207685_10050289 | 3300025905 | Bacteria | 1605 |
| 246 | Ga0207699_10001466 | 3300025906 | Bacteria | 11201 |
| 247 | Ga0207699_10005243 | 3300025906 | Bacteria | 6202 |
| 248 | Ga0207699_10006418 | 3300025906 | Bacteria | 5694 |
| 249 | Ga0207699_10085456 | 3300025906 | Bacteria | 1968 |
| 250 | Ga0207643_10143791 | 3300025908 | Unclassified | 1426 |
| 251 | Ga0207705_10028451 | 3300025909 | Bacteria | 3984 |
| 252 | Ga0207705_10057578 | 3300025909 | Bacteria | 2803 |
| 253 | Ga0207684_10000005 | 3300025910 | Bacteria | 736617 |
| 254 | Ga0207684_10000014 | 3300025910 | Bacteria | 440027 |
| 255 | Ga0207684_10000166 | 3300025910 | Bacteria | 111380 |
| 256 | Ga0207684_10000357 | 3300025910 | Bacteria | 62516 |
| 257 | Ga0207684_10001388 | 3300025910 | Bacteria | 26332 |
| 258 | Ga0207684_10009940 | 3300025910 | Bacteria | 8388 |
| 259 | Ga0207684_10010593 | 3300025910 | Bacteria | 8104 |
| 260 | Ga0207684_10012110 | 3300025910 | Bacteria | 7509 |
| 261 | Ga0207684_10012919 | 3300025910 | Bacteria | 7233 |
| 262 | Ga0207684_10036668 | 3300025910 | Bacteria | 4161 |
| 263 | Ga0207684_10045761 | 3300025910 | Bacteria | 3711 |
| 264 | Ga0207684_10071316 | 3300025910 | Bacteria | 2952 |
| 265 | Ga0207684_10140541 | 3300025910 | Bacteria | 2075 |
| 266 | Ga0207707_10068223 | 3300025912 | Bacteria | 3098 |
| 267 | Ga0207695_10077299 | 3300025913 | Bacteria | 3381 |
| 268 | Ga0207695_10169846 | 3300025913 | Bacteria | 2107 |
| 269 | Ga0207695_10376759 | 3300025913 | Bacteria | 1305 |
| 270 | Ga0207693_10000091 | 3300025915 | Bacteria | 80207 |
| 271 | Ga0207693_10011806 | 3300025915 | Bacteria | 7059 |
| 272 | Ga0207693_10041710 | 3300025915 | Bacteria | 3612 |
| 273 | Ga0207693_10309129 | 3300025915 | Bacteria | 1238 |
| 274 | Ga0207693_10310742 | 3300025915 | Bacteria | 1234 |
| 275 | Ga0207663_10000173 | 3300025916 | Bacteria | 29065 |
| 276 | Ga0207663_10034382 | 3300025916 | Bacteria | 3030 |
| 277 | Ga0207663_10037089 | 3300025916 | Unclassified | 2937 |
| 278 | Ga0207663_10102142 | 3300025916 | Bacteria | 1928 |
| 279 | Ga0207657_10005560 | 3300025919 | Bacteria | 13157 |
| 280 | Ga0207657_10013761 | 3300025919 | Bacteria | 7921 |
| 281 | Ga0207649_10012124 | 3300025920 | Bacteria | 4772 |
| 282 | Ga0207652_10042325 | 3300025921 | Bacteria | 3876 |
| 283 | Ga0207652_10152807 | 3300025921 | Bacteria | 2067 |
| 284 | Ga0207652_10508187 | 3300025921 | Bacteria | 1085 |
| 285 | Ga0207646_10000054 | 3300025922 | Bacteria | 160414 |
| 286 | Ga0207646_10000113 | 3300025922 | Bacteria | 111264 |
| 287 | Ga0207646_10000350 | 3300025922 | Bacteria | 62463 |
| 288 | Ga0207646_10000583 | 3300025922 | Bacteria | 47784 |
| 289 | Ga0207646_10002921 | 3300025922 | Bacteria | 19822 |
| 290 | Ga0207646_10005533 | 3300025922 | Bacteria | 13276 |
| 291 | Ga0207646_10006166 | 3300025922 | Bacteria | 12464 |
| 292 | Ga0207646_10017322 | 3300025922 | Bacteria | 6744 |
| 293 | Ga0207646_10022624 | 3300025922 | Bacteria | 5787 |
| 294 | Ga0207646_10026838 | 3300025922 | Bacteria | 5252 |
| 295 | Ga0207646_10065604 | 3300025922 | Bacteria | 3241 |
| 296 | Ga0207646_10068868 | 3300025922 | Bacteria | 3161 |
| 297 | Ga0207646_10116933 | 3300025922 | Unclassified | 2395 |
| 298 | Ga0207646_10239813 | 3300025922 | Bacteria | 1638 |
| 299 | Ga0207694_10071188 | 3300025924 | Bacteria | 2717 |
| 300 | Ga0207694_10327482 | 3300025924 | Bacteria | 1265 |
| 301 | Ga0207650_10005827 | 3300025925 | Bacteria | 8406 |
| 302 | Ga0207659_10464862 | 3300025926 | Bacteria | 1067 |
| 303 | Ga0207687_10174930 | 3300025927 | Unclassified | 1659 |
| 304 | Ga0207700_10000239 | 3300025928 | Bacteria | 32830 |
| 305 | Ga0207700_10034013 | 3300025928 | Bacteria | 3654 |
| 306 | Ga0207700_10123913 | 3300025928 | Bacteria | 2099 |
| 307 | Ga0207700_10244804 | 3300025928 | Bacteria | 1530 |
| 308 | Ga0207664_10021500 | 3300025929 | Bacteria | 4799 |
| 309 | Ga0207664_10033078 | 3300025929 | Bacteria | 3969 |
| 310 | Ga0207664_10045665 | 3300025929 | Unclassified | 3436 |
| 311 | Ga0207664_10270614 | 3300025929 | Unclassified | 1488 |
| 312 | Ga0207690_10059688 | 3300025932 | Bacteria | 2585 |
| 313 | Ga0207686_10082269 | 3300025934 | Bacteria | 2104 |
| 314 | Ga0207709_10015039 | 3300025935 | Bacteria | 4285 |
| 315 | Ga0207670_10075487 | 3300025936 | Bacteria | 2343 |
| 316 | Ga0207669_10082032 | 3300025937 | Bacteria | 2069 |
| 317 | Ga0207665_10002719 | 3300025939 | Bacteria | 11863 |
| 318 | Ga0207665_10003816 | 3300025939 | Bacteria | 10071 |
| 319 | Ga0207665_10009273 | 3300025939 | Bacteria | 6462 |
| 320 | Ga0207665_10021960 | 3300025939 | Bacteria | 4196 |
| 321 | Ga0207665_10075183 | 3300025939 | Bacteria | 2313 |
| 322 | Ga0207665_10095027 | 3300025939 | Bacteria | 2071 |
| 323 | Ga0207665_10265026 | 3300025939 | Bacteria | 1274 |
| 324 | Ga0207689_10003693 | 3300025942 | Bacteria | 13951 |
| 325 | Ga0207661_10026540 | 3300025944 | Bacteria | 4414 |
| 326 | Ga0207712_10115865 | 3300025961 | Bacteria | 2018 |
| 327 | Ga0207668_10146803 | 3300025972 | Bacteria | 1821 |
| 328 | Ga0207658_10271572 | 3300025986 | Bacteria | 1450 |
| 329 | Ga0207677_10230606 | 3300026023 | Bacteria | 1491 |
| 330 | Ga0207639_10092547 | 3300026041 | Bacteria | 2423 |
| 331 | Ga0207678_10002072 | 3300026067 | Bacteria | 18180 |
| 332 | Ga0207702_10079191 | 3300026078 | Bacteria | 2847 |
| 333 | Ga0207702_10470281 | 3300026078 | Bacteria | 1222 |
| 334 | Ga0207648_10147145 | 3300026089 | Bacteria | 2078 |
| 335 | Ga0207676_10176950 | 3300026095 | Bacteria | 1864 |
| 336 | Ga0207674_10019122 | 3300026116 | Bacteria | 7425 |
| 337 | Ga0207674_10056349 | 3300026116 | Bacteria | 3992 |
| 338 | Ga0207674_10547810 | 3300026116 | Bacteria | 1117 |
| 339 | Ga0207675_100015520 | 3300026118 | Bacteria | 7105 |
| 340 | Ga0207675_100340069 | 3300026118 | Bacteria | 1469 |
| 341 | Ga0207683_10003128 | 3300026121 | Bacteria | 14460 |
| 342 | Ga0207683_10005655 | 3300026121 | Bacteria | 10720 |
| 343 | Ga0207683_10255069 | 3300026121 | Bacteria | 1601 |
| 344 | Ga0207698_10202990 | 3300026142 | Unclassified | 1777 |
| 345 | Ga0207698_10433686 | 3300026142 | Bacteria | 1264 |
| 346 | Ga0268266_10000241 | 3300028379 | Bacteria | 92939 |
| 347 | Ga0268266_10413628 | 3300028379 | Bacteria | 1277 |
| 348 | Ga0265337_1000777 | 3300028556 | Bacteria | 16812 |
| 349 | Ga0265337_1013840 | 3300028556 | Bacteria | 2692 |
| 350 | Ga0265334_10071062 | 3300028573 | Bacteria | 1296 |
| 351 | Ga0265318_10049234 | 3300028577 | Bacteria | 1585 |
| 352 | Ga0265336_10008042 | 3300028666 | Bacteria | 3720 |
| 353 | Ga0265338_10000830 | 3300028800 | Bacteria | 52102 |
| 354 | Ga0265338_10014824 | 3300028800 | Bacteria | 8626 |
| 355 | Ga0265338_10074082 | 3300028800 | Bacteria | 2898 |
| 356 | Ga0265338_10096909 | 3300028800 | Bacteria | 2418 |
| 357 | Ga0265338_10099307 | 3300028800 | Bacteria | 2378 |
| 358 | Ga0265338_10299109 | 3300028800 | Bacteria | 1170 |
| 359 | Ga0265338_10347853 | 3300028800 | Unclassified | 1067 |
| 360 | Ga0265324_10017492 | 3300029957 | Bacteria | 2607 |
| 361 | Ga0265324_10017848 | 3300029957 | Bacteria | 2577 |
| 362 | Ga0265760_10040336 | 3300031090 | Bacteria | 1391 |
| 363 | Ga0265330_10006995 | 3300031235 | Bacteria | 5536 |
| 364 | Ga0265330_10044768 | 3300031235 | Bacteria | 1953 |
| 365 | Ga0265320_10000242 | 3300031240 | Bacteria | 45162 |
| 366 | Ga0265320_10022604 | 3300031240 | Bacteria | 3361 |
| 367 | Ga0265320_10031173 | 3300031240 | Bacteria | 2741 |
| 368 | Ga0265320_10032279 | 3300031240 | Bacteria | 2683 |
| 369 | Ga0265325_10000538 | 3300031241 | Bacteria | 27483 |
| 370 | Ga0265325_10007316 | 3300031241 | Bacteria | 6618 |
| 371 | Ga0265329_10043735 | 3300031242 | Bacteria | 1432 |
| 372 | Ga0265340_10025983 | 3300031247 | Bacteria | 2963 |
| 373 | Ga0265340_10034948 | 3300031247 | Bacteria | 2497 |
| 374 | Ga0265340_10099170 | 3300031247 | Unclassified | 1355 |
| 375 | Ga0265339_10000350 | 3300031249 | Bacteria | 36667 |
| 376 | Ga0265339_10091780 | 3300031249 | Bacteria | 1591 |
| 377 | Ga0265339_10101484 | 3300031249 | Bacteria | 1497 |
| 378 | Ga0265331_10012584 | 3300031250 | Bacteria | 4576 |
| 379 | Ga0265331_10091710 | 3300031250 | Unclassified | 1403 |
| 380 | Ga0265327_10002340 | 3300031251 | Bacteria | 20214 |
| 381 | Ga0265327_10003849 | 3300031251 | Bacteria | 13861 |
| 382 | Ga0265316_10000706 | 3300031344 | Bacteria | 36971 |
| 383 | Ga0265316_10003202 | 3300031344 | Bacteria | 16637 |
| 384 | Ga0265316_10054150 | 3300031344 | Bacteria | 3141 |
| 385 | Ga0265313_10000142 | 3300031595 | Bacteria | 74294 |
| 386 | Ga0316579_10001589 | 3300031691 | Bacteria | 8298 |
| 387 | Ga0265314_10001717 | 3300031711 | Bacteria | 23774 |
| 388 | Ga0265314_10003842 | 3300031711 | Bacteria | 14324 |
| 389 | Ga0265314_10186544 | 3300031711 | Unclassified | 1238 |
| 390 | Ga0265342_10029830 | 3300031712 | Bacteria | 3384 |
| 391 | Ga0316578_10050760 | 3300031728 | Bacteria | 2427 |
| 392 | Ga0307410_10002640 | 3300031852 | Bacteria | 8736 |
| 393 | Ga0307416_100002595 | 3300032002 | Bacteria | 10433 |
| 394 | Ga0307416_100369901 | 3300032002 | Bacteria | 1459 |
| 395 | Ga0373948_0020360 | 3300034817 | Bacteria | 1263 |
| 396 | Ga0373926_0021797 | 3300035083 | Bacteria | 2219 |
| 397 | Ga0373926_0024226 | 3300035083 | Bacteria | 2112 |
| 398 | Ga0373944_0000594 | 3300035089 | Bacteria | 8596 |
| 399 | Ga0373945_0000010 | 3300035116 | Bacteria | 41491 |
| 400 | Ga0373943_0002157 | 3300035170 | Bacteria | 8947 |
| 401 | Ga0373943_0009057 | 3300035170 | Bacteria | 4463 |
| 402 | Ga0373946_0000330 | 3300035171 | Bacteria | 15358 |
| 403 | Ga0373955_0030722 | 3300035172 | Bacteria | 2808 |
| 404 | Ga0373955_0112112 | 3300035172 | Bacteria | 1578 |
| 405 | Ga0373924_0024766 | 3300035410 | Bacteria | 2367 |
| 406 | Ga0373931_0027108 | 3300035691 | Bacteria | 2921 |
| 407 | Ga0373931_0078035 | 3300035691 | Bacteria | 1821 |
| 408 | Ga0373935_0036921 | 3300035692 | Bacteria | 3056 |
| 409 | Ga0373935_0117800 | 3300035692 | Bacteria | 1770 |
| 410 | Ga0373927_0011110 | 3300035695 | Bacteria | 5997 |
| 411 | Ga0373927_0034426 | 3300035695 | Bacteria | 3294 |
| 412 | Ga0373933_0024052 | 3300035724 | Bacteria | 3486 |
| 413 | Ga0373947_0001234 | 3300035725 | Bacteria | 15729 |
| 414 | Ga0373947_0002280 | 3300035725 | Bacteria | 11593 |
| 415 | Ga0373947_0072423 | 3300035725 | Unclassified | 2116 |
| 416 | Ga0373937_0156020 | 3300036401 | Bacteria | 2139 |
| 417 | Ga0373925_0001250 | 3300037068 | Bacteria | 22415 |
| 418 | Ga0373925_0019060 | 3300037068 | Bacteria | 4988 |
| 419 | Ga0373925_0060929 | 3300037068 | Unclassified | 2834 |
| 420 | Ga0373925_0189052 | 3300037068 | Bacteria | 1633 |
| 421 | Ga0373925_0324360 | 3300037068 | Bacteria | 1247 |
| 422 | Ga0395899_0076799 | 3300037312 | Bacteria | 2438 |
| 423 | Ga0395899_0110669 | 3300037312 | Unclassified | 1975 |
| 424 | Ga0395898_0062004 | 3300037466 | Bacteria | 3632 |
| 425 | Ga0395905_0015220 | 3300037471 | Bacteria | 7315 |
| 426 | Ga0395905_0419413 | 3300037471 | Unclassified | 1234 |
| 427 | Ga0436364_0757267 | 3300037853 | Bacteria | 15097 |
| 428 | Ga0395901_0551059 | 3300038443 | Unclassified | 1169 |
| 429 | Ga0400489_28569 | 3300039093 | Archaea | 1878 |
| 430 | Ga0436365_0127369 | 3300039437 | Unclassified | 1970 |
| 431 | Ga0436365_0610234 | 3300039437 | Bacteria | 4952 |
| 432 | Ga0436365_0950920 | 3300039437 | Bacteria | 1908 |
| 433 | Ga0436365_1773926 | 3300039437 | Bacteria | 5608 |
| 434 | Ga0436363_0303774 | 3300039450 | Bacteria | 7764 |
| 435 | Ga0436363_0624304 | 3300039450 | Bacteria | 9320 |
| 436 | Ga0436362_0749635 | 3300039453 | Bacteria | 1496 |
| 437 | Ga0436362_1085911 | 3300039453 | Bacteria | 1241 |
| 438 | Ga0451577_0001538 | 3300042876 | Bacteria | 30262 |
| 439 | Ga0451577_0078980 | 3300042876 | Bacteria | 2933 |
| 440 | Ga0451577_0155668 | 3300042876 | Bacteria | 2057 |
| 441 | Ga0466969_0067262 | 3300044656 | Bacteria | 1729 |
| 442 | Ga0453683_0011755 | 3300044673 | Bacteria | 5764 |
| 443 | Ga0466963_0007334 | 3300044694 | Bacteria | 6570 |
| 444 | Ga0453684_0001274 | 3300044712 | Bacteria | 75355 |
| 445 | Ga0453684_0001763 | 3300044712 | Bacteria | 57728 |
| 446 | Ga0453684_0002381 | 3300044712 | Bacteria | 45887 |
| 447 | Ga0453684_0002426 | 3300044712 | Bacteria | 45351 |
| 448 | Ga0453684_0002930 | 3300044712 | Bacteria | 40014 |
| 449 | Ga0453684_0006387 | 3300044712 | Bacteria | 22454 |
| 450 | Ga0453684_0015242 | 3300044712 | Bacteria | 12190 |
| 451 | Ga0453684_0026747 | 3300044712 | Bacteria | 8315 |
| 452 | Ga0453684_0036894 | 3300044712 | Bacteria | 6724 |
| 453 | Ga0453684_0058479 | 3300044712 | Bacteria | 4979 |
| 454 | Ga0453684_0175839 | 3300044712 | Bacteria | 2518 |
| 455 | Ga0453684_0375199 | 3300044712 | Bacteria | 1598 |
| 456 | Ga0453684_0667497 | 3300044712 | Bacteria | 1133 |
| 457 | Ga0466968_0010067 | 3300044735 | Bacteria | 3655 |
| 458 | Ga0466957_0008051 | 3300044842 | Bacteria | 5979 |
| 459 | Ga0466959_0021507 | 3300045049 | Bacteria | 4758 |
| 460 | Ga0451576_0005212 | 3300045051 | Bacteria | 16419 |
| 461 | Ga0451576_0011246 | 3300045051 | Bacteria | 10189 |
| 462 | Ga0451576_0122333 | 3300045051 | Bacteria | 2710 |
| 463 | Ga0451576_0351792 | 3300045051 | Unclassified | 1542 |
| 464 | Ga0451576_0514924 | 3300045051 | Bacteria | 1257 |
| 465 | Ga0466958_0029234 | 3300045836 | Bacteria | 3270 |
| 466 | Ga0466958_0185254 | 3300045836 | Bacteria | 1322 |
| 467 | Ga0466967_0051411 | 3300045976 | Bacteria | 3611 |
| 468 | Ga0466967_0346793 | 3300045976 | Bacteria | 1437 |
| 469 | Ga0495629_0048763 | 3300046459 | Unclassified | 2969 |
| 470 | Ga0495629_0061609 | 3300046459 | Bacteria | 2622 |
| 471 | Ga0495653_0002194 | 3300046463 | Bacteria | 15445 |
| 472 | Ga0495653_0003548 | 3300046463 | Bacteria | 12565 |
| 473 | Ga0495653_0075124 | 3300046463 | Bacteria | 2516 |
| 474 | Ga0495580_0006177 | 3300046472 | Bacteria | 9791 |
| 475 | Ga0495580_0031364 | 3300046472 | Bacteria | 3841 |
| 476 | Ga0495582_0074040 | 3300046473 | Bacteria | 1885 |
| 477 | Ga0495639_0022713 | 3300046475 | Bacteria | 2753 |
| 478 | Ga0495584_0130044 | 3300046491 | Bacteria | 1277 |
| 479 | Ga0495608_0030580 | 3300046511 | Bacteria | 3645 |
| 480 | Ga0495608_0085910 | 3300046511 | Bacteria | 2039 |
| 481 | Ga0495618_0028612 | 3300046514 | Bacteria | 3474 |
| 482 | Ga0495628_0019552 | 3300046516 | Bacteria | 5597 |
| 483 | Ga0495628_0021920 | 3300046516 | Bacteria | 5250 |
| 484 | Ga0495628_0111398 | 3300046516 | Bacteria | 2105 |
| 485 | Ga0495630_0000305 | 3300046517 | Bacteria | 39378 |
| 486 | Ga0495630_0047439 | 3300046517 | Bacteria | 3213 |
| 487 | Ga0495666_0015470 | 3300046526 | Unclassified | 3798 |
| 488 | Ga0495666_0049120 | 3300046526 | Bacteria | 2030 |
| 489 | Ga0495666_0147778 | 3300046526 | Unclassified | 1094 |
| 490 | Ga0495652_0031195 | 3300046529 | Bacteria | 4669 |
| 491 | Ga0495652_0191762 | 3300046529 | Bacteria | 1559 |
| 492 | Ga0495652_0306915 | 3300046529 | Bacteria | 1151 |
| 493 | Ga0495652_0342958 | 3300046529 | Bacteria | 1073 |
| 494 | Ga0495665_0008974 | 3300046531 | Bacteria | 5425 |
| 495 | Ga0495665_0066442 | 3300046531 | Bacteria | 1903 |
| 496 | Ga0495640_0005886 | 3300046533 | Bacteria | 9724 |
| 497 | Ga0495640_0062811 | 3300046533 | Unclassified | 2518 |
| 498 | Ga0495640_0082906 | 3300046533 | Bacteria | 2128 |
| 499 | Ga0495586_0000271 | 3300046535 | Bacteria | 33410 |
| 500 | Ga0495587_0102507 | 3300046536 | Bacteria | 1647 |
| 501 | Ga0495587_0167616 | 3300046536 | Bacteria | 1248 |
| 502 | Ga0495645_0016127 | 3300046543 | Bacteria | 5325 |
| 503 | Ga0495645_0053396 | 3300046543 | Bacteria | 2938 |
| 504 | Ga0495667_0004069 | 3300046559 | Bacteria | 9827 |
| 505 | Ga0495667_0052667 | 3300046559 | Bacteria | 2680 |
| 506 | Ga0495667_0186630 | 3300046559 | Bacteria | 1329 |
| 507 | Ga0495634_0033832 | 3300046642 | Bacteria | 3510 |
| 508 | Ga0495635_0000459 | 3300046663 | Bacteria | 25781 |
| 509 | Ga0495635_0039739 | 3300046663 | Bacteria | 3253 |
| 510 | Ga0495657_0014756 | 3300046675 | Bacteria | 5734 |
| 511 | Ga0495657_0156632 | 3300046675 | Bacteria | 1411 |
| 512 | Ga0495599_0049095 | 3300046678 | Bacteria | 2645 |
| 513 | Ga0495599_0106009 | 3300046678 | Bacteria | 1751 |
| 514 | Ga0495599_0118814 | 3300046678 | Bacteria | 1643 |
| 515 | Ga0495646_0214689 | 3300046680 | Unclassified | 1042 |
| 516 | Ga0495658_0035953 | 3300046683 | Unclassified | 2729 |
| 517 | Ga0495613_0016898 | 3300046689 | Bacteria | 5433 |
| 518 | Ga0495613_0046391 | 3300046689 | Unclassified | 3213 |
| 519 | Ga0495624_0006532 | 3300046690 | Bacteria | 8264 |
| 520 | Ga0495581_0029249 | 3300047315 | Bacteria | 3194 |
| 521 | Ga0495581_0197327 | 3300047315 | Bacteria | 1177 |
| 522 | Ga0495604_0000834 | 3300047317 | Bacteria | 25747 |
| 523 | Ga0495674_0000767 | 3300047319 | Bacteria | 30476 |
| 524 | Ga0495674_0006061 | 3300047319 | Bacteria | 11602 |
| 525 | Ga0495674_0137390 | 3300047319 | Bacteria | 2056 |
| 526 | Ga0495674_0231375 | 3300047319 | Bacteria | 1525 |
| 527 | Ga0495676_0011793 | 3300047321 | Bacteria | 7883 |
| 528 | Ga0495676_0021657 | 3300047321 | Bacteria | 5608 |
| 529 | Ga0495676_0036383 | 3300047321 | Bacteria | 4112 |
| 530 | Ga0495680_0035336 | 3300047322 | Bacteria | 4026 |
| 531 | Ga0495680_0230638 | 3300047322 | Bacteria | 1318 |
| 532 | Ga0495675_0035000 | 3300047444 | Bacteria | 3207 |
| 533 | Ga0495675_0153935 | 3300047444 | Bacteria | 1419 |
| 534 | Ga0495684_0003770 | 3300047471 | Bacteria | 11833 |
| 535 | Ga0495684_0099607 | 3300047471 | Bacteria | 2197 |
| 536 | Ga0495593_0033987 | 3300047673 | Bacteria | 2775 |
| 537 | Ga0496101_0454596 | 3300048904 | Bacteria | 1010 |
| 538 | Ga0496102_0069465 | 3300048905 | Bacteria | 3233 |
| 539 | Ga0496102_0151747 | 3300048905 | Bacteria | 2177 |
| 540 | Ga0496102_0254320 | 3300048905 | Bacteria | 1656 |
| 541 | Ga0496105_0015428 | 3300048908 | Bacteria | 6088 |
| 542 | Ga0496105_0210462 | 3300048908 | Bacteria | 1585 |
| 543 | Ga0496105_0246506 | 3300048908 | Bacteria | 1448 |
| 544 | Ga0496107_0067737 | 3300048910 | Bacteria | 2590 |
| 545 | Ga0496107_0278413 | 3300048910 | Bacteria | 1245 |
| 546 | Ga0496108_0163002 | 3300048911 | Bacteria | 1927 |
| 547 | Ga0496109_0008477 | 3300048912 | Bacteria | 8740 |
| 548 | Ga0496109_0178046 | 3300048912 | Bacteria | 1996 |
| 549 | Ga0496110_0137495 | 3300048913 | Bacteria | 2208 |
| 550 | Ga0496110_0326152 | 3300048913 | Bacteria | 1398 |
| 551 | Ga0496110_0349060 | 3300048913 | Bacteria | 1348 |
| 552 | Ga0496111_0005569 | 3300048914 | Bacteria | 8093 |
| 553 | Ga0496112_0197487 | 3300048915 | Bacteria | 1972 |
| 554 | Ga0496113_0101478 | 3300048916 | Bacteria | 2230 |
| 555 | Ga0496113_0256597 | 3300048916 | Bacteria | 1396 |
| 556 | Ga0496113_0328366 | 3300048916 | Bacteria | 1226 |
| 557 | Ga0496114_0043817 | 3300048917 | Bacteria | 3711 |
| 558 | Ga0496114_0062181 | 3300048917 | Bacteria | 3125 |
| 559 | Ga0496114_0125118 | 3300048917 | Bacteria | 2215 |
| 560 | Ga0496114_0138194 | 3300048917 | Bacteria | 2108 |
| 561 | Ga0496115_0098433 | 3300048918 | Bacteria | 2395 |
| 562 | Ga0496115_0224718 | 3300048918 | Unclassified | 1549 |
| 563 | Ga0501031_0009421 | 3300049568 | Bacteria | 6346 |
| 564 | Ga0501032_0016268 | 3300049569 | Bacteria | 5234 |
| 565 | Ga0501036_0055268 | 3300049572 | Unclassified | 3363 |
| 566 | Ga0501036_0208795 | 3300049572 | Bacteria | 1641 |
| 567 | Ga0501040_0010167 | 3300049576 | Bacteria | 6151 |
| 568 | Ga0501040_0095986 | 3300049576 | Unclassified | 2064 |
| 569 | Ga0501042_0004880 | 3300049578 | Bacteria | 8579 |
| 570 | Ga0501042_0335308 | 3300049578 | Bacteria | 1093 |
| 571 | Ga0501046_0173074 | 3300049580 | Bacteria | 1619 |
| 572 | Ga0501048_0380351 | 3300049582 | Unclassified | 1008 |
| 573 | Ga0501068_0037696 | 3300049584 | Bacteria | 2894 |
| 574 | Ga0501070_0006969 | 3300049586 | Bacteria | 9613 |
| 575 | Ga0501070_0436448 | 3300049586 | Bacteria | 1057 |
| 576 | Ga0501071_0074543 | 3300049587 | Bacteria | 2477 |
| 577 | Ga0501072_0068792 | 3300049588 | Bacteria | 2794 |
| 578 | Ga0501072_0140359 | 3300049588 | Unclassified | 1926 |
| 579 | Ga0501074_0176219 | 3300049590 | Unclassified | 1526 |
| 580 | Ga0501075_0253718 | 3300049591 | Unclassified | 1341 |
| 581 | Ga0501076_0236546 | 3300049592 | Bacteria | 1493 |
| 582 | Ga0501077_0061645 | 3300049593 | Bacteria | 2380 |
| 583 | Ga0501079_0164090 | 3300049741 | Bacteria | 1732 |
| 584 | Ga0501080_0024362 | 3300049742 | Bacteria | 5610 |
| 585 | Ga0501080_0184341 | 3300049742 | Unclassified | 1920 |
| 586 | Ga0501044_0045348 | 3300049823 | Bacteria | 4555 |
| 587 | Ga0501045_0008806 | 3300049824 | Bacteria | 7046 |
| 588 | Ga0501045_0122212 | 3300049824 | Unclassified | 1933 |
| 589 | Ga0501045_0331141 | 3300049824 | Bacteria | 1133 |
| 590 | nmdc:mga06z11_30421_c1 | 3300050494 | Bacteria | 2612 |
| 591 | nmdc:mga06z11_72581_c1 | 3300050494 | Bacteria | 1825 |
| 592 | nmdc:mga04h51_15389_c1 | 3300050495 | Unclassified | 2203 |
| 593 | nmdc:mga05p37_237934_c1 | 3300050507 | Bacteria | 2191 |
| 594 | nmdc:mga06r32_138714_c1 | 3300050510 | Bacteria | 2407 |
| 595 | nmdc:mga08y16_223347_c1 | 3300050511 | Bacteria | 1949 |
| 596 | nmdc:mga08y16_47847_c1 | 3300050511 | Unclassified | 4476 |
| 597 | nmdc:mga0n895_155624_c1 | 3300050512 | Bacteria | 2316 |
| 598 | nmdc:mga0n895_281135_c1 | 3300050512 | Unclassified | 1688 |
| 599 | nmdc:mga0n895_374689_c1 | 3300050512 | Bacteria | 1441 |
| 600 | nmdc:mga0n895_468755_c1 | 3300050512 | Unclassified | 1270 |
| 601 | nmdc:mga0rr50_173255_c1 | 3300050513 | Bacteria | 1760 |
| 602 | nmdc:mga08x19_101180_c1 | 3300050514 | Bacteria | 1912 |
| 603 | nmdc:mga08x19_134_c1 | 3300050514 | Bacteria | 65861 |
| 604 | nmdc:mga08x19_137080_c1 | 3300050514 | Bacteria | 1651 |
| 605 | nmdc:mga08x19_139514_c1 | 3300050514 | Bacteria | 1637 |
| 606 | nmdc:mga08x19_141072_c1 | 3300050514 | Bacteria | 1628 |
| 607 | nmdc:mga08x19_27535_c1 | 3300050514 | Bacteria | 3555 |
| 608 | nmdc:mga0a205_181634_c1 | 3300050515 | Bacteria | 1998 |
| 609 | nmdc:mga0a205_77014_c1 | 3300050515 | Unclassified | 3223 |
| 610 | Ga0495601_0037940 | 3300053077 | Bacteria | 3012 |
| 611 | Ga0495655_0001038 | 3300053083 | Bacteria | 4289 |
| 612 | Ga0495595_0057117 | 3300053084 | Bacteria | 1820 |
| 613 | Ga0495619_0010569 | 3300053085 | Bacteria | 5809 |
| 614 | Ga0495619_0032127 | 3300053085 | Bacteria | 3405 |
| 615 | Ga0501082_0176512 | 3300060353 | Unclassified | 1857 |
| 616 | Ga0501082_0233295 | 3300060353 | Bacteria | 1601 |
| 617 | Ga0466962_0007829 | 3300061719 | Bacteria | 5124 |
| 618 | Ga0466962_0030545 | 3300061719 | Bacteria | 2581 |
| 619 | Ga0530510_0008203 | 3300061734 | Bacteria | 7285 |
| 620 | Ga0530510_0166850 | 3300061734 | Bacteria | 1630 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_0551059 | Ga0395901_0551059_33_839 | 262 |
| 2 | 3300046472 | Ga0495580_0006177 | Ga0495580_0006177_3743_4567 | 264 |
| 3 | 3300046526 | Ga0495666_0147778 | Ga0495666_0147778_211_1035 | 264 |
| 4 | 3300049582 | Ga0501048_0380351 | Ga0501048_0380351_141_956 | 267 |
| 5 | 3300049590 | Ga0501074_0176219 | Ga0501074_0176219_700_1515 | 267 |
| 6 | 3300005445 | Ga0070708_100531761 | Ga0070708_1005317612 | 272 |
| 7 | 3300028800 | Ga0265338_10014824 | Ga0265338_100148242 | 272 |
| 8 | 3300006852 | Ga0075433_10330181 | Ga0075433_103301811 | 277 |
| 9 | 3300045051 | Ga0451576_0351792 | Ga0451576_0351792_573_1514 | 281 |
| 10 | 3300005329 | Ga0070683_100239336 | Ga0070683_1002393361 | 284 |
| 11 | 3300049824 | Ga0501045_0331141 | Ga0501045_0331141_117_1046 | 285 |
| 12 | 3300005937 | Ga0081455_10221953 | Ga0081455_102219531 | 286 |
| 13 | 3300025910 | Ga0207684_10012919 | Ga0207684_100129195 | 286 |
| 14 | 3300020075 | Ga0206349_1309353 | Ga0206349_13093533 | 291 |
| 15 | 3300039093 | Ga0400489_28569 | Ga0400489_28569_163_1104 | 291 |
| 16 | 3300037312 | Ga0395899_0076799 | Ga0395899_0076799_278_1174 | 292 |
| 17 | 3300037466 | Ga0395898_0062004 | Ga0395898_0062004_1948_2844 | 292 |
| 18 | 3300037471 | Ga0395905_0015220 | Ga0395905_0015220_4566_5462 | 292 |
| 19 | 3300006042 | Ga0075368_10027159 | Ga0075368_100271592 | 293 |
| 20 | 3300006178 | Ga0075367_10024787 | Ga0075367_100247872 | 293 |
| 21 | 3300006178 | Ga0075367_10056488 | Ga0075367_100564883 | 293 |
| 22 | 3300009147 | Ga0114129_10228739 | Ga0114129_102287393 | 293 |
| 23 | 3300031251 | Ga0265327_10002340 | Ga0265327_100023406 | 293 |
| 24 | 3300049569 | Ga0501032_0016268 | Ga0501032_0016268_3137_4060 | 293 |
| 25 | 3300049584 | Ga0501068_0037696 | Ga0501068_0037696_1569_2474 | 293 |
| 26 | 3300049586 | Ga0501070_0006969 | Ga0501070_0006969_5114_6037 | 293 |
| 27 | 3300049823 | Ga0501044_0045348 | Ga0501044_0045348_3160_4083 | 293 |
| 28 | 3300050494 | nmdc:mga06z11_30421_c1 | nmdc:mga06z11_30421_c1_1280_2284 | 293 |
| 29 | 3300050494 | nmdc:mga06z11_72581_c1 | nmdc:mga06z11_72581_c1_828_1760 | 293 |
| 30 | 3300050495 | nmdc:mga04h51_15389_c1 | nmdc:mga04h51_15389_c1_468_1400 | 293 |
| 31 | 3300005518 | Ga0070699_100026247 | Ga0070699_1000262474 | 294 |
| 32 | 3300005356 | Ga0070674_100139231 | Ga0070674_1001392312 | 295 |
| 33 | 3300005445 | Ga0070708_100152011 | Ga0070708_1001520112 | 295 |
| 34 | 3300005456 | Ga0070678_100496297 | Ga0070678_1004962971 | 295 |
| 35 | 3300005615 | Ga0070702_100029858 | Ga0070702_1000298583 | 295 |
| 36 | 3300006914 | Ga0075436_100020773 | Ga0075436_1000207736 | 295 |
| 37 | 3300009148 | Ga0105243_10145478 | Ga0105243_101454782 | 295 |
| 38 | 3300013306 | Ga0163162_10062342 | Ga0163162_100623423 | 295 |
| 39 | 3300013308 | Ga0157375_10152897 | Ga0157375_101528973 | 295 |
| 40 | 3300025906 | Ga0207699_10085456 | Ga0207699_100854562 | 295 |
| 41 | 3300025934 | Ga0207686_10082269 | Ga0207686_100822692 | 295 |
| 42 | 3300025972 | Ga0207668_10146803 | Ga0207668_101468032 | 295 |
| 43 | 3300026121 | Ga0207683_10255069 | Ga0207683_102550692 | 295 |
| 44 | 3300042876 | Ga0451577_0001538 | Ga0451577_0001538_752_1693 | 295 |
| 45 | 3300044712 | Ga0453684_0002381 | Ga0453684_0002381_759_1700 | 295 |
| 46 | 3300045976 | Ga0466967_0346793 | Ga0466967_0346793_426_1334 | 295 |
| 47 | 3300048917 | Ga0496114_0062181 | Ga0496114_0062181_632_1561 | 295 |
| 48 | 3300049578 | Ga0501042_0335308 | Ga0501042_0335308_100_1035 | 295 |
| 49 | 3300049587 | Ga0501071_0074543 | Ga0501071_0074543_47_982 | 295 |
| 50 | 3300049591 | Ga0501075_0253718 | Ga0501075_0253718_362_1297 | 295 |
| 51 | 3300049593 | Ga0501077_0061645 | Ga0501077_0061645_869_1804 | 295 |
| 52 | 3300050514 | nmdc:mga08x19_27535_c1 | nmdc:mga08x19_27535_c1_752_1663 | 295 |
| 53 | 3300060353 | Ga0501082_0233295 | Ga0501082_0233295_520_1455 | 295 |
| 54 | 3300005840 | Ga0068870_10017164 | Ga0068870_100171641 | 296 |
| 55 | 3300006914 | Ga0075436_100168628 | Ga0075436_1001686282 | 296 |
| 56 | 3300014325 | Ga0163163_10000034 | Ga0163163_10000034130 | 296 |
| 57 | 3300014969 | Ga0157376_10541289 | Ga0157376_105412891 | 296 |
| 58 | 3300025908 | Ga0207643_10143791 | Ga0207643_101437912 | 296 |
| 59 | 3300045051 | Ga0451576_0011246 | Ga0451576_0011246_5855_6760 | 296 |
| 60 | 3300048917 | Ga0496114_0138194 | Ga0496114_0138194_85_990 | 296 |
| 61 | 3300049572 | Ga0501036_0055268 | Ga0501036_0055268_1098_2012 | 296 |
| 62 | 3300049576 | Ga0501040_0095986 | Ga0501040_0095986_635_1549 | 296 |
| 63 | 3300049580 | Ga0501046_0173074 | Ga0501046_0173074_638_1552 | 296 |
| 64 | 3300049588 | Ga0501072_0140359 | Ga0501072_0140359_787_1701 | 296 |
| 65 | 3300049742 | Ga0501080_0184341 | Ga0501080_0184341_288_1202 | 296 |
| 66 | 3300049824 | Ga0501045_0122212 | Ga0501045_0122212_1001_1915 | 296 |
| 67 | 3300050514 | nmdc:mga08x19_141072_c1 | nmdc:mga08x19_141072_c1_189_1103 | 296 |
| 68 | 3300060353 | Ga0501082_0176512 | Ga0501082_0176512_74_988 | 296 |
| 69 | 3300005436 | Ga0070713_100041199 | Ga0070713_1000411993 | 297 |
| 70 | 3300005440 | Ga0070705_100002171 | Ga0070705_1000021712 | 297 |
| 71 | 3300005440 | Ga0070705_100025777 | Ga0070705_1000257772 | 297 |
| 72 | 3300005444 | Ga0070694_100258633 | Ga0070694_1002586332 | 297 |
| 73 | 3300005445 | Ga0070708_100000079 | Ga0070708_10000007954 | 297 |
| 74 | 3300005445 | Ga0070708_100010469 | Ga0070708_1000104693 | 297 |
| 75 | 3300005445 | Ga0070708_100016299 | Ga0070708_1000162996 | 297 |
| 76 | 3300005445 | Ga0070708_100082894 | Ga0070708_1000828943 | 297 |
| 77 | 3300005445 | Ga0070708_100151108 | Ga0070708_1001511082 | 297 |
| 78 | 3300005467 | Ga0070706_100000056 | Ga0070706_10000005647 | 297 |
| 79 | 3300005467 | Ga0070706_100000275 | Ga0070706_10000027554 | 297 |
| 80 | 3300005467 | Ga0070706_100000738 | Ga0070706_1000007389 | 297 |
| 81 | 3300005467 | Ga0070706_100002547 | Ga0070706_1000025478 | 297 |
| 82 | 3300005467 | Ga0070706_100143332 | Ga0070706_1001433322 | 297 |
| 83 | 3300005468 | Ga0070707_100000177 | Ga0070707_10000017720 | 297 |
| 84 | 3300005468 | Ga0070707_100017656 | Ga0070707_1000176564 | 297 |
| 85 | 3300005468 | Ga0070707_100020001 | Ga0070707_1000200019 | 297 |
| 86 | 3300005468 | Ga0070707_100076148 | Ga0070707_1000761483 | 297 |
| 87 | 3300005468 | Ga0070707_100109421 | Ga0070707_1001094212 | 297 |
| 88 | 3300005468 | Ga0070707_100157502 | Ga0070707_1001575022 | 297 |
| 89 | 3300005468 | Ga0070707_100305320 | Ga0070707_1003053202 | 297 |
| 90 | 3300005471 | Ga0070698_100001003 | Ga0070698_10000100311 | 297 |
| 91 | 3300005471 | Ga0070698_100004255 | Ga0070698_1000042554 | 297 |
| 92 | 3300005471 | Ga0070698_100049858 | Ga0070698_1000498582 | 297 |
| 93 | 3300005471 | Ga0070698_100097832 | Ga0070698_1000978323 | 297 |
| 94 | 3300005471 | Ga0070698_100153543 | Ga0070698_1001535432 | 297 |
| 95 | 3300005518 | Ga0070699_100000245 | Ga0070699_1000002458 | 297 |
| 96 | 3300005518 | Ga0070699_100000813 | Ga0070699_10000081313 | 297 |
| 97 | 3300005518 | Ga0070699_100000981 | Ga0070699_1000009818 | 297 |
| 98 | 3300005518 | Ga0070699_100005113 | Ga0070699_1000051139 | 297 |
| 99 | 3300005518 | Ga0070699_100219441 | Ga0070699_1002194412 | 297 |
| 100 | 3300005536 | Ga0070697_100002762 | Ga0070697_1000027625 | 297 |
| 101 | 3300005536 | Ga0070697_100037656 | Ga0070697_1000376563 | 297 |
| 102 | 3300005545 | Ga0070695_100010669 | Ga0070695_1000106694 | 297 |
| 103 | 3300005545 | Ga0070695_100096389 | Ga0070695_1000963892 | 297 |
| 104 | 3300005549 | Ga0070704_100003129 | Ga0070704_1000031299 | 297 |
| 105 | 3300006028 | Ga0070717_10000162 | Ga0070717_1000016211 | 297 |
| 106 | 3300006852 | Ga0075433_10185874 | Ga0075433_101858742 | 297 |
| 107 | 3300006871 | Ga0075434_100049482 | Ga0075434_1000494822 | 297 |
| 108 | 3300007076 | Ga0075435_100264013 | Ga0075435_1002640132 | 297 |
| 109 | 3300007265 | Ga0099794_10004597 | Ga0099794_100045974 | 297 |
| 110 | 3300007265 | Ga0099794_10072169 | Ga0099794_100721692 | 297 |
| 111 | 3300025910 | Ga0207684_10000005 | Ga0207684_1000000555 | 297 |
| 112 | 3300025910 | Ga0207684_10000014 | Ga0207684_1000001460 | 297 |
| 113 | 3300025910 | Ga0207684_10000166 | Ga0207684_1000016672 | 297 |
| 114 | 3300025910 | Ga0207684_10000357 | Ga0207684_1000035720 | 297 |
| 115 | 3300025910 | Ga0207684_10001388 | Ga0207684_100013882 | 297 |
| 116 | 3300025910 | Ga0207684_10009940 | Ga0207684_100099403 | 297 |
| 117 | 3300025910 | Ga0207684_10045761 | Ga0207684_100457613 | 297 |
| 118 | 3300025922 | Ga0207646_10000113 | Ga0207646_1000011321 | 297 |
| 119 | 3300025922 | Ga0207646_10000350 | Ga0207646_1000035020 | 297 |
| 120 | 3300025922 | Ga0207646_10000583 | Ga0207646_1000058344 | 297 |
| 121 | 3300025922 | Ga0207646_10002921 | Ga0207646_1000292114 | 297 |
| 122 | 3300025922 | Ga0207646_10005533 | Ga0207646_1000553317 | 297 |
| 123 | 3300025922 | Ga0207646_10006166 | Ga0207646_100061669 | 297 |
| 124 | 3300025922 | Ga0207646_10017322 | Ga0207646_100173225 | 297 |
| 125 | 3300025922 | Ga0207646_10068868 | Ga0207646_100688683 | 297 |
| 126 | 3300025922 | Ga0207646_10116933 | Ga0207646_101169332 | 297 |
| 127 | 3300025928 | Ga0207700_10244804 | Ga0207700_102448042 | 297 |
| 128 | 3300025939 | Ga0207665_10009273 | Ga0207665_100092736 | 297 |
| 129 | 3300025939 | Ga0207665_10075183 | Ga0207665_100751832 | 297 |
| 130 | 3300028800 | Ga0265338_10099307 | Ga0265338_100993073 | 297 |
| 131 | 3300031241 | Ga0265325_10007316 | Ga0265325_100073166 | 297 |
| 132 | 3300045051 | Ga0451576_0005212 | Ga0451576_0005212_14392_15309 | 297 |
| 133 | 3300050512 | nmdc:mga0n895_281135_c1 | nmdc:mga0n895_281135_c1_335_1243 | 297 |
| 134 | 3300050512 | nmdc:mga0n895_468755_c1 | nmdc:mga0n895_468755_c1_108_1025 | 297 |
| 135 | 3300050513 | nmdc:mga0rr50_173255_c1 | nmdc:mga0rr50_173255_c1_407_1315 | 297 |
| 136 | 3300050514 | nmdc:mga08x19_137080_c1 | nmdc:mga08x19_137080_c1_525_1433 | 297 |
| 137 | 3300050514 | nmdc:mga08x19_139514_c1 | nmdc:mga08x19_139514_c1_446_1354 | 297 |
| 138 | 3300050515 | nmdc:mga0a205_181634_c1 | nmdc:mga0a205_181634_c1_128_1036 | 297 |
| 139 | 3300005331 | Ga0070670_100016510 | Ga0070670_1000165106 | 298 |
| 140 | 3300005467 | Ga0070706_100031434 | Ga0070706_1000314341 | 298 |
| 141 | 3300005467 | Ga0070706_100106949 | Ga0070706_1001069492 | 298 |
| 142 | 3300005471 | Ga0070698_100142950 | Ga0070698_1001429502 | 298 |
| 143 | 3300005471 | Ga0070698_100272936 | Ga0070698_1002729362 | 298 |
| 144 | 3300005518 | Ga0070699_100060339 | Ga0070699_1000603395 | 298 |
| 145 | 3300005518 | Ga0070699_100113691 | Ga0070699_1001136912 | 298 |
| 146 | 3300005577 | Ga0068857_100009622 | Ga0068857_1000096225 | 298 |
| 147 | 3300006844 | Ga0075428_100309916 | Ga0075428_1003099162 | 298 |
| 148 | 3300009177 | Ga0105248_10686478 | Ga0105248_106864782 | 298 |
| 149 | 3300025910 | Ga0207684_10010593 | Ga0207684_100105939 | 298 |
| 150 | 3300025910 | Ga0207684_10036668 | Ga0207684_100366685 | 298 |
| 151 | 3300025925 | Ga0207650_10005827 | Ga0207650_100058272 | 298 |
| 152 | 3300026116 | Ga0207674_10019122 | Ga0207674_100191227 | 298 |
| 153 | 3300031251 | Ga0265327_10003849 | Ga0265327_100038499 | 298 |
| 154 | 3300035725 | Ga0373947_0072423 | Ga0373947_0072423_740_1645 | 298 |
| 155 | 3300046459 | Ga0495629_0061609 | Ga0495629_0061609_383_1324 | 298 |
| 156 | 3300046516 | Ga0495628_0111398 | Ga0495628_0111398_1026_1943 | 298 |
| 157 | 3300046529 | Ga0495652_0342958 | Ga0495652_0342958_100_1017 | 298 |
| 158 | 3300047319 | Ga0495674_0137390 | Ga0495674_0137390_148_1062 | 298 |
| 159 | 3300047321 | Ga0495676_0036383 | Ga0495676_0036383_2854_3759 | 298 |
| 160 | 3300053084 | Ga0495595_0057117 | Ga0495595_0057117_314_1228 | 298 |
| 161 | 3300005327 | Ga0070658_10020995 | Ga0070658_100209954 | 299 |
| 162 | 3300005327 | Ga0070658_10037149 | Ga0070658_100371492 | 299 |
| 163 | 3300005329 | Ga0070683_100050989 | Ga0070683_1000509892 | 299 |
| 164 | 3300005335 | Ga0070666_10212315 | Ga0070666_102123152 | 299 |
| 165 | 3300005337 | Ga0070682_100062106 | Ga0070682_1000621062 | 299 |
| 166 | 3300005337 | Ga0070682_100248735 | Ga0070682_1002487351 | 299 |
| 167 | 3300005338 | Ga0068868_100086820 | Ga0068868_1000868203 | 299 |
| 168 | 3300005341 | Ga0070691_10014562 | Ga0070691_100145622 | 299 |
| 169 | 3300005344 | Ga0070661_100016429 | Ga0070661_1000164294 | 299 |
| 170 | 3300005355 | Ga0070671_100042991 | Ga0070671_1000429914 | 299 |
| 171 | 3300005356 | Ga0070674_100158931 | Ga0070674_1001589312 | 299 |
| 172 | 3300005434 | Ga0070709_10171030 | Ga0070709_101710302 | 299 |
| 173 | 3300005434 | Ga0070709_10241047 | Ga0070709_102410472 | 299 |
| 174 | 3300005435 | Ga0070714_100004519 | Ga0070714_1000045194 | 299 |
| 175 | 3300005435 | Ga0070714_100110408 | Ga0070714_1001104082 | 299 |
| 176 | 3300005435 | Ga0070714_100397291 | Ga0070714_1003972912 | 299 |
| 177 | 3300005436 | Ga0070713_100000227 | Ga0070713_10000022711 | 299 |
| 178 | 3300005436 | Ga0070713_100547470 | Ga0070713_1005474701 | 299 |
| 179 | 3300005437 | Ga0070710_10009936 | Ga0070710_100099367 | 299 |
| 180 | 3300005437 | Ga0070710_10033090 | Ga0070710_100330902 | 299 |
| 181 | 3300005437 | Ga0070710_10193459 | Ga0070710_101934591 | 299 |
| 182 | 3300005439 | Ga0070711_100002099 | Ga0070711_1000020993 | 299 |
| 183 | 3300005439 | Ga0070711_100077229 | Ga0070711_1000772292 | 299 |
| 184 | 3300005439 | Ga0070711_100210822 | Ga0070711_1002108222 | 299 |
| 185 | 3300005439 | Ga0070711_100276699 | Ga0070711_1002766992 | 299 |
| 186 | 3300005440 | Ga0070705_100311515 | Ga0070705_1003115151 | 299 |
| 187 | 3300005455 | Ga0070663_100006099 | Ga0070663_1000060992 | 299 |
| 188 | 3300005456 | Ga0070678_100015683 | Ga0070678_1000156833 | 299 |
| 189 | 3300005456 | Ga0070678_100017884 | Ga0070678_1000178845 | 299 |
| 190 | 3300005458 | Ga0070681_10084060 | Ga0070681_100840602 | 299 |
| 191 | 3300005458 | Ga0070681_10108500 | Ga0070681_101085003 | 299 |
| 192 | 3300005458 | Ga0070681_10451602 | Ga0070681_104516022 | 299 |
| 193 | 3300005467 | Ga0070706_100084653 | Ga0070706_1000846533 | 299 |
| 194 | 3300005468 | Ga0070707_100003748 | Ga0070707_1000037488 | 299 |
| 195 | 3300005468 | Ga0070707_100212860 | Ga0070707_1002128602 | 299 |
| 196 | 3300005471 | Ga0070698_100011470 | Ga0070698_1000114703 | 299 |
| 197 | 3300005518 | Ga0070699_100025186 | Ga0070699_1000251864 | 299 |
| 198 | 3300005518 | Ga0070699_100142553 | Ga0070699_1001425532 | 299 |
| 199 | 3300005530 | Ga0070679_100032971 | Ga0070679_1000329712 | 299 |
| 200 | 3300005530 | Ga0070679_100051760 | Ga0070679_1000517604 | 299 |
| 201 | 3300005530 | Ga0070679_100105435 | Ga0070679_1001054352 | 299 |
| 202 | 3300005535 | Ga0070684_100164507 | Ga0070684_1001645073 | 299 |
| 203 | 3300005535 | Ga0070684_100279167 | Ga0070684_1002791672 | 299 |
| 204 | 3300005535 | Ga0070684_100318393 | Ga0070684_1003183932 | 299 |
| 205 | 3300005539 | Ga0068853_100066238 | Ga0068853_1000662381 | 299 |
| 206 | 3300005544 | Ga0070686_100006701 | Ga0070686_1000067016 | 299 |
| 207 | 3300005546 | Ga0070696_100013207 | Ga0070696_1000132073 | 299 |
| 208 | 3300005546 | Ga0070696_100129997 | Ga0070696_1001299972 | 299 |
| 209 | 3300005547 | Ga0070693_100230344 | Ga0070693_1002303441 | 299 |
| 210 | 3300005548 | Ga0070665_100212679 | Ga0070665_1002126792 | 299 |
| 211 | 3300005563 | Ga0068855_100065828 | Ga0068855_1000658282 | 299 |
| 212 | 3300005563 | Ga0068855_100483564 | Ga0068855_1004835642 | 299 |
| 213 | 3300005563 | Ga0068855_100553890 | Ga0068855_1005538902 | 299 |
| 214 | 3300005564 | Ga0070664_100009530 | Ga0070664_1000095303 | 299 |
| 215 | 3300005614 | Ga0068856_100446842 | Ga0068856_1004468422 | 299 |
| 216 | 3300005615 | Ga0070702_100029174 | Ga0070702_1000291741 | 299 |
| 217 | 3300005618 | Ga0068864_100223840 | Ga0068864_1002238402 | 299 |
| 218 | 3300005618 | Ga0068864_100539223 | Ga0068864_1005392232 | 299 |
| 219 | 3300005719 | Ga0068861_100169007 | Ga0068861_1001690072 | 299 |
| 220 | 3300005841 | Ga0068863_100011662 | Ga0068863_1000116625 | 299 |
| 221 | 3300005841 | Ga0068863_100552926 | Ga0068863_1005529262 | 299 |
| 222 | 3300006028 | Ga0070717_10055211 | Ga0070717_100552112 | 299 |
| 223 | 3300006028 | Ga0070717_10099565 | Ga0070717_100995652 | 299 |
| 224 | 3300006028 | Ga0070717_10136936 | Ga0070717_101369362 | 299 |
| 225 | 3300006028 | Ga0070717_10359799 | Ga0070717_103597992 | 299 |
| 226 | 3300006163 | Ga0070715_10015021 | Ga0070715_100150211 | 299 |
| 227 | 3300006163 | Ga0070715_10020705 | Ga0070715_100207052 | 299 |
| 228 | 3300006163 | Ga0070715_10048634 | Ga0070715_100486342 | 299 |
| 229 | 3300006163 | Ga0070715_10065165 | Ga0070715_100651651 | 299 |
| 230 | 3300006163 | Ga0070715_10082342 | Ga0070715_100823422 | 299 |
| 231 | 3300006173 | Ga0070716_100002393 | Ga0070716_1000023931 | 299 |
| 232 | 3300006173 | Ga0070716_100106625 | Ga0070716_1001066252 | 299 |
| 233 | 3300006175 | Ga0070712_100000611 | Ga0070712_10000061117 | 299 |
| 234 | 3300006175 | Ga0070712_100101871 | Ga0070712_1001018712 | 299 |
| 235 | 3300006237 | Ga0097621_100403962 | Ga0097621_1004039622 | 299 |
| 236 | 3300006358 | Ga0068871_100282122 | Ga0068871_1002821222 | 299 |
| 237 | 3300006358 | Ga0068871_100343515 | Ga0068871_1003435152 | 299 |
| 238 | 3300006844 | Ga0075428_100000151 | Ga0075428_10000015139 | 299 |
| 239 | 3300006871 | Ga0075434_100366536 | Ga0075434_1003665361 | 299 |
| 240 | 3300006914 | Ga0075436_100007209 | Ga0075436_1000072097 | 299 |
| 241 | 3300009093 | Ga0105240_10024032 | Ga0105240_100240328 | 299 |
| 242 | 3300009093 | Ga0105240_10070304 | Ga0105240_100703044 | 299 |
| 243 | 3300009093 | Ga0105240_10565591 | Ga0105240_105655912 | 299 |
| 244 | 3300009098 | Ga0105245_10089412 | Ga0105245_100894123 | 299 |
| 245 | 3300009098 | Ga0105245_10473576 | Ga0105245_104735762 | 299 |
| 246 | 3300009101 | Ga0105247_10048085 | Ga0105247_100480852 | 299 |
| 247 | 3300009147 | Ga0114129_10857768 | Ga0114129_108577681 | 299 |
| 248 | 3300009148 | Ga0105243_10031948 | Ga0105243_100319483 | 299 |
| 249 | 3300009148 | Ga0105243_10550859 | Ga0105243_105508592 | 299 |
| 250 | 3300009174 | Ga0105241_10120622 | Ga0105241_101206222 | 299 |
| 251 | 3300009176 | Ga0105242_10203436 | Ga0105242_102034362 | 299 |
| 252 | 3300009176 | Ga0105242_10259286 | Ga0105242_102592862 | 299 |
| 253 | 3300009177 | Ga0105248_10152852 | Ga0105248_101528522 | 299 |
| 254 | 3300009545 | Ga0105237_10404254 | Ga0105237_104042542 | 299 |
| 255 | 3300009545 | Ga0105237_10599584 | Ga0105237_105995841 | 299 |
| 256 | 3300009551 | Ga0105238_10365078 | Ga0105238_103650782 | 299 |
| 257 | 3300010375 | Ga0105239_10438009 | Ga0105239_104380092 | 299 |
| 258 | 3300011119 | Ga0105246_10034156 | Ga0105246_100341564 | 299 |
| 259 | 3300013102 | Ga0157371_10246857 | Ga0157371_102468572 | 299 |
| 260 | 3300013104 | Ga0157370_10031786 | Ga0157370_100317862 | 299 |
| 261 | 3300013104 | Ga0157370_10380818 | Ga0157370_103808182 | 299 |
| 262 | 3300013105 | Ga0157369_10038511 | Ga0157369_100385112 | 299 |
| 263 | 3300013105 | Ga0157369_10039679 | Ga0157369_100396792 | 299 |
| 264 | 3300013105 | Ga0157369_10089298 | Ga0157369_100892984 | 299 |
| 265 | 3300013296 | Ga0157374_10087923 | Ga0157374_100879232 | 299 |
| 266 | 3300013296 | Ga0157374_10208348 | Ga0157374_102083482 | 299 |
| 267 | 3300013297 | Ga0157378_10207435 | Ga0157378_102074352 | 299 |
| 268 | 3300013297 | Ga0157378_10339211 | Ga0157378_103392112 | 299 |
| 269 | 3300013306 | Ga0163162_10245708 | Ga0163162_102457082 | 299 |
| 270 | 3300013306 | Ga0163162_10276719 | Ga0163162_102767191 | 299 |
| 271 | 3300013307 | Ga0157372_10682782 | Ga0157372_106827822 | 299 |
| 272 | 3300014325 | Ga0163163_10047822 | Ga0163163_100478225 | 299 |
| 273 | 3300014745 | Ga0157377_10213063 | Ga0157377_102130632 | 299 |
| 274 | 3300014968 | Ga0157379_10183089 | Ga0157379_101830892 | 299 |
| 275 | 3300014969 | Ga0157376_10054572 | Ga0157376_100545722 | 299 |
| 276 | 3300014969 | Ga0157376_10616354 | Ga0157376_106163542 | 299 |
| 277 | 3300017792 | Ga0163161_10027115 | Ga0163161_100271156 | 299 |
| 278 | 3300020070 | Ga0206356_11840338 | Ga0206356_118403381 | 299 |
| 279 | 3300020080 | Ga0206350_10254859 | Ga0206350_102548592 | 299 |
| 280 | 3300020081 | Ga0206354_10453000 | Ga0206354_104530002 | 299 |
| 281 | 3300020082 | Ga0206353_10888380 | Ga0206353_108883806 | 299 |
| 282 | 3300022467 | Ga0224712_10000892 | Ga0224712_100008928 | 299 |
| 283 | 3300025898 | Ga0207692_10016470 | Ga0207692_100164701 | 299 |
| 284 | 3300025898 | Ga0207692_10071707 | Ga0207692_100717072 | 299 |
| 285 | 3300025900 | Ga0207710_10030887 | Ga0207710_100308872 | 299 |
| 286 | 3300025901 | Ga0207688_10077873 | Ga0207688_100778732 | 299 |
| 287 | 3300025904 | Ga0207647_10087913 | Ga0207647_100879132 | 299 |
| 288 | 3300025905 | Ga0207685_10016920 | Ga0207685_100169203 | 299 |
| 289 | 3300025906 | Ga0207699_10001466 | Ga0207699_1000146610 | 299 |
| 290 | 3300025906 | Ga0207699_10005243 | Ga0207699_100052435 | 299 |
| 291 | 3300025906 | Ga0207699_10006418 | Ga0207699_100064185 | 299 |
| 292 | 3300025909 | Ga0207705_10028451 | Ga0207705_100284514 | 299 |
| 293 | 3300025909 | Ga0207705_10057578 | Ga0207705_100575782 | 299 |
| 294 | 3300025910 | Ga0207684_10071316 | Ga0207684_100713162 | 299 |
| 295 | 3300025910 | Ga0207684_10140541 | Ga0207684_101405412 | 299 |
| 296 | 3300025912 | Ga0207707_10068223 | Ga0207707_100682234 | 299 |
| 297 | 3300025913 | Ga0207695_10077299 | Ga0207695_100772992 | 299 |
| 298 | 3300025913 | Ga0207695_10169846 | Ga0207695_101698462 | 299 |
| 299 | 3300025913 | Ga0207695_10376759 | Ga0207695_103767592 | 299 |
| 300 | 3300025915 | Ga0207693_10000091 | Ga0207693_1000009116 | 299 |
| 301 | 3300025915 | Ga0207693_10011806 | Ga0207693_100118065 | 299 |
| 302 | 3300025915 | Ga0207693_10041710 | Ga0207693_100417103 | 299 |
| 303 | 3300025915 | Ga0207693_10309129 | Ga0207693_103091292 | 299 |
| 304 | 3300025915 | Ga0207693_10310742 | Ga0207693_103107422 | 299 |
| 305 | 3300025916 | Ga0207663_10000173 | Ga0207663_100001739 | 299 |
| 306 | 3300025916 | Ga0207663_10034382 | Ga0207663_100343822 | 299 |
| 307 | 3300025916 | Ga0207663_10102142 | Ga0207663_101021421 | 299 |
| 308 | 3300025919 | Ga0207657_10005560 | Ga0207657_1000556010 | 299 |
| 309 | 3300025920 | Ga0207649_10012124 | Ga0207649_100121242 | 299 |
| 310 | 3300025921 | Ga0207652_10042325 | Ga0207652_100423252 | 299 |
| 311 | 3300025921 | Ga0207652_10152807 | Ga0207652_101528073 | 299 |
| 312 | 3300025921 | Ga0207652_10508187 | Ga0207652_105081872 | 299 |
| 313 | 3300025922 | Ga0207646_10022624 | Ga0207646_100226243 | 299 |
| 314 | 3300025924 | Ga0207694_10071188 | Ga0207694_100711882 | 299 |
| 315 | 3300025924 | Ga0207694_10327482 | Ga0207694_103274821 | 299 |
| 316 | 3300025926 | Ga0207659_10464862 | Ga0207659_104648622 | 299 |
| 317 | 3300025927 | Ga0207687_10174930 | Ga0207687_101749302 | 299 |
| 318 | 3300025928 | Ga0207700_10000239 | Ga0207700_1000023916 | 299 |
| 319 | 3300025928 | Ga0207700_10034013 | Ga0207700_100340132 | 299 |
| 320 | 3300025928 | Ga0207700_10123913 | Ga0207700_101239132 | 299 |
| 321 | 3300025929 | Ga0207664_10021500 | Ga0207664_100215002 | 299 |
| 322 | 3300025929 | Ga0207664_10033078 | Ga0207664_100330781 | 299 |
| 323 | 3300025929 | Ga0207664_10045665 | Ga0207664_100456654 | 299 |
| 324 | 3300025932 | Ga0207690_10059688 | Ga0207690_100596882 | 299 |
| 325 | 3300025935 | Ga0207709_10015039 | Ga0207709_100150393 | 299 |
| 326 | 3300025936 | Ga0207670_10075487 | Ga0207670_100754872 | 299 |
| 327 | 3300025937 | Ga0207669_10082032 | Ga0207669_100820322 | 299 |
| 328 | 3300025939 | Ga0207665_10002719 | Ga0207665_100027195 | 299 |
| 329 | 3300025939 | Ga0207665_10003816 | Ga0207665_1000381612 | 299 |
| 330 | 3300025939 | Ga0207665_10021960 | Ga0207665_100219603 | 299 |
| 331 | 3300025939 | Ga0207665_10095027 | Ga0207665_100950272 | 299 |
| 332 | 3300025939 | Ga0207665_10265026 | Ga0207665_102650262 | 299 |
| 333 | 3300025942 | Ga0207689_10003693 | Ga0207689_1000369310 | 299 |
| 334 | 3300025944 | Ga0207661_10026540 | Ga0207661_100265402 | 299 |
| 335 | 3300025961 | Ga0207712_10115865 | Ga0207712_101158652 | 299 |
| 336 | 3300025986 | Ga0207658_10271572 | Ga0207658_102715722 | 299 |
| 337 | 3300026023 | Ga0207677_10230606 | Ga0207677_102306061 | 299 |
| 338 | 3300026041 | Ga0207639_10092547 | Ga0207639_100925473 | 299 |
| 339 | 3300026067 | Ga0207678_10002072 | Ga0207678_1000207210 | 299 |
| 340 | 3300026078 | Ga0207702_10079191 | Ga0207702_100791912 | 299 |
| 341 | 3300026078 | Ga0207702_10470281 | Ga0207702_104702812 | 299 |
| 342 | 3300026089 | Ga0207648_10147145 | Ga0207648_101471453 | 299 |
| 343 | 3300026095 | Ga0207676_10176950 | Ga0207676_101769502 | 299 |
| 344 | 3300026116 | Ga0207674_10056349 | Ga0207674_100563492 | 299 |
| 345 | 3300026116 | Ga0207674_10547810 | Ga0207674_105478101 | 299 |
| 346 | 3300026118 | Ga0207675_100015520 | Ga0207675_1000155208 | 299 |
| 347 | 3300026121 | Ga0207683_10003128 | Ga0207683_100031282 | 299 |
| 348 | 3300026121 | Ga0207683_10005655 | Ga0207683_1000565510 | 299 |
| 349 | 3300026142 | Ga0207698_10202990 | Ga0207698_102029903 | 299 |
| 350 | 3300026142 | Ga0207698_10433686 | Ga0207698_104336862 | 299 |
| 351 | 3300028577 | Ga0265318_10049234 | Ga0265318_100492341 | 299 |
| 352 | 3300028800 | Ga0265338_10000830 | Ga0265338_1000083015 | 299 |
| 353 | 3300028800 | Ga0265338_10299109 | Ga0265338_102991091 | 299 |
| 354 | 3300031090 | Ga0265760_10040336 | Ga0265760_100403362 | 299 |
| 355 | 3300031241 | Ga0265325_10000538 | Ga0265325_1000053821 | 299 |
| 356 | 3300031249 | Ga0265339_10000350 | Ga0265339_1000035026 | 299 |
| 357 | 3300031595 | Ga0265313_10000142 | Ga0265313_1000014244 | 299 |
| 358 | 3300031711 | Ga0265314_10003842 | Ga0265314_100038429 | 299 |
| 359 | 3300034817 | Ga0373948_0020360 | Ga0373948_0020360_309_1232 | 299 |
| 360 | 3300035083 | Ga0373926_0021797 | Ga0373926_0021797_978_1931 | 299 |
| 361 | 3300035170 | Ga0373943_0009057 | Ga0373943_0009057_1738_2649 | 299 |
| 362 | 3300035172 | Ga0373955_0112112 | Ga0373955_0112112_339_1256 | 299 |
| 363 | 3300035691 | Ga0373931_0027108 | Ga0373931_0027108_184_1107 | 299 |
| 364 | 3300035691 | Ga0373931_0078035 | Ga0373931_0078035_22_939 | 299 |
| 365 | 3300035692 | Ga0373935_0117800 | Ga0373935_0117800_101_1018 | 299 |
| 366 | 3300035695 | Ga0373927_0034426 | Ga0373927_0034426_1615_2568 | 299 |
| 367 | 3300035724 | Ga0373933_0024052 | Ga0373933_0024052_1197_2174 | 299 |
| 368 | 3300035725 | Ga0373947_0002280 | Ga0373947_0002280_2090_3043 | 299 |
| 369 | 3300036401 | Ga0373937_0156020 | Ga0373937_0156020_961_1878 | 299 |
| 370 | 3300037068 | Ga0373925_0001250 | Ga0373925_0001250_10764_11717 | 299 |
| 371 | 3300037068 | Ga0373925_0060929 | Ga0373925_0060929_420_1349 | 299 |
| 372 | 3300037068 | Ga0373925_0189052 | Ga0373925_0189052_555_1472 | 299 |
| 373 | 3300037068 | Ga0373925_0324360 | Ga0373925_0324360_101_1018 | 299 |
| 374 | 3300039437 | Ga0436365_0127369 | Ga0436365_0127369_816_1778 | 299 |
| 375 | 3300039437 | Ga0436365_0950920 | Ga0436365_0950920_531_1439 | 299 |
| 376 | 3300039437 | Ga0436365_1773926 | Ga0436365_1773926_4084_5112 | 299 |
| 377 | 3300042876 | Ga0451577_0078980 | Ga0451577_0078980_1537_2448 | 299 |
| 378 | 3300042876 | Ga0451577_0155668 | Ga0451577_0155668_249_1160 | 299 |
| 379 | 3300044673 | Ga0453683_0011755 | Ga0453683_0011755_4123_5034 | 299 |
| 380 | 3300044712 | Ga0453684_0001274 | Ga0453684_0001274_18713_19669 | 299 |
| 381 | 3300044712 | Ga0453684_0001763 | Ga0453684_0001763_24000_24911 | 299 |
| 382 | 3300044712 | Ga0453684_0002930 | Ga0453684_0002930_19069_19980 | 299 |
| 383 | 3300044712 | Ga0453684_0036894 | Ga0453684_0036894_1162_2073 | 299 |
| 384 | 3300044712 | Ga0453684_0058479 | Ga0453684_0058479_3890_4801 | 299 |
| 385 | 3300044712 | Ga0453684_0175839 | Ga0453684_0175839_655_1566 | 299 |
| 386 | 3300044712 | Ga0453684_0375199 | Ga0453684_0375199_363_1274 | 299 |
| 387 | 3300044712 | Ga0453684_0667497 | Ga0453684_0667497_15_926 | 299 |
| 388 | 3300045051 | Ga0451576_0122333 | Ga0451576_0122333_1681_2613 | 299 |
| 389 | 3300045051 | Ga0451576_0514924 | Ga0451576_0514924_248_1159 | 299 |
| 390 | 3300045976 | Ga0466967_0051411 | Ga0466967_0051411_1944_2855 | 299 |
| 391 | 3300046459 | Ga0495629_0048763 | Ga0495629_0048763_1899_2828 | 299 |
| 392 | 3300046463 | Ga0495653_0003548 | Ga0495653_0003548_5166_6098 | 299 |
| 393 | 3300046463 | Ga0495653_0075124 | Ga0495653_0075124_299_1216 | 299 |
| 394 | 3300046472 | Ga0495580_0031364 | Ga0495580_0031364_2227_3159 | 299 |
| 395 | 3300046511 | Ga0495608_0030580 | Ga0495608_0030580_2203_3135 | 299 |
| 396 | 3300046516 | Ga0495628_0019552 | Ga0495628_0019552_3021_4019 | 299 |
| 397 | 3300046517 | Ga0495630_0000305 | Ga0495630_0000305_10348_11277 | 299 |
| 398 | 3300046526 | Ga0495666_0015470 | Ga0495666_0015470_53_982 | 299 |
| 399 | 3300046526 | Ga0495666_0049120 | Ga0495666_0049120_555_1508 | 299 |
| 400 | 3300046529 | Ga0495652_0191762 | Ga0495652_0191762_508_1419 | 299 |
| 401 | 3300046529 | Ga0495652_0306915 | Ga0495652_0306915_92_1009 | 299 |
| 402 | 3300046531 | Ga0495665_0008974 | Ga0495665_0008974_4349_5281 | 299 |
| 403 | 3300046533 | Ga0495640_0005886 | Ga0495640_0005886_7031_7963 | 299 |
| 404 | 3300046533 | Ga0495640_0062811 | Ga0495640_0062811_813_1742 | 299 |
| 405 | 3300046535 | Ga0495586_0000271 | Ga0495586_0000271_10368_11297 | 299 |
| 406 | 3300046536 | Ga0495587_0102507 | Ga0495587_0102507_55_987 | 299 |
| 407 | 3300046536 | Ga0495587_0167616 | Ga0495587_0167616_293_1210 | 299 |
| 408 | 3300046543 | Ga0495645_0016127 | Ga0495645_0016127_230_1162 | 299 |
| 409 | 3300046559 | Ga0495667_0052667 | Ga0495667_0052667_1303_2235 | 299 |
| 410 | 3300046559 | Ga0495667_0186630 | Ga0495667_0186630_102_1019 | 299 |
| 411 | 3300046663 | Ga0495635_0039739 | Ga0495635_0039739_1298_2215 | 299 |
| 412 | 3300046675 | Ga0495657_0014756 | Ga0495657_0014756_3500_4432 | 299 |
| 413 | 3300046678 | Ga0495599_0106009 | Ga0495599_0106009_69_995 | 299 |
| 414 | 3300046678 | Ga0495599_0118814 | Ga0495599_0118814_657_1589 | 299 |
| 415 | 3300046680 | Ga0495646_0214689 | Ga0495646_0214689_56_988 | 299 |
| 416 | 3300046683 | Ga0495658_0035953 | Ga0495658_0035953_1025_1954 | 299 |
| 417 | 3300046689 | Ga0495613_0016898 | Ga0495613_0016898_1002_1934 | 299 |
| 418 | 3300046689 | Ga0495613_0046391 | Ga0495613_0046391_1727_2656 | 299 |
| 419 | 3300047315 | Ga0495581_0197327 | Ga0495581_0197327_183_1115 | 299 |
| 420 | 3300047317 | Ga0495604_0000834 | Ga0495604_0000834_15251_16183 | 299 |
| 421 | 3300047319 | Ga0495674_0000767 | Ga0495674_0000767_24104_25033 | 299 |
| 422 | 3300047319 | Ga0495674_0231375 | Ga0495674_0231375_436_1353 | 299 |
| 423 | 3300047321 | Ga0495676_0021657 | Ga0495676_0021657_4615_5544 | 299 |
| 424 | 3300047322 | Ga0495680_0230638 | Ga0495680_0230638_55_972 | 299 |
| 425 | 3300047444 | Ga0495675_0035000 | Ga0495675_0035000_1431_2363 | 299 |
| 426 | 3300047444 | Ga0495675_0153935 | Ga0495675_0153935_341_1258 | 299 |
| 427 | 3300047471 | Ga0495684_0099607 | Ga0495684_0099607_346_1263 | 299 |
| 428 | 3300048904 | Ga0496101_0454596 | Ga0496101_0454596_32_949 | 299 |
| 429 | 3300048905 | Ga0496102_0069465 | Ga0496102_0069465_228_1145 | 299 |
| 430 | 3300048905 | Ga0496102_0151747 | Ga0496102_0151747_1021_1944 | 299 |
| 431 | 3300048908 | Ga0496105_0015428 | Ga0496105_0015428_290_1213 | 299 |
| 432 | 3300048908 | Ga0496105_0210462 | Ga0496105_0210462_319_1242 | 299 |
| 433 | 3300048908 | Ga0496105_0246506 | Ga0496105_0246506_97_1014 | 299 |
| 434 | 3300048910 | Ga0496107_0067737 | Ga0496107_0067737_1623_2546 | 299 |
| 435 | 3300048910 | Ga0496107_0278413 | Ga0496107_0278413_172_1089 | 299 |
| 436 | 3300048912 | Ga0496109_0178046 | Ga0496109_0178046_1013_1936 | 299 |
| 437 | 3300048913 | Ga0496110_0137495 | Ga0496110_0137495_664_1587 | 299 |
| 438 | 3300048913 | Ga0496110_0326152 | Ga0496110_0326152_255_1172 | 299 |
| 439 | 3300048914 | Ga0496111_0005569 | Ga0496111_0005569_6172_7095 | 299 |
| 440 | 3300048915 | Ga0496112_0197487 | Ga0496112_0197487_204_1115 | 299 |
| 441 | 3300048916 | Ga0496113_0101478 | Ga0496113_0101478_1014_1937 | 299 |
| 442 | 3300048916 | Ga0496113_0256597 | Ga0496113_0256597_163_1119 | 299 |
| 443 | 3300048916 | Ga0496113_0328366 | Ga0496113_0328366_14_931 | 299 |
| 444 | 3300048917 | Ga0496114_0125118 | Ga0496114_0125118_201_1124 | 299 |
| 445 | 3300048918 | Ga0496115_0098433 | Ga0496115_0098433_127_1044 | 299 |
| 446 | 3300048918 | Ga0496115_0224718 | Ga0496115_0224718_315_1298 | 299 |
| 447 | 3300049568 | Ga0501031_0009421 | Ga0501031_0009421_4215_5138 | 299 |
| 448 | 3300049572 | Ga0501036_0208795 | Ga0501036_0208795_67_990 | 299 |
| 449 | 3300049576 | Ga0501040_0010167 | Ga0501040_0010167_328_1251 | 299 |
| 450 | 3300049578 | Ga0501042_0004880 | Ga0501042_0004880_1298_2221 | 299 |
| 451 | 3300049586 | Ga0501070_0436448 | Ga0501070_0436448_84_1007 | 299 |
| 452 | 3300049588 | Ga0501072_0068792 | Ga0501072_0068792_1439_2362 | 299 |
| 453 | 3300049592 | Ga0501076_0236546 | Ga0501076_0236546_71_994 | 299 |
| 454 | 3300049741 | Ga0501079_0164090 | Ga0501079_0164090_44_967 | 299 |
| 455 | 3300049742 | Ga0501080_0024362 | Ga0501080_0024362_3945_4868 | 299 |
| 456 | 3300049824 | Ga0501045_0008806 | Ga0501045_0008806_5819_6742 | 299 |
| 457 | 3300050512 | nmdc:mga0n895_155624_c1 | nmdc:mga0n895_155624_c1_495_1418 | 299 |
| 458 | 3300050514 | nmdc:mga08x19_134_c1 | nmdc:mga08x19_134_c1_53178_54131 | 299 |
| 459 | 3300053077 | Ga0495601_0037940 | Ga0495601_0037940_434_1366 | 299 |
| 460 | 3300053085 | Ga0495619_0032127 | Ga0495619_0032127_54_986 | 299 |
| 461 | 3300061719 | Ga0466962_0030545 | Ga0466962_0030545_59_1021 | 299 |
| 462 | 3300061734 | Ga0530510_0008203 | Ga0530510_0008203_3933_4856 | 299 |
| 463 | 3300061734 | Ga0530510_0166850 | Ga0530510_0166850_598_1509 | 299 |
| 464 | 3300005339 | Ga0070660_100016204 | Ga0070660_1000162042 | 300 |
| 465 | 3300005439 | Ga0070711_100082493 | Ga0070711_1000824932 | 300 |
| 466 | 3300005445 | Ga0070708_100006063 | Ga0070708_1000060634 | 300 |
| 467 | 3300005445 | Ga0070708_100010325 | Ga0070708_1000103252 | 300 |
| 468 | 3300005445 | Ga0070708_100125057 | Ga0070708_1001250573 | 300 |
| 469 | 3300005445 | Ga0070708_100592523 | Ga0070708_1005925231 | 300 |
| 470 | 3300005458 | Ga0070681_10052862 | Ga0070681_100528623 | 300 |
| 471 | 3300005458 | Ga0070681_10244432 | Ga0070681_102444322 | 300 |
| 472 | 3300005467 | Ga0070706_100003078 | Ga0070706_10000307816 | 300 |
| 473 | 3300005467 | Ga0070706_100052553 | Ga0070706_1000525534 | 300 |
| 474 | 3300005468 | Ga0070707_100000933 | Ga0070707_1000009335 | 300 |
| 475 | 3300005468 | Ga0070707_100014998 | Ga0070707_1000149983 | 300 |
| 476 | 3300005468 | Ga0070707_100086991 | Ga0070707_1000869913 | 300 |
| 477 | 3300005468 | Ga0070707_100275596 | Ga0070707_1002755962 | 300 |
| 478 | 3300005471 | Ga0070698_100000745 | Ga0070698_10000074532 | 300 |
| 479 | 3300005471 | Ga0070698_100104147 | Ga0070698_1001041472 | 300 |
| 480 | 3300005471 | Ga0070698_100132610 | Ga0070698_1001326103 | 300 |
| 481 | 3300005518 | Ga0070699_100013099 | Ga0070699_1000130994 | 300 |
| 482 | 3300005535 | Ga0070684_100072443 | Ga0070684_1000724432 | 300 |
| 483 | 3300005536 | Ga0070697_100021391 | Ga0070697_1000213915 | 300 |
| 484 | 3300005536 | Ga0070697_100040828 | Ga0070697_1000408284 | 300 |
| 485 | 3300005546 | Ga0070696_100117371 | Ga0070696_1001173713 | 300 |
| 486 | 3300005548 | Ga0070665_100000050 | Ga0070665_100000050128 | 300 |
| 487 | 3300005719 | Ga0068861_100141314 | Ga0068861_1001413142 | 300 |
| 488 | 3300005937 | Ga0081455_10087395 | Ga0081455_100873951 | 300 |
| 489 | 3300006028 | Ga0070717_10007624 | Ga0070717_100076243 | 300 |
| 490 | 3300006028 | Ga0070717_10103147 | Ga0070717_101031474 | 300 |
| 491 | 3300006028 | Ga0070717_10220461 | Ga0070717_102204612 | 300 |
| 492 | 3300006852 | Ga0075433_10404056 | Ga0075433_104040561 | 300 |
| 493 | 3300009094 | Ga0111539_10390434 | Ga0111539_103904342 | 300 |
| 494 | 3300009147 | Ga0114129_10007038 | Ga0114129_100070388 | 300 |
| 495 | 3300021358 | Ga0213873_10039467 | Ga0213873_100394671 | 300 |
| 496 | 3300021388 | Ga0213875_10091986 | Ga0213875_100919862 | 300 |
| 497 | 3300025905 | Ga0207685_10050289 | Ga0207685_100502891 | 300 |
| 498 | 3300025910 | Ga0207684_10012110 | Ga0207684_100121107 | 300 |
| 499 | 3300025916 | Ga0207663_10037089 | Ga0207663_100370895 | 300 |
| 500 | 3300025919 | Ga0207657_10013761 | Ga0207657_100137615 | 300 |
| 501 | 3300025922 | Ga0207646_10000054 | Ga0207646_10000054133 | 300 |
| 502 | 3300025922 | Ga0207646_10026838 | Ga0207646_100268384 | 300 |
| 503 | 3300025922 | Ga0207646_10065604 | Ga0207646_100656041 | 300 |
| 504 | 3300025922 | Ga0207646_10239813 | Ga0207646_102398132 | 300 |
| 505 | 3300026118 | Ga0207675_100340069 | Ga0207675_1003400692 | 300 |
| 506 | 3300028379 | Ga0268266_10000241 | Ga0268266_1000024159 | 300 |
| 507 | 3300028556 | Ga0265337_1000777 | Ga0265337_100077717 | 300 |
| 508 | 3300028556 | Ga0265337_1013840 | Ga0265337_10138401 | 300 |
| 509 | 3300028573 | Ga0265334_10071062 | Ga0265334_100710621 | 300 |
| 510 | 3300028666 | Ga0265336_10008042 | Ga0265336_100080422 | 300 |
| 511 | 3300028800 | Ga0265338_10074082 | Ga0265338_100740824 | 300 |
| 512 | 3300028800 | Ga0265338_10096909 | Ga0265338_100969093 | 300 |
| 513 | 3300028800 | Ga0265338_10347853 | Ga0265338_103478531 | 300 |
| 514 | 3300029957 | Ga0265324_10017492 | Ga0265324_100174922 | 300 |
| 515 | 3300029957 | Ga0265324_10017848 | Ga0265324_100178481 | 300 |
| 516 | 3300031235 | Ga0265330_10006995 | Ga0265330_100069953 | 300 |
| 517 | 3300031235 | Ga0265330_10044768 | Ga0265330_100447682 | 300 |
| 518 | 3300031240 | Ga0265320_10000242 | Ga0265320_1000024217 | 300 |
| 519 | 3300031240 | Ga0265320_10022604 | Ga0265320_100226043 | 300 |
| 520 | 3300031240 | Ga0265320_10031173 | Ga0265320_100311732 | 300 |
| 521 | 3300031240 | Ga0265320_10032279 | Ga0265320_100322792 | 300 |
| 522 | 3300031242 | Ga0265329_10043735 | Ga0265329_100437352 | 300 |
| 523 | 3300031247 | Ga0265340_10025983 | Ga0265340_100259833 | 300 |
| 524 | 3300031247 | Ga0265340_10034948 | Ga0265340_100349482 | 300 |
| 525 | 3300031247 | Ga0265340_10099170 | Ga0265340_100991702 | 300 |
| 526 | 3300031249 | Ga0265339_10091780 | Ga0265339_100917802 | 300 |
| 527 | 3300031249 | Ga0265339_10101484 | Ga0265339_101014842 | 300 |
| 528 | 3300031250 | Ga0265331_10012584 | Ga0265331_100125843 | 300 |
| 529 | 3300031250 | Ga0265331_10091710 | Ga0265331_100917101 | 300 |
| 530 | 3300031344 | Ga0265316_10000706 | Ga0265316_1000070617 | 300 |
| 531 | 3300031344 | Ga0265316_10003202 | Ga0265316_1000320214 | 300 |
| 532 | 3300031344 | Ga0265316_10054150 | Ga0265316_100541502 | 300 |
| 533 | 3300031691 | Ga0316579_10001589 | Ga0316579_100015895 | 300 |
| 534 | 3300031711 | Ga0265314_10001717 | Ga0265314_1000171721 | 300 |
| 535 | 3300031711 | Ga0265314_10186544 | Ga0265314_101865441 | 300 |
| 536 | 3300031712 | Ga0265342_10029830 | Ga0265342_100298302 | 300 |
| 537 | 3300031728 | Ga0316578_10050760 | Ga0316578_100507601 | 300 |
| 538 | 3300031852 | Ga0307410_10002640 | Ga0307410_1000264010 | 300 |
| 539 | 3300032002 | Ga0307416_100002595 | Ga0307416_1000025953 | 300 |
| 540 | 3300032002 | Ga0307416_100369901 | Ga0307416_1003699012 | 300 |
| 541 | 3300035083 | Ga0373926_0024226 | Ga0373926_0024226_1034_1954 | 300 |
| 542 | 3300035089 | Ga0373944_0000594 | Ga0373944_0000594_3311_4231 | 300 |
| 543 | 3300035116 | Ga0373945_0000010 | Ga0373945_0000010_9507_10427 | 300 |
| 544 | 3300035170 | Ga0373943_0002157 | Ga0373943_0002157_7387_8307 | 300 |
| 545 | 3300035171 | Ga0373946_0000330 | Ga0373946_0000330_9326_10246 | 300 |
| 546 | 3300035172 | Ga0373955_0030722 | Ga0373955_0030722_1137_2057 | 300 |
| 547 | 3300035410 | Ga0373924_0024766 | Ga0373924_0024766_817_1737 | 300 |
| 548 | 3300035692 | Ga0373935_0036921 | Ga0373935_0036921_495_1415 | 300 |
| 549 | 3300035695 | Ga0373927_0011110 | Ga0373927_0011110_225_1145 | 300 |
| 550 | 3300035725 | Ga0373947_0001234 | Ga0373947_0001234_1020_1940 | 300 |
| 551 | 3300037068 | Ga0373925_0019060 | Ga0373925_0019060_2921_3841 | 300 |
| 552 | 3300037312 | Ga0395899_0110669 | Ga0395899_0110669_137_1297 | 300 |
| 553 | 3300037471 | Ga0395905_0419413 | Ga0395905_0419413_216_1136 | 300 |
| 554 | 3300037853 | Ga0436364_0757267 | Ga0436364_0757267_4838_5758 | 300 |
| 555 | 3300039450 | Ga0436363_0303774 | Ga0436363_0303774_2807_3724 | 300 |
| 556 | 3300039450 | Ga0436363_0624304 | Ga0436363_0624304_2976_3902 | 300 |
| 557 | 3300039453 | Ga0436362_0749635 | Ga0436362_0749635_83_1003 | 300 |
| 558 | 3300039453 | Ga0436362_1085911 | Ga0436362_1085911_240_1166 | 300 |
| 559 | 3300044712 | Ga0453684_0002426 | Ga0453684_0002426_34718_35620 | 300 |
| 560 | 3300044712 | Ga0453684_0006387 | Ga0453684_0006387_18558_19499 | 300 |
| 561 | 3300044712 | Ga0453684_0015242 | Ga0453684_0015242_11085_12029 | 300 |
| 562 | 3300044712 | Ga0453684_0026747 | Ga0453684_0026747_4422_5351 | 300 |
| 563 | 3300046463 | Ga0495653_0002194 | Ga0495653_0002194_5088_6008 | 300 |
| 564 | 3300046473 | Ga0495582_0074040 | Ga0495582_0074040_272_1192 | 300 |
| 565 | 3300046475 | Ga0495639_0022713 | Ga0495639_0022713_266_1186 | 300 |
| 566 | 3300046491 | Ga0495584_0130044 | Ga0495584_0130044_243_1175 | 300 |
| 567 | 3300046511 | Ga0495608_0085910 | Ga0495608_0085910_312_1232 | 300 |
| 568 | 3300046514 | Ga0495618_0028612 | Ga0495618_0028612_769_1689 | 300 |
| 569 | 3300046516 | Ga0495628_0021920 | Ga0495628_0021920_3543_4463 | 300 |
| 570 | 3300046517 | Ga0495630_0047439 | Ga0495630_0047439_906_1826 | 300 |
| 571 | 3300046529 | Ga0495652_0031195 | Ga0495652_0031195_994_1914 | 300 |
| 572 | 3300046531 | Ga0495665_0066442 | Ga0495665_0066442_475_1395 | 300 |
| 573 | 3300046533 | Ga0495640_0082906 | Ga0495640_0082906_779_1699 | 300 |
| 574 | 3300046543 | Ga0495645_0053396 | Ga0495645_0053396_1360_2280 | 300 |
| 575 | 3300046559 | Ga0495667_0004069 | Ga0495667_0004069_7866_8786 | 300 |
| 576 | 3300046642 | Ga0495634_0033832 | Ga0495634_0033832_1700_2620 | 300 |
| 577 | 3300046663 | Ga0495635_0000459 | Ga0495635_0000459_11748_12668 | 300 |
| 578 | 3300046675 | Ga0495657_0156632 | Ga0495657_0156632_268_1188 | 300 |
| 579 | 3300046678 | Ga0495599_0049095 | Ga0495599_0049095_1154_2074 | 300 |
| 580 | 3300046690 | Ga0495624_0006532 | Ga0495624_0006532_5390_6310 | 300 |
| 581 | 3300047315 | Ga0495581_0029249 | Ga0495581_0029249_1436_2356 | 300 |
| 582 | 3300047319 | Ga0495674_0006061 | Ga0495674_0006061_10042_10962 | 300 |
| 583 | 3300047321 | Ga0495676_0011793 | Ga0495676_0011793_880_1800 | 300 |
| 584 | 3300047322 | Ga0495680_0035336 | Ga0495680_0035336_2323_3243 | 300 |
| 585 | 3300047471 | Ga0495684_0003770 | Ga0495684_0003770_4465_5385 | 300 |
| 586 | 3300047673 | Ga0495593_0033987 | Ga0495593_0033987_1291_2211 | 300 |
| 587 | 3300048905 | Ga0496102_0254320 | Ga0496102_0254320_225_1139 | 300 |
| 588 | 3300048913 | Ga0496110_0349060 | Ga0496110_0349060_240_1172 | 300 |
| 589 | 3300050511 | nmdc:mga08y16_223347_c1 | nmdc:mga08y16_223347_c1_491_1480 | 300 |
| 590 | 3300050514 | nmdc:mga08x19_101180_c1 | nmdc:mga08x19_101180_c1_862_1806 | 300 |
| 591 | 3300053083 | Ga0495655_0001038 | Ga0495655_0001038_3116_4051 | 300 |
| 592 | 3300053085 | Ga0495619_0010569 | Ga0495619_0010569_1623_2552 | 300 |
| 593 | 3300005295 | Ga0065707_10095319 | Ga0065707_100953194 | 301 |
| 594 | 3300005435 | Ga0070714_100195658 | Ga0070714_1001956582 | 301 |
| 595 | 3300005985 | Ga0081539_10007469 | Ga0081539_100074699 | 301 |
| 596 | 3300006847 | Ga0075431_100016333 | Ga0075431_1000163335 | 301 |
| 597 | 3300006852 | Ga0075433_10040529 | Ga0075433_100405292 | 301 |
| 598 | 3300006852 | Ga0075433_10246838 | Ga0075433_102468382 | 301 |
| 599 | 3300006871 | Ga0075434_100140982 | Ga0075434_1001409822 | 301 |
| 600 | 3300009094 | Ga0111539_10247061 | Ga0111539_102470612 | 301 |
| 601 | 3300021384 | Ga0213876_10065874 | Ga0213876_100658742 | 301 |
| 602 | 3300025929 | Ga0207664_10270614 | Ga0207664_102706142 | 301 |
| 603 | 3300028379 | Ga0268266_10413628 | Ga0268266_104136282 | 301 |
| 604 | 3300039437 | Ga0436365_0610234 | Ga0436365_0610234_2278_3216 | 301 |
| 605 | 3300044656 | Ga0466969_0067262 | Ga0466969_0067262_341_1279 | 301 |
| 606 | 3300044694 | Ga0466963_0007334 | Ga0466963_0007334_2978_3910 | 301 |
| 607 | 3300044735 | Ga0466968_0010067 | Ga0466968_0010067_484_1416 | 301 |
| 608 | 3300044842 | Ga0466957_0008051 | Ga0466957_0008051_1422_2354 | 301 |
| 609 | 3300045049 | Ga0466959_0021507 | Ga0466959_0021507_1797_2729 | 301 |
| 610 | 3300045836 | Ga0466958_0029234 | Ga0466958_0029234_1297_2235 | 301 |
| 611 | 3300045836 | Ga0466958_0185254 | Ga0466958_0185254_222_1157 | 301 |
| 612 | 3300048911 | Ga0496108_0163002 | Ga0496108_0163002_496_1428 | 301 |
| 613 | 3300048912 | Ga0496109_0008477 | Ga0496109_0008477_6891_7823 | 301 |
| 614 | 3300048917 | Ga0496114_0043817 | Ga0496114_0043817_307_1260 | 301 |
| 615 | 3300050507 | nmdc:mga05p37_237934_c1 | nmdc:mga05p37_237934_c1_761_1729 | 301 |
| 616 | 3300050510 | nmdc:mga06r32_138714_c1 | nmdc:mga06r32_138714_c1_1075_2013 | 301 |
| 617 | 3300050511 | nmdc:mga08y16_47847_c1 | nmdc:mga08y16_47847_c1_1011_1949 | 301 |
| 618 | 3300050512 | nmdc:mga0n895_374689_c1 | nmdc:mga0n895_374689_c1_82_1020 | 301 |
| 619 | 3300050515 | nmdc:mga0a205_77014_c1 | nmdc:mga0a205_77014_c1_334_1293 | 301 |
| 620 | 3300061719 | Ga0466962_0007829 | Ga0466962_0007829_3555_4487 | 301 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7a24-assembly1.cif.gz_T | assembly intermediate of the plant mitochondrial complex i | 0.8502 | 3 | 280 |
| 3w1v-assembly1.cif.gz_A | crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor | 0.8465 | 2 | 232 |
| 5gup-assembly1.cif.gz_L | cryo-em structure of mammalian respiratory supercomplex i1iii2iv1 | 0.8441 | 1 | 271 |
| 7ak6-assembly1.cif.gz_P | cryo-em structure of nd6-p25l mutant respiratory complex i from mus musculus at 3.8 a | 0.8413 | 1 | 220 |
| 6qa9-assembly1.cif.gz_A9 | isolated complex i class refinement from ovine respiratory supercomplex i+iii2 | 0.839 | 1 | 222 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q559Z0_43_331_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8678 | 5 | 271 | 3.40.50.720 |
| af_A0A1D6K5B6_15_173_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8593 | 2 | 105 | 3.40.50.720 |
| af_Q9SK66_71_329_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8586 | 4 | 250 | 3.40.50.720 |
| af_Q4DU32_30_254_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8508 | 1 | 202 | 3.40.50.720 |
| af_A0A2R8RUA9_55_239_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8382 | 1 | 164 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350G5F5-F1-model_v4 | NAD(P)-binding domain-containing protein | 0.9801 | 1 | 173 |
GO:0044877
GO:1901006 |
| AF-A0A525C0B3-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.979 | 2 | 298 |
GO:0044877
GO:1901006 |
| AF-A0A7V2M250-F1-model_v4 | Epimerase | 0.977 | 137 | 301 |
GO:0044877
GO:1901006 |
| AF-A0A7V9V8J9-F1-model_v4 | NAD(P)H-binding protein | 0.9693 | 2 | 300 |
GO:0044877
GO:1901006 |
| AF-A0A2H6H442-F1-model_v4 | NAD(P)-binding domain-containing protein | 0.9677 | 2 | 298 |
GO:0044877
GO:1901006 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar