F469895

General Info

Members Datasets Scaffolds Average Seq Length
620 282 620 309

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100011470|Ga0070698_1000114703
Length 371
Sequence MTDLDVVTGAFSYSGAAIATELQAAGRRVRTLTGHPGRVPKTGAASGIEVRPLDFTDPVLLAESMRGAETLYNTYWVRFAHGGVDHPVAVARSRVLFQAAAEAGVRRIVHVSITNPSADSPYPYFRGKAAVEQALGDLGVSHAVLRPAVLFGGNGVLINNIAWLLRRLPVFAVGGTGEYRIRPIHVDDLARLAVRAGRSEATEVIDAVGPERPAFGELVHTIRNLVGSRSRIVHVPGALLPVAARALGLVLRDTLLTADEYQGMADGLADTDGPATGDTRLTQWMADHKDALGRVYANELTRHFRASPAAQRLPEGAGVGGGVDLAEPVHGDQSVDLGSGDGRVAEQFLDHPDVGAAVEHVGGERVPQRVR

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
145 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
146 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
147 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
150 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 1.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 4.19
Rhizosphere 93.23
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10095319 3300005295 Unclassified 3386
2 Ga0070658_10020995 3300005327 Bacteria 5231
3 Ga0070658_10037149 3300005327 Bacteria 3925
4 Ga0070683_100050989 3300005329 Bacteria 3833
5 Ga0070683_100239336 3300005329 Bacteria 1726
6 Ga0070670_100016510 3300005331 Bacteria 6338
7 Ga0070666_10212315 3300005335 Bacteria 1363
8 Ga0070682_100062106 3300005337 Bacteria 2366
9 Ga0070682_100248735 3300005337 Bacteria 1280
10 Ga0068868_100086820 3300005338 Bacteria 2515
11 Ga0070660_100016204 3300005339 Bacteria 5405
12 Ga0070691_10014562 3300005341 Bacteria 3609
13 Ga0070661_100016429 3300005344 Bacteria 5231
14 Ga0070671_100042991 3300005355 Bacteria 3757
15 Ga0070674_100139231 3300005356 Bacteria 1819
16 Ga0070674_100158931 3300005356 Bacteria 1713
17 Ga0070709_10171030 3300005434 Bacteria 1518
18 Ga0070709_10241047 3300005434 Bacteria 1298
19 Ga0070714_100004519 3300005435 Bacteria 10490
20 Ga0070714_100110408 3300005435 Bacteria 2434
21 Ga0070714_100195658 3300005435 Unclassified 1847
22 Ga0070714_100397291 3300005435 Bacteria 1302
23 Ga0070713_100000227 3300005436 Bacteria 37565
24 Ga0070713_100041199 3300005436 Bacteria 3761
25 Ga0070713_100547470 3300005436 Bacteria 1095
26 Ga0070710_10009936 3300005437 Unclassified 4665
27 Ga0070710_10033090 3300005437 Bacteria 2805
28 Ga0070710_10193459 3300005437 Bacteria 1280
29 Ga0070711_100002099 3300005439 Bacteria 11266
30 Ga0070711_100077229 3300005439 Bacteria 2363
31 Ga0070711_100082493 3300005439 Unclassified 2295
32 Ga0070711_100210822 3300005439 Bacteria 1504
33 Ga0070711_100276699 3300005439 Bacteria 1326
34 Ga0070705_100002171 3300005440 Bacteria 9968
35 Ga0070705_100025777 3300005440 Bacteria 3191
36 Ga0070705_100311515 3300005440 Bacteria 1132
37 Ga0070694_100258633 3300005444 Unclassified 1320
38 Ga0070708_100000079 3300005445 Bacteria 62448
39 Ga0070708_100006063 3300005445 Bacteria 9615
40 Ga0070708_100010325 3300005445 Bacteria 7562
41 Ga0070708_100010469 3300005445 Bacteria 7520
42 Ga0070708_100016299 3300005445 Bacteria 6163
43 Ga0070708_100082894 3300005445 Bacteria 2905
44 Ga0070708_100125057 3300005445 Bacteria 2376
45 Ga0070708_100151108 3300005445 Bacteria 2159
46 Ga0070708_100152011 3300005445 Bacteria 2153
47 Ga0070708_100531761 3300005445 Bacteria 1109
48 Ga0070708_100592523 3300005445 Bacteria 1045
49 Ga0070663_100006099 3300005455 Bacteria 7213
50 Ga0070678_100015683 3300005456 Bacteria 4823
51 Ga0070678_100017884 3300005456 Bacteria 4578
52 Ga0070678_100496297 3300005456 Bacteria 1076
53 Ga0070681_10052862 3300005458 Bacteria 4051
54 Ga0070681_10084060 3300005458 Bacteria 3135
55 Ga0070681_10108500 3300005458 Bacteria 2716
56 Ga0070681_10244432 3300005458 Bacteria 1708
57 Ga0070681_10451602 3300005458 Bacteria 1197
58 Ga0070706_100000056 3300005467 Bacteria 137252
59 Ga0070706_100000275 3300005467 Bacteria 62444
60 Ga0070706_100000738 3300005467 Bacteria 36905
61 Ga0070706_100002547 3300005467 Bacteria 18320
62 Ga0070706_100003078 3300005467 Bacteria 16520
63 Ga0070706_100031434 3300005467 Bacteria 4895
64 Ga0070706_100052553 3300005467 Unclassified 3760
65 Ga0070706_100084653 3300005467 Bacteria 2938
66 Ga0070706_100106949 3300005467 Bacteria 2602
67 Ga0070706_100143332 3300005467 Bacteria 2230
68 Ga0070707_100000177 3300005468 Bacteria 62444
69 Ga0070707_100000933 3300005468 Bacteria 29038
70 Ga0070707_100003748 3300005468 Bacteria 14337
71 Ga0070707_100014998 3300005468 Bacteria 7273
72 Ga0070707_100017656 3300005468 Bacteria 6712
73 Ga0070707_100020001 3300005468 Bacteria 6311
74 Ga0070707_100076148 3300005468 Bacteria 3237
75 Ga0070707_100086991 3300005468 Unclassified 3022
76 Ga0070707_100109421 3300005468 Bacteria 2680
77 Ga0070707_100157502 3300005468 Bacteria 2212
78 Ga0070707_100212860 3300005468 Bacteria 1883
79 Ga0070707_100275596 3300005468 Bacteria 1635
80 Ga0070707_100305320 3300005468 Bacteria 1546
81 Ga0070698_100000745 3300005471 Bacteria 35041
82 Ga0070698_100001003 3300005471 Bacteria 31091
83 Ga0070698_100004255 3300005471 Bacteria 15737
84 Ga0070698_100011470 3300005471 Bacteria 9405
85 Ga0070698_100049858 3300005471 Bacteria 4272
86 Ga0070698_100097832 3300005471 Bacteria 2910
87 Ga0070698_100104147 3300005471 Bacteria 2807
88 Ga0070698_100132610 3300005471 Bacteria 2446
89 Ga0070698_100142950 3300005471 Bacteria 2343
90 Ga0070698_100153543 3300005471 Bacteria 2248
91 Ga0070698_100272936 3300005471 Bacteria 1622
92 Ga0070699_100000245 3300005518 Bacteria 53369
93 Ga0070699_100000813 3300005518 Bacteria 28868
94 Ga0070699_100000981 3300005518 Bacteria 26615
95 Ga0070699_100005113 3300005518 Bacteria 11536
96 Ga0070699_100013099 3300005518 Bacteria 7147
97 Ga0070699_100025186 3300005518 Bacteria 5130
98 Ga0070699_100026247 3300005518 Bacteria 5025
99 Ga0070699_100060339 3300005518 Bacteria 3287
100 Ga0070699_100113691 3300005518 Bacteria 2378
101 Ga0070699_100142553 3300005518 Bacteria 2117
102 Ga0070699_100219441 3300005518 Bacteria 1694
103 Ga0070679_100032971 3300005530 Bacteria 5126
104 Ga0070679_100051760 3300005530 Bacteria 4090
105 Ga0070679_100105435 3300005530 Bacteria 2805
106 Ga0070684_100072443 3300005535 Bacteria 3033
107 Ga0070684_100164507 3300005535 Bacteria 2013
108 Ga0070684_100279167 3300005535 Bacteria 1530
109 Ga0070684_100318393 3300005535 Bacteria 1429
110 Ga0070697_100002762 3300005536 Bacteria 13516
111 Ga0070697_100021391 3300005536 Bacteria 5125
112 Ga0070697_100037656 3300005536 Bacteria 3908
113 Ga0070697_100040828 3300005536 Unclassified 3754
114 Ga0068853_100066238 3300005539 Bacteria 3136
115 Ga0070686_100006701 3300005544 Bacteria 6412
116 Ga0070695_100010669 3300005545 Bacteria 5490
117 Ga0070695_100096389 3300005545 Unclassified 1985
118 Ga0070696_100013207 3300005546 Bacteria 5542
119 Ga0070696_100117371 3300005546 Bacteria 1923
120 Ga0070696_100129997 3300005546 Bacteria 1831
121 Ga0070693_100230344 3300005547 Bacteria 1218
122 Ga0070665_100000050 3300005548 Bacteria 250991
123 Ga0070665_100212679 3300005548 Bacteria 1934
124 Ga0070704_100003129 3300005549 Bacteria 9439
125 Ga0068855_100065828 3300005563 Bacteria 4225
126 Ga0068855_100483564 3300005563 Bacteria 1347
127 Ga0068855_100553890 3300005563 Bacteria 1244
128 Ga0070664_100009530 3300005564 Bacteria 7874
129 Ga0068857_100009622 3300005577 Bacteria 8397
130 Ga0068856_100446842 3300005614 Bacteria 1313
131 Ga0070702_100029174 3300005615 Bacteria 2997
132 Ga0070702_100029858 3300005615 Bacteria 2968
133 Ga0068864_100223840 3300005618 Bacteria 1737
134 Ga0068864_100539223 3300005618 Bacteria 1126
135 Ga0068861_100141314 3300005719 Bacteria 1965
136 Ga0068861_100169007 3300005719 Bacteria 1811
137 Ga0068870_10017164 3300005840 Unclassified 3474
138 Ga0068863_100011662 3300005841 Bacteria 8502
139 Ga0068863_100552926 3300005841 Bacteria 1136
140 Ga0081455_10087395 3300005937 Bacteria 2536
141 Ga0081455_10221953 3300005937 Unclassified 1400
142 Ga0081539_10007469 3300005985 Bacteria 9954
143 Ga0070717_10000162 3300006028 Bacteria 50425
144 Ga0070717_10007624 3300006028 Bacteria 8044
145 Ga0070717_10055211 3300006028 Bacteria 3276
146 Ga0070717_10099565 3300006028 Unclassified 2466
147 Ga0070717_10103147 3300006028 Bacteria 2424
148 Ga0070717_10136936 3300006028 Bacteria 2109
149 Ga0070717_10220461 3300006028 Bacteria 1667
150 Ga0070717_10359799 3300006028 Bacteria 1302
151 Ga0075368_10027159 3300006042 Unclassified 2206
152 Ga0070715_10015021 3300006163 Bacteria 2880
153 Ga0070715_10020705 3300006163 Bacteria 2540
154 Ga0070715_10048634 3300006163 Bacteria 1814
155 Ga0070715_10065165 3300006163 Bacteria 1611
156 Ga0070715_10082342 3300006163 Bacteria 1463
157 Ga0070716_100002393 3300006173 Bacteria 8634
158 Ga0070716_100106625 3300006173 Bacteria 1728
159 Ga0070712_100000611 3300006175 Bacteria 20975
160 Ga0070712_100101871 3300006175 Bacteria 2125
161 Ga0075367_10024787 3300006178 Unclassified 3384
162 Ga0075367_10056488 3300006178 Bacteria 2332
163 Ga0097621_100403962 3300006237 Bacteria 1223
164 Ga0068871_100282122 3300006358 Bacteria 1453
165 Ga0068871_100343515 3300006358 Bacteria 1318
166 Ga0075428_100000151 3300006844 Bacteria 62789
167 Ga0075428_100309916 3300006844 Unclassified 1697
168 Ga0075431_100016333 3300006847 Bacteria 7530
169 Ga0075433_10040529 3300006852 Unclassified 4032
170 Ga0075433_10185874 3300006852 Unclassified 1849
171 Ga0075433_10246838 3300006852 Bacteria 1584
172 Ga0075433_10330181 3300006852 Bacteria 1349
173 Ga0075433_10404056 3300006852 Unclassified 1205
174 Ga0075434_100049482 3300006871 Bacteria 4173
175 Ga0075434_100140982 3300006871 Unclassified 2430
176 Ga0075434_100366536 3300006871 Bacteria 1462
177 Ga0075436_100007209 3300006914 Bacteria 7607
178 Ga0075436_100020773 3300006914 Bacteria 4505
179 Ga0075436_100168628 3300006914 Bacteria 1545
180 Ga0075435_100264013 3300007076 Bacteria 1467
181 Ga0099794_10004597 3300007265 Bacteria 5446
182 Ga0099794_10072169 3300007265 Bacteria 1692
183 Ga0105240_10024032 3300009093 Bacteria 8049
184 Ga0105240_10070304 3300009093 Unclassified 4331
185 Ga0105240_10565591 3300009093 Bacteria 1256
186 Ga0111539_10247061 3300009094 Bacteria 2077
187 Ga0111539_10390434 3300009094 Bacteria 1621
188 Ga0105245_10089412 3300009098 Bacteria 2831
189 Ga0105245_10473576 3300009098 Bacteria 1264
190 Ga0105247_10048085 3300009101 Bacteria 2620
191 Ga0114129_10007038 3300009147 Bacteria 16014
192 Ga0114129_10228739 3300009147 Bacteria 2505
193 Ga0114129_10857768 3300009147 Unclassified 1154
194 Ga0105243_10031948 3300009148 Bacteria 4063
195 Ga0105243_10145478 3300009148 Bacteria 2027
196 Ga0105243_10550859 3300009148 Bacteria 1102
197 Ga0105241_10120622 3300009174 Bacteria 2111
198 Ga0105242_10203436 3300009176 Bacteria 1760
199 Ga0105242_10259286 3300009176 Bacteria 1570
200 Ga0105248_10152852 3300009177 Bacteria 2604
201 Ga0105248_10686478 3300009177 Bacteria 1155
202 Ga0105237_10404254 3300009545 Bacteria 1370
203 Ga0105237_10599584 3300009545 Bacteria 1109
204 Ga0105238_10365078 3300009551 Bacteria 1434
205 Ga0105239_10438009 3300010375 Bacteria 1482
206 Ga0105246_10034156 3300011119 Bacteria 3386
207 Ga0157371_10246857 3300013102 Bacteria 1285
208 Ga0157370_10031786 3300013104 Bacteria 5160
209 Ga0157370_10380818 3300013104 Bacteria 1299
210 Ga0157369_10038511 3300013105 Bacteria 5227
211 Ga0157369_10039679 3300013105 Bacteria 5144
212 Ga0157369_10089298 3300013105 Bacteria 3290
213 Ga0157374_10087923 3300013296 Bacteria 2959
214 Ga0157374_10208348 3300013296 Bacteria 1916
215 Ga0157378_10207435 3300013297 Bacteria 1856
216 Ga0157378_10339211 3300013297 Bacteria 1465
217 Ga0163162_10062342 3300013306 Bacteria 3769
218 Ga0163162_10245708 3300013306 Bacteria 1921
219 Ga0163162_10276719 3300013306 Bacteria 1810
220 Ga0157372_10682782 3300013307 Bacteria 1195
221 Ga0157375_10152897 3300013308 Bacteria 2444
222 Ga0163163_10000034 3300014325 Bacteria 161820
223 Ga0163163_10047822 3300014325 Bacteria 4205
224 Ga0157377_10213063 3300014745 Bacteria 1233
225 Ga0157379_10183089 3300014968 Bacteria 1892
226 Ga0157376_10054572 3300014969 Bacteria 3332
227 Ga0157376_10541289 3300014969 Bacteria 1151
228 Ga0157376_10616354 3300014969 Bacteria 1082
229 Ga0163161_10027115 3300017792 Bacteria 4063
230 Ga0206356_11840338 3300020070 Bacteria 1829
231 Ga0206349_1309353 3300020075 Bacteria 2044
232 Ga0206350_10254859 3300020080 Bacteria 2013
233 Ga0206354_10453000 3300020081 Bacteria 2270
234 Ga0206353_10888380 3300020082 Bacteria 7439
235 Ga0213873_10039467 3300021358 Bacteria 1210
236 Ga0213876_10065874 3300021384 Bacteria 1912
237 Ga0213875_10091986 3300021388 Unclassified 1415
238 Ga0224712_10000892 3300022467 Bacteria 6406
239 Ga0207692_10016470 3300025898 Bacteria 3275
240 Ga0207692_10071707 3300025898 Bacteria 1828
241 Ga0207710_10030887 3300025900 Bacteria 2339
242 Ga0207688_10077873 3300025901 Bacteria 1890
243 Ga0207647_10087913 3300025904 Bacteria 1856
244 Ga0207685_10016920 3300025905 Bacteria 2344
245 Ga0207685_10050289 3300025905 Bacteria 1605
246 Ga0207699_10001466 3300025906 Bacteria 11201
247 Ga0207699_10005243 3300025906 Bacteria 6202
248 Ga0207699_10006418 3300025906 Bacteria 5694
249 Ga0207699_10085456 3300025906 Bacteria 1968
250 Ga0207643_10143791 3300025908 Unclassified 1426
251 Ga0207705_10028451 3300025909 Bacteria 3984
252 Ga0207705_10057578 3300025909 Bacteria 2803
253 Ga0207684_10000005 3300025910 Bacteria 736617
254 Ga0207684_10000014 3300025910 Bacteria 440027
255 Ga0207684_10000166 3300025910 Bacteria 111380
256 Ga0207684_10000357 3300025910 Bacteria 62516
257 Ga0207684_10001388 3300025910 Bacteria 26332
258 Ga0207684_10009940 3300025910 Bacteria 8388
259 Ga0207684_10010593 3300025910 Bacteria 8104
260 Ga0207684_10012110 3300025910 Bacteria 7509
261 Ga0207684_10012919 3300025910 Bacteria 7233
262 Ga0207684_10036668 3300025910 Bacteria 4161
263 Ga0207684_10045761 3300025910 Bacteria 3711
264 Ga0207684_10071316 3300025910 Bacteria 2952
265 Ga0207684_10140541 3300025910 Bacteria 2075
266 Ga0207707_10068223 3300025912 Bacteria 3098
267 Ga0207695_10077299 3300025913 Bacteria 3381
268 Ga0207695_10169846 3300025913 Bacteria 2107
269 Ga0207695_10376759 3300025913 Bacteria 1305
270 Ga0207693_10000091 3300025915 Bacteria 80207
271 Ga0207693_10011806 3300025915 Bacteria 7059
272 Ga0207693_10041710 3300025915 Bacteria 3612
273 Ga0207693_10309129 3300025915 Bacteria 1238
274 Ga0207693_10310742 3300025915 Bacteria 1234
275 Ga0207663_10000173 3300025916 Bacteria 29065
276 Ga0207663_10034382 3300025916 Bacteria 3030
277 Ga0207663_10037089 3300025916 Unclassified 2937
278 Ga0207663_10102142 3300025916 Bacteria 1928
279 Ga0207657_10005560 3300025919 Bacteria 13157
280 Ga0207657_10013761 3300025919 Bacteria 7921
281 Ga0207649_10012124 3300025920 Bacteria 4772
282 Ga0207652_10042325 3300025921 Bacteria 3876
283 Ga0207652_10152807 3300025921 Bacteria 2067
284 Ga0207652_10508187 3300025921 Bacteria 1085
285 Ga0207646_10000054 3300025922 Bacteria 160414
286 Ga0207646_10000113 3300025922 Bacteria 111264
287 Ga0207646_10000350 3300025922 Bacteria 62463
288 Ga0207646_10000583 3300025922 Bacteria 47784
289 Ga0207646_10002921 3300025922 Bacteria 19822
290 Ga0207646_10005533 3300025922 Bacteria 13276
291 Ga0207646_10006166 3300025922 Bacteria 12464
292 Ga0207646_10017322 3300025922 Bacteria 6744
293 Ga0207646_10022624 3300025922 Bacteria 5787
294 Ga0207646_10026838 3300025922 Bacteria 5252
295 Ga0207646_10065604 3300025922 Bacteria 3241
296 Ga0207646_10068868 3300025922 Bacteria 3161
297 Ga0207646_10116933 3300025922 Unclassified 2395
298 Ga0207646_10239813 3300025922 Bacteria 1638
299 Ga0207694_10071188 3300025924 Bacteria 2717
300 Ga0207694_10327482 3300025924 Bacteria 1265
301 Ga0207650_10005827 3300025925 Bacteria 8406
302 Ga0207659_10464862 3300025926 Bacteria 1067
303 Ga0207687_10174930 3300025927 Unclassified 1659
304 Ga0207700_10000239 3300025928 Bacteria 32830
305 Ga0207700_10034013 3300025928 Bacteria 3654
306 Ga0207700_10123913 3300025928 Bacteria 2099
307 Ga0207700_10244804 3300025928 Bacteria 1530
308 Ga0207664_10021500 3300025929 Bacteria 4799
309 Ga0207664_10033078 3300025929 Bacteria 3969
310 Ga0207664_10045665 3300025929 Unclassified 3436
311 Ga0207664_10270614 3300025929 Unclassified 1488
312 Ga0207690_10059688 3300025932 Bacteria 2585
313 Ga0207686_10082269 3300025934 Bacteria 2104
314 Ga0207709_10015039 3300025935 Bacteria 4285
315 Ga0207670_10075487 3300025936 Bacteria 2343
316 Ga0207669_10082032 3300025937 Bacteria 2069
317 Ga0207665_10002719 3300025939 Bacteria 11863
318 Ga0207665_10003816 3300025939 Bacteria 10071
319 Ga0207665_10009273 3300025939 Bacteria 6462
320 Ga0207665_10021960 3300025939 Bacteria 4196
321 Ga0207665_10075183 3300025939 Bacteria 2313
322 Ga0207665_10095027 3300025939 Bacteria 2071
323 Ga0207665_10265026 3300025939 Bacteria 1274
324 Ga0207689_10003693 3300025942 Bacteria 13951
325 Ga0207661_10026540 3300025944 Bacteria 4414
326 Ga0207712_10115865 3300025961 Bacteria 2018
327 Ga0207668_10146803 3300025972 Bacteria 1821
328 Ga0207658_10271572 3300025986 Bacteria 1450
329 Ga0207677_10230606 3300026023 Bacteria 1491
330 Ga0207639_10092547 3300026041 Bacteria 2423
331 Ga0207678_10002072 3300026067 Bacteria 18180
332 Ga0207702_10079191 3300026078 Bacteria 2847
333 Ga0207702_10470281 3300026078 Bacteria 1222
334 Ga0207648_10147145 3300026089 Bacteria 2078
335 Ga0207676_10176950 3300026095 Bacteria 1864
336 Ga0207674_10019122 3300026116 Bacteria 7425
337 Ga0207674_10056349 3300026116 Bacteria 3992
338 Ga0207674_10547810 3300026116 Bacteria 1117
339 Ga0207675_100015520 3300026118 Bacteria 7105
340 Ga0207675_100340069 3300026118 Bacteria 1469
341 Ga0207683_10003128 3300026121 Bacteria 14460
342 Ga0207683_10005655 3300026121 Bacteria 10720
343 Ga0207683_10255069 3300026121 Bacteria 1601
344 Ga0207698_10202990 3300026142 Unclassified 1777
345 Ga0207698_10433686 3300026142 Bacteria 1264
346 Ga0268266_10000241 3300028379 Bacteria 92939
347 Ga0268266_10413628 3300028379 Bacteria 1277
348 Ga0265337_1000777 3300028556 Bacteria 16812
349 Ga0265337_1013840 3300028556 Bacteria 2692
350 Ga0265334_10071062 3300028573 Bacteria 1296
351 Ga0265318_10049234 3300028577 Bacteria 1585
352 Ga0265336_10008042 3300028666 Bacteria 3720
353 Ga0265338_10000830 3300028800 Bacteria 52102
354 Ga0265338_10014824 3300028800 Bacteria 8626
355 Ga0265338_10074082 3300028800 Bacteria 2898
356 Ga0265338_10096909 3300028800 Bacteria 2418
357 Ga0265338_10099307 3300028800 Bacteria 2378
358 Ga0265338_10299109 3300028800 Bacteria 1170
359 Ga0265338_10347853 3300028800 Unclassified 1067
360 Ga0265324_10017492 3300029957 Bacteria 2607
361 Ga0265324_10017848 3300029957 Bacteria 2577
362 Ga0265760_10040336 3300031090 Bacteria 1391
363 Ga0265330_10006995 3300031235 Bacteria 5536
364 Ga0265330_10044768 3300031235 Bacteria 1953
365 Ga0265320_10000242 3300031240 Bacteria 45162
366 Ga0265320_10022604 3300031240 Bacteria 3361
367 Ga0265320_10031173 3300031240 Bacteria 2741
368 Ga0265320_10032279 3300031240 Bacteria 2683
369 Ga0265325_10000538 3300031241 Bacteria 27483
370 Ga0265325_10007316 3300031241 Bacteria 6618
371 Ga0265329_10043735 3300031242 Bacteria 1432
372 Ga0265340_10025983 3300031247 Bacteria 2963
373 Ga0265340_10034948 3300031247 Bacteria 2497
374 Ga0265340_10099170 3300031247 Unclassified 1355
375 Ga0265339_10000350 3300031249 Bacteria 36667
376 Ga0265339_10091780 3300031249 Bacteria 1591
377 Ga0265339_10101484 3300031249 Bacteria 1497
378 Ga0265331_10012584 3300031250 Bacteria 4576
379 Ga0265331_10091710 3300031250 Unclassified 1403
380 Ga0265327_10002340 3300031251 Bacteria 20214
381 Ga0265327_10003849 3300031251 Bacteria 13861
382 Ga0265316_10000706 3300031344 Bacteria 36971
383 Ga0265316_10003202 3300031344 Bacteria 16637
384 Ga0265316_10054150 3300031344 Bacteria 3141
385 Ga0265313_10000142 3300031595 Bacteria 74294
386 Ga0316579_10001589 3300031691 Bacteria 8298
387 Ga0265314_10001717 3300031711 Bacteria 23774
388 Ga0265314_10003842 3300031711 Bacteria 14324
389 Ga0265314_10186544 3300031711 Unclassified 1238
390 Ga0265342_10029830 3300031712 Bacteria 3384
391 Ga0316578_10050760 3300031728 Bacteria 2427
392 Ga0307410_10002640 3300031852 Bacteria 8736
393 Ga0307416_100002595 3300032002 Bacteria 10433
394 Ga0307416_100369901 3300032002 Bacteria 1459
395 Ga0373948_0020360 3300034817 Bacteria 1263
396 Ga0373926_0021797 3300035083 Bacteria 2219
397 Ga0373926_0024226 3300035083 Bacteria 2112
398 Ga0373944_0000594 3300035089 Bacteria 8596
399 Ga0373945_0000010 3300035116 Bacteria 41491
400 Ga0373943_0002157 3300035170 Bacteria 8947
401 Ga0373943_0009057 3300035170 Bacteria 4463
402 Ga0373946_0000330 3300035171 Bacteria 15358
403 Ga0373955_0030722 3300035172 Bacteria 2808
404 Ga0373955_0112112 3300035172 Bacteria 1578
405 Ga0373924_0024766 3300035410 Bacteria 2367
406 Ga0373931_0027108 3300035691 Bacteria 2921
407 Ga0373931_0078035 3300035691 Bacteria 1821
408 Ga0373935_0036921 3300035692 Bacteria 3056
409 Ga0373935_0117800 3300035692 Bacteria 1770
410 Ga0373927_0011110 3300035695 Bacteria 5997
411 Ga0373927_0034426 3300035695 Bacteria 3294
412 Ga0373933_0024052 3300035724 Bacteria 3486
413 Ga0373947_0001234 3300035725 Bacteria 15729
414 Ga0373947_0002280 3300035725 Bacteria 11593
415 Ga0373947_0072423 3300035725 Unclassified 2116
416 Ga0373937_0156020 3300036401 Bacteria 2139
417 Ga0373925_0001250 3300037068 Bacteria 22415
418 Ga0373925_0019060 3300037068 Bacteria 4988
419 Ga0373925_0060929 3300037068 Unclassified 2834
420 Ga0373925_0189052 3300037068 Bacteria 1633
421 Ga0373925_0324360 3300037068 Bacteria 1247
422 Ga0395899_0076799 3300037312 Bacteria 2438
423 Ga0395899_0110669 3300037312 Unclassified 1975
424 Ga0395898_0062004 3300037466 Bacteria 3632
425 Ga0395905_0015220 3300037471 Bacteria 7315
426 Ga0395905_0419413 3300037471 Unclassified 1234
427 Ga0436364_0757267 3300037853 Bacteria 15097
428 Ga0395901_0551059 3300038443 Unclassified 1169
429 Ga0400489_28569 3300039093 Archaea 1878
430 Ga0436365_0127369 3300039437 Unclassified 1970
431 Ga0436365_0610234 3300039437 Bacteria 4952
432 Ga0436365_0950920 3300039437 Bacteria 1908
433 Ga0436365_1773926 3300039437 Bacteria 5608
434 Ga0436363_0303774 3300039450 Bacteria 7764
435 Ga0436363_0624304 3300039450 Bacteria 9320
436 Ga0436362_0749635 3300039453 Bacteria 1496
437 Ga0436362_1085911 3300039453 Bacteria 1241
438 Ga0451577_0001538 3300042876 Bacteria 30262
439 Ga0451577_0078980 3300042876 Bacteria 2933
440 Ga0451577_0155668 3300042876 Bacteria 2057
441 Ga0466969_0067262 3300044656 Bacteria 1729
442 Ga0453683_0011755 3300044673 Bacteria 5764
443 Ga0466963_0007334 3300044694 Bacteria 6570
444 Ga0453684_0001274 3300044712 Bacteria 75355
445 Ga0453684_0001763 3300044712 Bacteria 57728
446 Ga0453684_0002381 3300044712 Bacteria 45887
447 Ga0453684_0002426 3300044712 Bacteria 45351
448 Ga0453684_0002930 3300044712 Bacteria 40014
449 Ga0453684_0006387 3300044712 Bacteria 22454
450 Ga0453684_0015242 3300044712 Bacteria 12190
451 Ga0453684_0026747 3300044712 Bacteria 8315
452 Ga0453684_0036894 3300044712 Bacteria 6724
453 Ga0453684_0058479 3300044712 Bacteria 4979
454 Ga0453684_0175839 3300044712 Bacteria 2518
455 Ga0453684_0375199 3300044712 Bacteria 1598
456 Ga0453684_0667497 3300044712 Bacteria 1133
457 Ga0466968_0010067 3300044735 Bacteria 3655
458 Ga0466957_0008051 3300044842 Bacteria 5979
459 Ga0466959_0021507 3300045049 Bacteria 4758
460 Ga0451576_0005212 3300045051 Bacteria 16419
461 Ga0451576_0011246 3300045051 Bacteria 10189
462 Ga0451576_0122333 3300045051 Bacteria 2710
463 Ga0451576_0351792 3300045051 Unclassified 1542
464 Ga0451576_0514924 3300045051 Bacteria 1257
465 Ga0466958_0029234 3300045836 Bacteria 3270
466 Ga0466958_0185254 3300045836 Bacteria 1322
467 Ga0466967_0051411 3300045976 Bacteria 3611
468 Ga0466967_0346793 3300045976 Bacteria 1437
469 Ga0495629_0048763 3300046459 Unclassified 2969
470 Ga0495629_0061609 3300046459 Bacteria 2622
471 Ga0495653_0002194 3300046463 Bacteria 15445
472 Ga0495653_0003548 3300046463 Bacteria 12565
473 Ga0495653_0075124 3300046463 Bacteria 2516
474 Ga0495580_0006177 3300046472 Bacteria 9791
475 Ga0495580_0031364 3300046472 Bacteria 3841
476 Ga0495582_0074040 3300046473 Bacteria 1885
477 Ga0495639_0022713 3300046475 Bacteria 2753
478 Ga0495584_0130044 3300046491 Bacteria 1277
479 Ga0495608_0030580 3300046511 Bacteria 3645
480 Ga0495608_0085910 3300046511 Bacteria 2039
481 Ga0495618_0028612 3300046514 Bacteria 3474
482 Ga0495628_0019552 3300046516 Bacteria 5597
483 Ga0495628_0021920 3300046516 Bacteria 5250
484 Ga0495628_0111398 3300046516 Bacteria 2105
485 Ga0495630_0000305 3300046517 Bacteria 39378
486 Ga0495630_0047439 3300046517 Bacteria 3213
487 Ga0495666_0015470 3300046526 Unclassified 3798
488 Ga0495666_0049120 3300046526 Bacteria 2030
489 Ga0495666_0147778 3300046526 Unclassified 1094
490 Ga0495652_0031195 3300046529 Bacteria 4669
491 Ga0495652_0191762 3300046529 Bacteria 1559
492 Ga0495652_0306915 3300046529 Bacteria 1151
493 Ga0495652_0342958 3300046529 Bacteria 1073
494 Ga0495665_0008974 3300046531 Bacteria 5425
495 Ga0495665_0066442 3300046531 Bacteria 1903
496 Ga0495640_0005886 3300046533 Bacteria 9724
497 Ga0495640_0062811 3300046533 Unclassified 2518
498 Ga0495640_0082906 3300046533 Bacteria 2128
499 Ga0495586_0000271 3300046535 Bacteria 33410
500 Ga0495587_0102507 3300046536 Bacteria 1647
501 Ga0495587_0167616 3300046536 Bacteria 1248
502 Ga0495645_0016127 3300046543 Bacteria 5325
503 Ga0495645_0053396 3300046543 Bacteria 2938
504 Ga0495667_0004069 3300046559 Bacteria 9827
505 Ga0495667_0052667 3300046559 Bacteria 2680
506 Ga0495667_0186630 3300046559 Bacteria 1329
507 Ga0495634_0033832 3300046642 Bacteria 3510
508 Ga0495635_0000459 3300046663 Bacteria 25781
509 Ga0495635_0039739 3300046663 Bacteria 3253
510 Ga0495657_0014756 3300046675 Bacteria 5734
511 Ga0495657_0156632 3300046675 Bacteria 1411
512 Ga0495599_0049095 3300046678 Bacteria 2645
513 Ga0495599_0106009 3300046678 Bacteria 1751
514 Ga0495599_0118814 3300046678 Bacteria 1643
515 Ga0495646_0214689 3300046680 Unclassified 1042
516 Ga0495658_0035953 3300046683 Unclassified 2729
517 Ga0495613_0016898 3300046689 Bacteria 5433
518 Ga0495613_0046391 3300046689 Unclassified 3213
519 Ga0495624_0006532 3300046690 Bacteria 8264
520 Ga0495581_0029249 3300047315 Bacteria 3194
521 Ga0495581_0197327 3300047315 Bacteria 1177
522 Ga0495604_0000834 3300047317 Bacteria 25747
523 Ga0495674_0000767 3300047319 Bacteria 30476
524 Ga0495674_0006061 3300047319 Bacteria 11602
525 Ga0495674_0137390 3300047319 Bacteria 2056
526 Ga0495674_0231375 3300047319 Bacteria 1525
527 Ga0495676_0011793 3300047321 Bacteria 7883
528 Ga0495676_0021657 3300047321 Bacteria 5608
529 Ga0495676_0036383 3300047321 Bacteria 4112
530 Ga0495680_0035336 3300047322 Bacteria 4026
531 Ga0495680_0230638 3300047322 Bacteria 1318
532 Ga0495675_0035000 3300047444 Bacteria 3207
533 Ga0495675_0153935 3300047444 Bacteria 1419
534 Ga0495684_0003770 3300047471 Bacteria 11833
535 Ga0495684_0099607 3300047471 Bacteria 2197
536 Ga0495593_0033987 3300047673 Bacteria 2775
537 Ga0496101_0454596 3300048904 Bacteria 1010
538 Ga0496102_0069465 3300048905 Bacteria 3233
539 Ga0496102_0151747 3300048905 Bacteria 2177
540 Ga0496102_0254320 3300048905 Bacteria 1656
541 Ga0496105_0015428 3300048908 Bacteria 6088
542 Ga0496105_0210462 3300048908 Bacteria 1585
543 Ga0496105_0246506 3300048908 Bacteria 1448
544 Ga0496107_0067737 3300048910 Bacteria 2590
545 Ga0496107_0278413 3300048910 Bacteria 1245
546 Ga0496108_0163002 3300048911 Bacteria 1927
547 Ga0496109_0008477 3300048912 Bacteria 8740
548 Ga0496109_0178046 3300048912 Bacteria 1996
549 Ga0496110_0137495 3300048913 Bacteria 2208
550 Ga0496110_0326152 3300048913 Bacteria 1398
551 Ga0496110_0349060 3300048913 Bacteria 1348
552 Ga0496111_0005569 3300048914 Bacteria 8093
553 Ga0496112_0197487 3300048915 Bacteria 1972
554 Ga0496113_0101478 3300048916 Bacteria 2230
555 Ga0496113_0256597 3300048916 Bacteria 1396
556 Ga0496113_0328366 3300048916 Bacteria 1226
557 Ga0496114_0043817 3300048917 Bacteria 3711
558 Ga0496114_0062181 3300048917 Bacteria 3125
559 Ga0496114_0125118 3300048917 Bacteria 2215
560 Ga0496114_0138194 3300048917 Bacteria 2108
561 Ga0496115_0098433 3300048918 Bacteria 2395
562 Ga0496115_0224718 3300048918 Unclassified 1549
563 Ga0501031_0009421 3300049568 Bacteria 6346
564 Ga0501032_0016268 3300049569 Bacteria 5234
565 Ga0501036_0055268 3300049572 Unclassified 3363
566 Ga0501036_0208795 3300049572 Bacteria 1641
567 Ga0501040_0010167 3300049576 Bacteria 6151
568 Ga0501040_0095986 3300049576 Unclassified 2064
569 Ga0501042_0004880 3300049578 Bacteria 8579
570 Ga0501042_0335308 3300049578 Bacteria 1093
571 Ga0501046_0173074 3300049580 Bacteria 1619
572 Ga0501048_0380351 3300049582 Unclassified 1008
573 Ga0501068_0037696 3300049584 Bacteria 2894
574 Ga0501070_0006969 3300049586 Bacteria 9613
575 Ga0501070_0436448 3300049586 Bacteria 1057
576 Ga0501071_0074543 3300049587 Bacteria 2477
577 Ga0501072_0068792 3300049588 Bacteria 2794
578 Ga0501072_0140359 3300049588 Unclassified 1926
579 Ga0501074_0176219 3300049590 Unclassified 1526
580 Ga0501075_0253718 3300049591 Unclassified 1341
581 Ga0501076_0236546 3300049592 Bacteria 1493
582 Ga0501077_0061645 3300049593 Bacteria 2380
583 Ga0501079_0164090 3300049741 Bacteria 1732
584 Ga0501080_0024362 3300049742 Bacteria 5610
585 Ga0501080_0184341 3300049742 Unclassified 1920
586 Ga0501044_0045348 3300049823 Bacteria 4555
587 Ga0501045_0008806 3300049824 Bacteria 7046
588 Ga0501045_0122212 3300049824 Unclassified 1933
589 Ga0501045_0331141 3300049824 Bacteria 1133
590 nmdc:mga06z11_30421_c1 3300050494 Bacteria 2612
591 nmdc:mga06z11_72581_c1 3300050494 Bacteria 1825
592 nmdc:mga04h51_15389_c1 3300050495 Unclassified 2203
593 nmdc:mga05p37_237934_c1 3300050507 Bacteria 2191
594 nmdc:mga06r32_138714_c1 3300050510 Bacteria 2407
595 nmdc:mga08y16_223347_c1 3300050511 Bacteria 1949
596 nmdc:mga08y16_47847_c1 3300050511 Unclassified 4476
597 nmdc:mga0n895_155624_c1 3300050512 Bacteria 2316
598 nmdc:mga0n895_281135_c1 3300050512 Unclassified 1688
599 nmdc:mga0n895_374689_c1 3300050512 Bacteria 1441
600 nmdc:mga0n895_468755_c1 3300050512 Unclassified 1270
601 nmdc:mga0rr50_173255_c1 3300050513 Bacteria 1760
602 nmdc:mga08x19_101180_c1 3300050514 Bacteria 1912
603 nmdc:mga08x19_134_c1 3300050514 Bacteria 65861
604 nmdc:mga08x19_137080_c1 3300050514 Bacteria 1651
605 nmdc:mga08x19_139514_c1 3300050514 Bacteria 1637
606 nmdc:mga08x19_141072_c1 3300050514 Bacteria 1628
607 nmdc:mga08x19_27535_c1 3300050514 Bacteria 3555
608 nmdc:mga0a205_181634_c1 3300050515 Bacteria 1998
609 nmdc:mga0a205_77014_c1 3300050515 Unclassified 3223
610 Ga0495601_0037940 3300053077 Bacteria 3012
611 Ga0495655_0001038 3300053083 Bacteria 4289
612 Ga0495595_0057117 3300053084 Bacteria 1820
613 Ga0495619_0010569 3300053085 Bacteria 5809
614 Ga0495619_0032127 3300053085 Bacteria 3405
615 Ga0501082_0176512 3300060353 Unclassified 1857
616 Ga0501082_0233295 3300060353 Bacteria 1601
617 Ga0466962_0007829 3300061719 Bacteria 5124
618 Ga0466962_0030545 3300061719 Bacteria 2581
619 Ga0530510_0008203 3300061734 Bacteria 7285
620 Ga0530510_0166850 3300061734 Bacteria 1630

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0551059 Ga0395901_0551059_33_839 262
2 3300046472 Ga0495580_0006177 Ga0495580_0006177_3743_4567 264
3 3300046526 Ga0495666_0147778 Ga0495666_0147778_211_1035 264
4 3300049582 Ga0501048_0380351 Ga0501048_0380351_141_956 267
5 3300049590 Ga0501074_0176219 Ga0501074_0176219_700_1515 267
6 3300005445 Ga0070708_100531761 Ga0070708_1005317612 272
7 3300028800 Ga0265338_10014824 Ga0265338_100148242 272
8 3300006852 Ga0075433_10330181 Ga0075433_103301811 277
9 3300045051 Ga0451576_0351792 Ga0451576_0351792_573_1514 281
10 3300005329 Ga0070683_100239336 Ga0070683_1002393361 284
11 3300049824 Ga0501045_0331141 Ga0501045_0331141_117_1046 285
12 3300005937 Ga0081455_10221953 Ga0081455_102219531 286
13 3300025910 Ga0207684_10012919 Ga0207684_100129195 286
14 3300020075 Ga0206349_1309353 Ga0206349_13093533 291
15 3300039093 Ga0400489_28569 Ga0400489_28569_163_1104 291
16 3300037312 Ga0395899_0076799 Ga0395899_0076799_278_1174 292
17 3300037466 Ga0395898_0062004 Ga0395898_0062004_1948_2844 292
18 3300037471 Ga0395905_0015220 Ga0395905_0015220_4566_5462 292
19 3300006042 Ga0075368_10027159 Ga0075368_100271592 293
20 3300006178 Ga0075367_10024787 Ga0075367_100247872 293
21 3300006178 Ga0075367_10056488 Ga0075367_100564883 293
22 3300009147 Ga0114129_10228739 Ga0114129_102287393 293
23 3300031251 Ga0265327_10002340 Ga0265327_100023406 293
24 3300049569 Ga0501032_0016268 Ga0501032_0016268_3137_4060 293
25 3300049584 Ga0501068_0037696 Ga0501068_0037696_1569_2474 293
26 3300049586 Ga0501070_0006969 Ga0501070_0006969_5114_6037 293
27 3300049823 Ga0501044_0045348 Ga0501044_0045348_3160_4083 293
28 3300050494 nmdc:mga06z11_30421_c1 nmdc:mga06z11_30421_c1_1280_2284 293
29 3300050494 nmdc:mga06z11_72581_c1 nmdc:mga06z11_72581_c1_828_1760 293
30 3300050495 nmdc:mga04h51_15389_c1 nmdc:mga04h51_15389_c1_468_1400 293
31 3300005518 Ga0070699_100026247 Ga0070699_1000262474 294
32 3300005356 Ga0070674_100139231 Ga0070674_1001392312 295
33 3300005445 Ga0070708_100152011 Ga0070708_1001520112 295
34 3300005456 Ga0070678_100496297 Ga0070678_1004962971 295
35 3300005615 Ga0070702_100029858 Ga0070702_1000298583 295
36 3300006914 Ga0075436_100020773 Ga0075436_1000207736 295
37 3300009148 Ga0105243_10145478 Ga0105243_101454782 295
38 3300013306 Ga0163162_10062342 Ga0163162_100623423 295
39 3300013308 Ga0157375_10152897 Ga0157375_101528973 295
40 3300025906 Ga0207699_10085456 Ga0207699_100854562 295
41 3300025934 Ga0207686_10082269 Ga0207686_100822692 295
42 3300025972 Ga0207668_10146803 Ga0207668_101468032 295
43 3300026121 Ga0207683_10255069 Ga0207683_102550692 295
44 3300042876 Ga0451577_0001538 Ga0451577_0001538_752_1693 295
45 3300044712 Ga0453684_0002381 Ga0453684_0002381_759_1700 295
46 3300045976 Ga0466967_0346793 Ga0466967_0346793_426_1334 295
47 3300048917 Ga0496114_0062181 Ga0496114_0062181_632_1561 295
48 3300049578 Ga0501042_0335308 Ga0501042_0335308_100_1035 295
49 3300049587 Ga0501071_0074543 Ga0501071_0074543_47_982 295
50 3300049591 Ga0501075_0253718 Ga0501075_0253718_362_1297 295
51 3300049593 Ga0501077_0061645 Ga0501077_0061645_869_1804 295
52 3300050514 nmdc:mga08x19_27535_c1 nmdc:mga08x19_27535_c1_752_1663 295
53 3300060353 Ga0501082_0233295 Ga0501082_0233295_520_1455 295
54 3300005840 Ga0068870_10017164 Ga0068870_100171641 296
55 3300006914 Ga0075436_100168628 Ga0075436_1001686282 296
56 3300014325 Ga0163163_10000034 Ga0163163_10000034130 296
57 3300014969 Ga0157376_10541289 Ga0157376_105412891 296
58 3300025908 Ga0207643_10143791 Ga0207643_101437912 296
59 3300045051 Ga0451576_0011246 Ga0451576_0011246_5855_6760 296
60 3300048917 Ga0496114_0138194 Ga0496114_0138194_85_990 296
61 3300049572 Ga0501036_0055268 Ga0501036_0055268_1098_2012 296
62 3300049576 Ga0501040_0095986 Ga0501040_0095986_635_1549 296
63 3300049580 Ga0501046_0173074 Ga0501046_0173074_638_1552 296
64 3300049588 Ga0501072_0140359 Ga0501072_0140359_787_1701 296
65 3300049742 Ga0501080_0184341 Ga0501080_0184341_288_1202 296
66 3300049824 Ga0501045_0122212 Ga0501045_0122212_1001_1915 296
67 3300050514 nmdc:mga08x19_141072_c1 nmdc:mga08x19_141072_c1_189_1103 296
68 3300060353 Ga0501082_0176512 Ga0501082_0176512_74_988 296
69 3300005436 Ga0070713_100041199 Ga0070713_1000411993 297
70 3300005440 Ga0070705_100002171 Ga0070705_1000021712 297
71 3300005440 Ga0070705_100025777 Ga0070705_1000257772 297
72 3300005444 Ga0070694_100258633 Ga0070694_1002586332 297
73 3300005445 Ga0070708_100000079 Ga0070708_10000007954 297
74 3300005445 Ga0070708_100010469 Ga0070708_1000104693 297
75 3300005445 Ga0070708_100016299 Ga0070708_1000162996 297
76 3300005445 Ga0070708_100082894 Ga0070708_1000828943 297
77 3300005445 Ga0070708_100151108 Ga0070708_1001511082 297
78 3300005467 Ga0070706_100000056 Ga0070706_10000005647 297
79 3300005467 Ga0070706_100000275 Ga0070706_10000027554 297
80 3300005467 Ga0070706_100000738 Ga0070706_1000007389 297
81 3300005467 Ga0070706_100002547 Ga0070706_1000025478 297
82 3300005467 Ga0070706_100143332 Ga0070706_1001433322 297
83 3300005468 Ga0070707_100000177 Ga0070707_10000017720 297
84 3300005468 Ga0070707_100017656 Ga0070707_1000176564 297
85 3300005468 Ga0070707_100020001 Ga0070707_1000200019 297
86 3300005468 Ga0070707_100076148 Ga0070707_1000761483 297
87 3300005468 Ga0070707_100109421 Ga0070707_1001094212 297
88 3300005468 Ga0070707_100157502 Ga0070707_1001575022 297
89 3300005468 Ga0070707_100305320 Ga0070707_1003053202 297
90 3300005471 Ga0070698_100001003 Ga0070698_10000100311 297
91 3300005471 Ga0070698_100004255 Ga0070698_1000042554 297
92 3300005471 Ga0070698_100049858 Ga0070698_1000498582 297
93 3300005471 Ga0070698_100097832 Ga0070698_1000978323 297
94 3300005471 Ga0070698_100153543 Ga0070698_1001535432 297
95 3300005518 Ga0070699_100000245 Ga0070699_1000002458 297
96 3300005518 Ga0070699_100000813 Ga0070699_10000081313 297
97 3300005518 Ga0070699_100000981 Ga0070699_1000009818 297
98 3300005518 Ga0070699_100005113 Ga0070699_1000051139 297
99 3300005518 Ga0070699_100219441 Ga0070699_1002194412 297
100 3300005536 Ga0070697_100002762 Ga0070697_1000027625 297
101 3300005536 Ga0070697_100037656 Ga0070697_1000376563 297
102 3300005545 Ga0070695_100010669 Ga0070695_1000106694 297
103 3300005545 Ga0070695_100096389 Ga0070695_1000963892 297
104 3300005549 Ga0070704_100003129 Ga0070704_1000031299 297
105 3300006028 Ga0070717_10000162 Ga0070717_1000016211 297
106 3300006852 Ga0075433_10185874 Ga0075433_101858742 297
107 3300006871 Ga0075434_100049482 Ga0075434_1000494822 297
108 3300007076 Ga0075435_100264013 Ga0075435_1002640132 297
109 3300007265 Ga0099794_10004597 Ga0099794_100045974 297
110 3300007265 Ga0099794_10072169 Ga0099794_100721692 297
111 3300025910 Ga0207684_10000005 Ga0207684_1000000555 297
112 3300025910 Ga0207684_10000014 Ga0207684_1000001460 297
113 3300025910 Ga0207684_10000166 Ga0207684_1000016672 297
114 3300025910 Ga0207684_10000357 Ga0207684_1000035720 297
115 3300025910 Ga0207684_10001388 Ga0207684_100013882 297
116 3300025910 Ga0207684_10009940 Ga0207684_100099403 297
117 3300025910 Ga0207684_10045761 Ga0207684_100457613 297
118 3300025922 Ga0207646_10000113 Ga0207646_1000011321 297
119 3300025922 Ga0207646_10000350 Ga0207646_1000035020 297
120 3300025922 Ga0207646_10000583 Ga0207646_1000058344 297
121 3300025922 Ga0207646_10002921 Ga0207646_1000292114 297
122 3300025922 Ga0207646_10005533 Ga0207646_1000553317 297
123 3300025922 Ga0207646_10006166 Ga0207646_100061669 297
124 3300025922 Ga0207646_10017322 Ga0207646_100173225 297
125 3300025922 Ga0207646_10068868 Ga0207646_100688683 297
126 3300025922 Ga0207646_10116933 Ga0207646_101169332 297
127 3300025928 Ga0207700_10244804 Ga0207700_102448042 297
128 3300025939 Ga0207665_10009273 Ga0207665_100092736 297
129 3300025939 Ga0207665_10075183 Ga0207665_100751832 297
130 3300028800 Ga0265338_10099307 Ga0265338_100993073 297
131 3300031241 Ga0265325_10007316 Ga0265325_100073166 297
132 3300045051 Ga0451576_0005212 Ga0451576_0005212_14392_15309 297
133 3300050512 nmdc:mga0n895_281135_c1 nmdc:mga0n895_281135_c1_335_1243 297
134 3300050512 nmdc:mga0n895_468755_c1 nmdc:mga0n895_468755_c1_108_1025 297
135 3300050513 nmdc:mga0rr50_173255_c1 nmdc:mga0rr50_173255_c1_407_1315 297
136 3300050514 nmdc:mga08x19_137080_c1 nmdc:mga08x19_137080_c1_525_1433 297
137 3300050514 nmdc:mga08x19_139514_c1 nmdc:mga08x19_139514_c1_446_1354 297
138 3300050515 nmdc:mga0a205_181634_c1 nmdc:mga0a205_181634_c1_128_1036 297
139 3300005331 Ga0070670_100016510 Ga0070670_1000165106 298
140 3300005467 Ga0070706_100031434 Ga0070706_1000314341 298
141 3300005467 Ga0070706_100106949 Ga0070706_1001069492 298
142 3300005471 Ga0070698_100142950 Ga0070698_1001429502 298
143 3300005471 Ga0070698_100272936 Ga0070698_1002729362 298
144 3300005518 Ga0070699_100060339 Ga0070699_1000603395 298
145 3300005518 Ga0070699_100113691 Ga0070699_1001136912 298
146 3300005577 Ga0068857_100009622 Ga0068857_1000096225 298
147 3300006844 Ga0075428_100309916 Ga0075428_1003099162 298
148 3300009177 Ga0105248_10686478 Ga0105248_106864782 298
149 3300025910 Ga0207684_10010593 Ga0207684_100105939 298
150 3300025910 Ga0207684_10036668 Ga0207684_100366685 298
151 3300025925 Ga0207650_10005827 Ga0207650_100058272 298
152 3300026116 Ga0207674_10019122 Ga0207674_100191227 298
153 3300031251 Ga0265327_10003849 Ga0265327_100038499 298
154 3300035725 Ga0373947_0072423 Ga0373947_0072423_740_1645 298
155 3300046459 Ga0495629_0061609 Ga0495629_0061609_383_1324 298
156 3300046516 Ga0495628_0111398 Ga0495628_0111398_1026_1943 298
157 3300046529 Ga0495652_0342958 Ga0495652_0342958_100_1017 298
158 3300047319 Ga0495674_0137390 Ga0495674_0137390_148_1062 298
159 3300047321 Ga0495676_0036383 Ga0495676_0036383_2854_3759 298
160 3300053084 Ga0495595_0057117 Ga0495595_0057117_314_1228 298
161 3300005327 Ga0070658_10020995 Ga0070658_100209954 299
162 3300005327 Ga0070658_10037149 Ga0070658_100371492 299
163 3300005329 Ga0070683_100050989 Ga0070683_1000509892 299
164 3300005335 Ga0070666_10212315 Ga0070666_102123152 299
165 3300005337 Ga0070682_100062106 Ga0070682_1000621062 299
166 3300005337 Ga0070682_100248735 Ga0070682_1002487351 299
167 3300005338 Ga0068868_100086820 Ga0068868_1000868203 299
168 3300005341 Ga0070691_10014562 Ga0070691_100145622 299
169 3300005344 Ga0070661_100016429 Ga0070661_1000164294 299
170 3300005355 Ga0070671_100042991 Ga0070671_1000429914 299
171 3300005356 Ga0070674_100158931 Ga0070674_1001589312 299
172 3300005434 Ga0070709_10171030 Ga0070709_101710302 299
173 3300005434 Ga0070709_10241047 Ga0070709_102410472 299
174 3300005435 Ga0070714_100004519 Ga0070714_1000045194 299
175 3300005435 Ga0070714_100110408 Ga0070714_1001104082 299
176 3300005435 Ga0070714_100397291 Ga0070714_1003972912 299
177 3300005436 Ga0070713_100000227 Ga0070713_10000022711 299
178 3300005436 Ga0070713_100547470 Ga0070713_1005474701 299
179 3300005437 Ga0070710_10009936 Ga0070710_100099367 299
180 3300005437 Ga0070710_10033090 Ga0070710_100330902 299
181 3300005437 Ga0070710_10193459 Ga0070710_101934591 299
182 3300005439 Ga0070711_100002099 Ga0070711_1000020993 299
183 3300005439 Ga0070711_100077229 Ga0070711_1000772292 299
184 3300005439 Ga0070711_100210822 Ga0070711_1002108222 299
185 3300005439 Ga0070711_100276699 Ga0070711_1002766992 299
186 3300005440 Ga0070705_100311515 Ga0070705_1003115151 299
187 3300005455 Ga0070663_100006099 Ga0070663_1000060992 299
188 3300005456 Ga0070678_100015683 Ga0070678_1000156833 299
189 3300005456 Ga0070678_100017884 Ga0070678_1000178845 299
190 3300005458 Ga0070681_10084060 Ga0070681_100840602 299
191 3300005458 Ga0070681_10108500 Ga0070681_101085003 299
192 3300005458 Ga0070681_10451602 Ga0070681_104516022 299
193 3300005467 Ga0070706_100084653 Ga0070706_1000846533 299
194 3300005468 Ga0070707_100003748 Ga0070707_1000037488 299
195 3300005468 Ga0070707_100212860 Ga0070707_1002128602 299
196 3300005471 Ga0070698_100011470 Ga0070698_1000114703 299
197 3300005518 Ga0070699_100025186 Ga0070699_1000251864 299
198 3300005518 Ga0070699_100142553 Ga0070699_1001425532 299
199 3300005530 Ga0070679_100032971 Ga0070679_1000329712 299
200 3300005530 Ga0070679_100051760 Ga0070679_1000517604 299
201 3300005530 Ga0070679_100105435 Ga0070679_1001054352 299
202 3300005535 Ga0070684_100164507 Ga0070684_1001645073 299
203 3300005535 Ga0070684_100279167 Ga0070684_1002791672 299
204 3300005535 Ga0070684_100318393 Ga0070684_1003183932 299
205 3300005539 Ga0068853_100066238 Ga0068853_1000662381 299
206 3300005544 Ga0070686_100006701 Ga0070686_1000067016 299
207 3300005546 Ga0070696_100013207 Ga0070696_1000132073 299
208 3300005546 Ga0070696_100129997 Ga0070696_1001299972 299
209 3300005547 Ga0070693_100230344 Ga0070693_1002303441 299
210 3300005548 Ga0070665_100212679 Ga0070665_1002126792 299
211 3300005563 Ga0068855_100065828 Ga0068855_1000658282 299
212 3300005563 Ga0068855_100483564 Ga0068855_1004835642 299
213 3300005563 Ga0068855_100553890 Ga0068855_1005538902 299
214 3300005564 Ga0070664_100009530 Ga0070664_1000095303 299
215 3300005614 Ga0068856_100446842 Ga0068856_1004468422 299
216 3300005615 Ga0070702_100029174 Ga0070702_1000291741 299
217 3300005618 Ga0068864_100223840 Ga0068864_1002238402 299
218 3300005618 Ga0068864_100539223 Ga0068864_1005392232 299
219 3300005719 Ga0068861_100169007 Ga0068861_1001690072 299
220 3300005841 Ga0068863_100011662 Ga0068863_1000116625 299
221 3300005841 Ga0068863_100552926 Ga0068863_1005529262 299
222 3300006028 Ga0070717_10055211 Ga0070717_100552112 299
223 3300006028 Ga0070717_10099565 Ga0070717_100995652 299
224 3300006028 Ga0070717_10136936 Ga0070717_101369362 299
225 3300006028 Ga0070717_10359799 Ga0070717_103597992 299
226 3300006163 Ga0070715_10015021 Ga0070715_100150211 299
227 3300006163 Ga0070715_10020705 Ga0070715_100207052 299
228 3300006163 Ga0070715_10048634 Ga0070715_100486342 299
229 3300006163 Ga0070715_10065165 Ga0070715_100651651 299
230 3300006163 Ga0070715_10082342 Ga0070715_100823422 299
231 3300006173 Ga0070716_100002393 Ga0070716_1000023931 299
232 3300006173 Ga0070716_100106625 Ga0070716_1001066252 299
233 3300006175 Ga0070712_100000611 Ga0070712_10000061117 299
234 3300006175 Ga0070712_100101871 Ga0070712_1001018712 299
235 3300006237 Ga0097621_100403962 Ga0097621_1004039622 299
236 3300006358 Ga0068871_100282122 Ga0068871_1002821222 299
237 3300006358 Ga0068871_100343515 Ga0068871_1003435152 299
238 3300006844 Ga0075428_100000151 Ga0075428_10000015139 299
239 3300006871 Ga0075434_100366536 Ga0075434_1003665361 299
240 3300006914 Ga0075436_100007209 Ga0075436_1000072097 299
241 3300009093 Ga0105240_10024032 Ga0105240_100240328 299
242 3300009093 Ga0105240_10070304 Ga0105240_100703044 299
243 3300009093 Ga0105240_10565591 Ga0105240_105655912 299
244 3300009098 Ga0105245_10089412 Ga0105245_100894123 299
245 3300009098 Ga0105245_10473576 Ga0105245_104735762 299
246 3300009101 Ga0105247_10048085 Ga0105247_100480852 299
247 3300009147 Ga0114129_10857768 Ga0114129_108577681 299
248 3300009148 Ga0105243_10031948 Ga0105243_100319483 299
249 3300009148 Ga0105243_10550859 Ga0105243_105508592 299
250 3300009174 Ga0105241_10120622 Ga0105241_101206222 299
251 3300009176 Ga0105242_10203436 Ga0105242_102034362 299
252 3300009176 Ga0105242_10259286 Ga0105242_102592862 299
253 3300009177 Ga0105248_10152852 Ga0105248_101528522 299
254 3300009545 Ga0105237_10404254 Ga0105237_104042542 299
255 3300009545 Ga0105237_10599584 Ga0105237_105995841 299
256 3300009551 Ga0105238_10365078 Ga0105238_103650782 299
257 3300010375 Ga0105239_10438009 Ga0105239_104380092 299
258 3300011119 Ga0105246_10034156 Ga0105246_100341564 299
259 3300013102 Ga0157371_10246857 Ga0157371_102468572 299
260 3300013104 Ga0157370_10031786 Ga0157370_100317862 299
261 3300013104 Ga0157370_10380818 Ga0157370_103808182 299
262 3300013105 Ga0157369_10038511 Ga0157369_100385112 299
263 3300013105 Ga0157369_10039679 Ga0157369_100396792 299
264 3300013105 Ga0157369_10089298 Ga0157369_100892984 299
265 3300013296 Ga0157374_10087923 Ga0157374_100879232 299
266 3300013296 Ga0157374_10208348 Ga0157374_102083482 299
267 3300013297 Ga0157378_10207435 Ga0157378_102074352 299
268 3300013297 Ga0157378_10339211 Ga0157378_103392112 299
269 3300013306 Ga0163162_10245708 Ga0163162_102457082 299
270 3300013306 Ga0163162_10276719 Ga0163162_102767191 299
271 3300013307 Ga0157372_10682782 Ga0157372_106827822 299
272 3300014325 Ga0163163_10047822 Ga0163163_100478225 299
273 3300014745 Ga0157377_10213063 Ga0157377_102130632 299
274 3300014968 Ga0157379_10183089 Ga0157379_101830892 299
275 3300014969 Ga0157376_10054572 Ga0157376_100545722 299
276 3300014969 Ga0157376_10616354 Ga0157376_106163542 299
277 3300017792 Ga0163161_10027115 Ga0163161_100271156 299
278 3300020070 Ga0206356_11840338 Ga0206356_118403381 299
279 3300020080 Ga0206350_10254859 Ga0206350_102548592 299
280 3300020081 Ga0206354_10453000 Ga0206354_104530002 299
281 3300020082 Ga0206353_10888380 Ga0206353_108883806 299
282 3300022467 Ga0224712_10000892 Ga0224712_100008928 299
283 3300025898 Ga0207692_10016470 Ga0207692_100164701 299
284 3300025898 Ga0207692_10071707 Ga0207692_100717072 299
285 3300025900 Ga0207710_10030887 Ga0207710_100308872 299
286 3300025901 Ga0207688_10077873 Ga0207688_100778732 299
287 3300025904 Ga0207647_10087913 Ga0207647_100879132 299
288 3300025905 Ga0207685_10016920 Ga0207685_100169203 299
289 3300025906 Ga0207699_10001466 Ga0207699_1000146610 299
290 3300025906 Ga0207699_10005243 Ga0207699_100052435 299
291 3300025906 Ga0207699_10006418 Ga0207699_100064185 299
292 3300025909 Ga0207705_10028451 Ga0207705_100284514 299
293 3300025909 Ga0207705_10057578 Ga0207705_100575782 299
294 3300025910 Ga0207684_10071316 Ga0207684_100713162 299
295 3300025910 Ga0207684_10140541 Ga0207684_101405412 299
296 3300025912 Ga0207707_10068223 Ga0207707_100682234 299
297 3300025913 Ga0207695_10077299 Ga0207695_100772992 299
298 3300025913 Ga0207695_10169846 Ga0207695_101698462 299
299 3300025913 Ga0207695_10376759 Ga0207695_103767592 299
300 3300025915 Ga0207693_10000091 Ga0207693_1000009116 299
301 3300025915 Ga0207693_10011806 Ga0207693_100118065 299
302 3300025915 Ga0207693_10041710 Ga0207693_100417103 299
303 3300025915 Ga0207693_10309129 Ga0207693_103091292 299
304 3300025915 Ga0207693_10310742 Ga0207693_103107422 299
305 3300025916 Ga0207663_10000173 Ga0207663_100001739 299
306 3300025916 Ga0207663_10034382 Ga0207663_100343822 299
307 3300025916 Ga0207663_10102142 Ga0207663_101021421 299
308 3300025919 Ga0207657_10005560 Ga0207657_1000556010 299
309 3300025920 Ga0207649_10012124 Ga0207649_100121242 299
310 3300025921 Ga0207652_10042325 Ga0207652_100423252 299
311 3300025921 Ga0207652_10152807 Ga0207652_101528073 299
312 3300025921 Ga0207652_10508187 Ga0207652_105081872 299
313 3300025922 Ga0207646_10022624 Ga0207646_100226243 299
314 3300025924 Ga0207694_10071188 Ga0207694_100711882 299
315 3300025924 Ga0207694_10327482 Ga0207694_103274821 299
316 3300025926 Ga0207659_10464862 Ga0207659_104648622 299
317 3300025927 Ga0207687_10174930 Ga0207687_101749302 299
318 3300025928 Ga0207700_10000239 Ga0207700_1000023916 299
319 3300025928 Ga0207700_10034013 Ga0207700_100340132 299
320 3300025928 Ga0207700_10123913 Ga0207700_101239132 299
321 3300025929 Ga0207664_10021500 Ga0207664_100215002 299
322 3300025929 Ga0207664_10033078 Ga0207664_100330781 299
323 3300025929 Ga0207664_10045665 Ga0207664_100456654 299
324 3300025932 Ga0207690_10059688 Ga0207690_100596882 299
325 3300025935 Ga0207709_10015039 Ga0207709_100150393 299
326 3300025936 Ga0207670_10075487 Ga0207670_100754872 299
327 3300025937 Ga0207669_10082032 Ga0207669_100820322 299
328 3300025939 Ga0207665_10002719 Ga0207665_100027195 299
329 3300025939 Ga0207665_10003816 Ga0207665_1000381612 299
330 3300025939 Ga0207665_10021960 Ga0207665_100219603 299
331 3300025939 Ga0207665_10095027 Ga0207665_100950272 299
332 3300025939 Ga0207665_10265026 Ga0207665_102650262 299
333 3300025942 Ga0207689_10003693 Ga0207689_1000369310 299
334 3300025944 Ga0207661_10026540 Ga0207661_100265402 299
335 3300025961 Ga0207712_10115865 Ga0207712_101158652 299
336 3300025986 Ga0207658_10271572 Ga0207658_102715722 299
337 3300026023 Ga0207677_10230606 Ga0207677_102306061 299
338 3300026041 Ga0207639_10092547 Ga0207639_100925473 299
339 3300026067 Ga0207678_10002072 Ga0207678_1000207210 299
340 3300026078 Ga0207702_10079191 Ga0207702_100791912 299
341 3300026078 Ga0207702_10470281 Ga0207702_104702812 299
342 3300026089 Ga0207648_10147145 Ga0207648_101471453 299
343 3300026095 Ga0207676_10176950 Ga0207676_101769502 299
344 3300026116 Ga0207674_10056349 Ga0207674_100563492 299
345 3300026116 Ga0207674_10547810 Ga0207674_105478101 299
346 3300026118 Ga0207675_100015520 Ga0207675_1000155208 299
347 3300026121 Ga0207683_10003128 Ga0207683_100031282 299
348 3300026121 Ga0207683_10005655 Ga0207683_1000565510 299
349 3300026142 Ga0207698_10202990 Ga0207698_102029903 299
350 3300026142 Ga0207698_10433686 Ga0207698_104336862 299
351 3300028577 Ga0265318_10049234 Ga0265318_100492341 299
352 3300028800 Ga0265338_10000830 Ga0265338_1000083015 299
353 3300028800 Ga0265338_10299109 Ga0265338_102991091 299
354 3300031090 Ga0265760_10040336 Ga0265760_100403362 299
355 3300031241 Ga0265325_10000538 Ga0265325_1000053821 299
356 3300031249 Ga0265339_10000350 Ga0265339_1000035026 299
357 3300031595 Ga0265313_10000142 Ga0265313_1000014244 299
358 3300031711 Ga0265314_10003842 Ga0265314_100038429 299
359 3300034817 Ga0373948_0020360 Ga0373948_0020360_309_1232 299
360 3300035083 Ga0373926_0021797 Ga0373926_0021797_978_1931 299
361 3300035170 Ga0373943_0009057 Ga0373943_0009057_1738_2649 299
362 3300035172 Ga0373955_0112112 Ga0373955_0112112_339_1256 299
363 3300035691 Ga0373931_0027108 Ga0373931_0027108_184_1107 299
364 3300035691 Ga0373931_0078035 Ga0373931_0078035_22_939 299
365 3300035692 Ga0373935_0117800 Ga0373935_0117800_101_1018 299
366 3300035695 Ga0373927_0034426 Ga0373927_0034426_1615_2568 299
367 3300035724 Ga0373933_0024052 Ga0373933_0024052_1197_2174 299
368 3300035725 Ga0373947_0002280 Ga0373947_0002280_2090_3043 299
369 3300036401 Ga0373937_0156020 Ga0373937_0156020_961_1878 299
370 3300037068 Ga0373925_0001250 Ga0373925_0001250_10764_11717 299
371 3300037068 Ga0373925_0060929 Ga0373925_0060929_420_1349 299
372 3300037068 Ga0373925_0189052 Ga0373925_0189052_555_1472 299
373 3300037068 Ga0373925_0324360 Ga0373925_0324360_101_1018 299
374 3300039437 Ga0436365_0127369 Ga0436365_0127369_816_1778 299
375 3300039437 Ga0436365_0950920 Ga0436365_0950920_531_1439 299
376 3300039437 Ga0436365_1773926 Ga0436365_1773926_4084_5112 299
377 3300042876 Ga0451577_0078980 Ga0451577_0078980_1537_2448 299
378 3300042876 Ga0451577_0155668 Ga0451577_0155668_249_1160 299
379 3300044673 Ga0453683_0011755 Ga0453683_0011755_4123_5034 299
380 3300044712 Ga0453684_0001274 Ga0453684_0001274_18713_19669 299
381 3300044712 Ga0453684_0001763 Ga0453684_0001763_24000_24911 299
382 3300044712 Ga0453684_0002930 Ga0453684_0002930_19069_19980 299
383 3300044712 Ga0453684_0036894 Ga0453684_0036894_1162_2073 299
384 3300044712 Ga0453684_0058479 Ga0453684_0058479_3890_4801 299
385 3300044712 Ga0453684_0175839 Ga0453684_0175839_655_1566 299
386 3300044712 Ga0453684_0375199 Ga0453684_0375199_363_1274 299
387 3300044712 Ga0453684_0667497 Ga0453684_0667497_15_926 299
388 3300045051 Ga0451576_0122333 Ga0451576_0122333_1681_2613 299
389 3300045051 Ga0451576_0514924 Ga0451576_0514924_248_1159 299
390 3300045976 Ga0466967_0051411 Ga0466967_0051411_1944_2855 299
391 3300046459 Ga0495629_0048763 Ga0495629_0048763_1899_2828 299
392 3300046463 Ga0495653_0003548 Ga0495653_0003548_5166_6098 299
393 3300046463 Ga0495653_0075124 Ga0495653_0075124_299_1216 299
394 3300046472 Ga0495580_0031364 Ga0495580_0031364_2227_3159 299
395 3300046511 Ga0495608_0030580 Ga0495608_0030580_2203_3135 299
396 3300046516 Ga0495628_0019552 Ga0495628_0019552_3021_4019 299
397 3300046517 Ga0495630_0000305 Ga0495630_0000305_10348_11277 299
398 3300046526 Ga0495666_0015470 Ga0495666_0015470_53_982 299
399 3300046526 Ga0495666_0049120 Ga0495666_0049120_555_1508 299
400 3300046529 Ga0495652_0191762 Ga0495652_0191762_508_1419 299
401 3300046529 Ga0495652_0306915 Ga0495652_0306915_92_1009 299
402 3300046531 Ga0495665_0008974 Ga0495665_0008974_4349_5281 299
403 3300046533 Ga0495640_0005886 Ga0495640_0005886_7031_7963 299
404 3300046533 Ga0495640_0062811 Ga0495640_0062811_813_1742 299
405 3300046535 Ga0495586_0000271 Ga0495586_0000271_10368_11297 299
406 3300046536 Ga0495587_0102507 Ga0495587_0102507_55_987 299
407 3300046536 Ga0495587_0167616 Ga0495587_0167616_293_1210 299
408 3300046543 Ga0495645_0016127 Ga0495645_0016127_230_1162 299
409 3300046559 Ga0495667_0052667 Ga0495667_0052667_1303_2235 299
410 3300046559 Ga0495667_0186630 Ga0495667_0186630_102_1019 299
411 3300046663 Ga0495635_0039739 Ga0495635_0039739_1298_2215 299
412 3300046675 Ga0495657_0014756 Ga0495657_0014756_3500_4432 299
413 3300046678 Ga0495599_0106009 Ga0495599_0106009_69_995 299
414 3300046678 Ga0495599_0118814 Ga0495599_0118814_657_1589 299
415 3300046680 Ga0495646_0214689 Ga0495646_0214689_56_988 299
416 3300046683 Ga0495658_0035953 Ga0495658_0035953_1025_1954 299
417 3300046689 Ga0495613_0016898 Ga0495613_0016898_1002_1934 299
418 3300046689 Ga0495613_0046391 Ga0495613_0046391_1727_2656 299
419 3300047315 Ga0495581_0197327 Ga0495581_0197327_183_1115 299
420 3300047317 Ga0495604_0000834 Ga0495604_0000834_15251_16183 299
421 3300047319 Ga0495674_0000767 Ga0495674_0000767_24104_25033 299
422 3300047319 Ga0495674_0231375 Ga0495674_0231375_436_1353 299
423 3300047321 Ga0495676_0021657 Ga0495676_0021657_4615_5544 299
424 3300047322 Ga0495680_0230638 Ga0495680_0230638_55_972 299
425 3300047444 Ga0495675_0035000 Ga0495675_0035000_1431_2363 299
426 3300047444 Ga0495675_0153935 Ga0495675_0153935_341_1258 299
427 3300047471 Ga0495684_0099607 Ga0495684_0099607_346_1263 299
428 3300048904 Ga0496101_0454596 Ga0496101_0454596_32_949 299
429 3300048905 Ga0496102_0069465 Ga0496102_0069465_228_1145 299
430 3300048905 Ga0496102_0151747 Ga0496102_0151747_1021_1944 299
431 3300048908 Ga0496105_0015428 Ga0496105_0015428_290_1213 299
432 3300048908 Ga0496105_0210462 Ga0496105_0210462_319_1242 299
433 3300048908 Ga0496105_0246506 Ga0496105_0246506_97_1014 299
434 3300048910 Ga0496107_0067737 Ga0496107_0067737_1623_2546 299
435 3300048910 Ga0496107_0278413 Ga0496107_0278413_172_1089 299
436 3300048912 Ga0496109_0178046 Ga0496109_0178046_1013_1936 299
437 3300048913 Ga0496110_0137495 Ga0496110_0137495_664_1587 299
438 3300048913 Ga0496110_0326152 Ga0496110_0326152_255_1172 299
439 3300048914 Ga0496111_0005569 Ga0496111_0005569_6172_7095 299
440 3300048915 Ga0496112_0197487 Ga0496112_0197487_204_1115 299
441 3300048916 Ga0496113_0101478 Ga0496113_0101478_1014_1937 299
442 3300048916 Ga0496113_0256597 Ga0496113_0256597_163_1119 299
443 3300048916 Ga0496113_0328366 Ga0496113_0328366_14_931 299
444 3300048917 Ga0496114_0125118 Ga0496114_0125118_201_1124 299
445 3300048918 Ga0496115_0098433 Ga0496115_0098433_127_1044 299
446 3300048918 Ga0496115_0224718 Ga0496115_0224718_315_1298 299
447 3300049568 Ga0501031_0009421 Ga0501031_0009421_4215_5138 299
448 3300049572 Ga0501036_0208795 Ga0501036_0208795_67_990 299
449 3300049576 Ga0501040_0010167 Ga0501040_0010167_328_1251 299
450 3300049578 Ga0501042_0004880 Ga0501042_0004880_1298_2221 299
451 3300049586 Ga0501070_0436448 Ga0501070_0436448_84_1007 299
452 3300049588 Ga0501072_0068792 Ga0501072_0068792_1439_2362 299
453 3300049592 Ga0501076_0236546 Ga0501076_0236546_71_994 299
454 3300049741 Ga0501079_0164090 Ga0501079_0164090_44_967 299
455 3300049742 Ga0501080_0024362 Ga0501080_0024362_3945_4868 299
456 3300049824 Ga0501045_0008806 Ga0501045_0008806_5819_6742 299
457 3300050512 nmdc:mga0n895_155624_c1 nmdc:mga0n895_155624_c1_495_1418 299
458 3300050514 nmdc:mga08x19_134_c1 nmdc:mga08x19_134_c1_53178_54131 299
459 3300053077 Ga0495601_0037940 Ga0495601_0037940_434_1366 299
460 3300053085 Ga0495619_0032127 Ga0495619_0032127_54_986 299
461 3300061719 Ga0466962_0030545 Ga0466962_0030545_59_1021 299
462 3300061734 Ga0530510_0008203 Ga0530510_0008203_3933_4856 299
463 3300061734 Ga0530510_0166850 Ga0530510_0166850_598_1509 299
464 3300005339 Ga0070660_100016204 Ga0070660_1000162042 300
465 3300005439 Ga0070711_100082493 Ga0070711_1000824932 300
466 3300005445 Ga0070708_100006063 Ga0070708_1000060634 300
467 3300005445 Ga0070708_100010325 Ga0070708_1000103252 300
468 3300005445 Ga0070708_100125057 Ga0070708_1001250573 300
469 3300005445 Ga0070708_100592523 Ga0070708_1005925231 300
470 3300005458 Ga0070681_10052862 Ga0070681_100528623 300
471 3300005458 Ga0070681_10244432 Ga0070681_102444322 300
472 3300005467 Ga0070706_100003078 Ga0070706_10000307816 300
473 3300005467 Ga0070706_100052553 Ga0070706_1000525534 300
474 3300005468 Ga0070707_100000933 Ga0070707_1000009335 300
475 3300005468 Ga0070707_100014998 Ga0070707_1000149983 300
476 3300005468 Ga0070707_100086991 Ga0070707_1000869913 300
477 3300005468 Ga0070707_100275596 Ga0070707_1002755962 300
478 3300005471 Ga0070698_100000745 Ga0070698_10000074532 300
479 3300005471 Ga0070698_100104147 Ga0070698_1001041472 300
480 3300005471 Ga0070698_100132610 Ga0070698_1001326103 300
481 3300005518 Ga0070699_100013099 Ga0070699_1000130994 300
482 3300005535 Ga0070684_100072443 Ga0070684_1000724432 300
483 3300005536 Ga0070697_100021391 Ga0070697_1000213915 300
484 3300005536 Ga0070697_100040828 Ga0070697_1000408284 300
485 3300005546 Ga0070696_100117371 Ga0070696_1001173713 300
486 3300005548 Ga0070665_100000050 Ga0070665_100000050128 300
487 3300005719 Ga0068861_100141314 Ga0068861_1001413142 300
488 3300005937 Ga0081455_10087395 Ga0081455_100873951 300
489 3300006028 Ga0070717_10007624 Ga0070717_100076243 300
490 3300006028 Ga0070717_10103147 Ga0070717_101031474 300
491 3300006028 Ga0070717_10220461 Ga0070717_102204612 300
492 3300006852 Ga0075433_10404056 Ga0075433_104040561 300
493 3300009094 Ga0111539_10390434 Ga0111539_103904342 300
494 3300009147 Ga0114129_10007038 Ga0114129_100070388 300
495 3300021358 Ga0213873_10039467 Ga0213873_100394671 300
496 3300021388 Ga0213875_10091986 Ga0213875_100919862 300
497 3300025905 Ga0207685_10050289 Ga0207685_100502891 300
498 3300025910 Ga0207684_10012110 Ga0207684_100121107 300
499 3300025916 Ga0207663_10037089 Ga0207663_100370895 300
500 3300025919 Ga0207657_10013761 Ga0207657_100137615 300
501 3300025922 Ga0207646_10000054 Ga0207646_10000054133 300
502 3300025922 Ga0207646_10026838 Ga0207646_100268384 300
503 3300025922 Ga0207646_10065604 Ga0207646_100656041 300
504 3300025922 Ga0207646_10239813 Ga0207646_102398132 300
505 3300026118 Ga0207675_100340069 Ga0207675_1003400692 300
506 3300028379 Ga0268266_10000241 Ga0268266_1000024159 300
507 3300028556 Ga0265337_1000777 Ga0265337_100077717 300
508 3300028556 Ga0265337_1013840 Ga0265337_10138401 300
509 3300028573 Ga0265334_10071062 Ga0265334_100710621 300
510 3300028666 Ga0265336_10008042 Ga0265336_100080422 300
511 3300028800 Ga0265338_10074082 Ga0265338_100740824 300
512 3300028800 Ga0265338_10096909 Ga0265338_100969093 300
513 3300028800 Ga0265338_10347853 Ga0265338_103478531 300
514 3300029957 Ga0265324_10017492 Ga0265324_100174922 300
515 3300029957 Ga0265324_10017848 Ga0265324_100178481 300
516 3300031235 Ga0265330_10006995 Ga0265330_100069953 300
517 3300031235 Ga0265330_10044768 Ga0265330_100447682 300
518 3300031240 Ga0265320_10000242 Ga0265320_1000024217 300
519 3300031240 Ga0265320_10022604 Ga0265320_100226043 300
520 3300031240 Ga0265320_10031173 Ga0265320_100311732 300
521 3300031240 Ga0265320_10032279 Ga0265320_100322792 300
522 3300031242 Ga0265329_10043735 Ga0265329_100437352 300
523 3300031247 Ga0265340_10025983 Ga0265340_100259833 300
524 3300031247 Ga0265340_10034948 Ga0265340_100349482 300
525 3300031247 Ga0265340_10099170 Ga0265340_100991702 300
526 3300031249 Ga0265339_10091780 Ga0265339_100917802 300
527 3300031249 Ga0265339_10101484 Ga0265339_101014842 300
528 3300031250 Ga0265331_10012584 Ga0265331_100125843 300
529 3300031250 Ga0265331_10091710 Ga0265331_100917101 300
530 3300031344 Ga0265316_10000706 Ga0265316_1000070617 300
531 3300031344 Ga0265316_10003202 Ga0265316_1000320214 300
532 3300031344 Ga0265316_10054150 Ga0265316_100541502 300
533 3300031691 Ga0316579_10001589 Ga0316579_100015895 300
534 3300031711 Ga0265314_10001717 Ga0265314_1000171721 300
535 3300031711 Ga0265314_10186544 Ga0265314_101865441 300
536 3300031712 Ga0265342_10029830 Ga0265342_100298302 300
537 3300031728 Ga0316578_10050760 Ga0316578_100507601 300
538 3300031852 Ga0307410_10002640 Ga0307410_1000264010 300
539 3300032002 Ga0307416_100002595 Ga0307416_1000025953 300
540 3300032002 Ga0307416_100369901 Ga0307416_1003699012 300
541 3300035083 Ga0373926_0024226 Ga0373926_0024226_1034_1954 300
542 3300035089 Ga0373944_0000594 Ga0373944_0000594_3311_4231 300
543 3300035116 Ga0373945_0000010 Ga0373945_0000010_9507_10427 300
544 3300035170 Ga0373943_0002157 Ga0373943_0002157_7387_8307 300
545 3300035171 Ga0373946_0000330 Ga0373946_0000330_9326_10246 300
546 3300035172 Ga0373955_0030722 Ga0373955_0030722_1137_2057 300
547 3300035410 Ga0373924_0024766 Ga0373924_0024766_817_1737 300
548 3300035692 Ga0373935_0036921 Ga0373935_0036921_495_1415 300
549 3300035695 Ga0373927_0011110 Ga0373927_0011110_225_1145 300
550 3300035725 Ga0373947_0001234 Ga0373947_0001234_1020_1940 300
551 3300037068 Ga0373925_0019060 Ga0373925_0019060_2921_3841 300
552 3300037312 Ga0395899_0110669 Ga0395899_0110669_137_1297 300
553 3300037471 Ga0395905_0419413 Ga0395905_0419413_216_1136 300
554 3300037853 Ga0436364_0757267 Ga0436364_0757267_4838_5758 300
555 3300039450 Ga0436363_0303774 Ga0436363_0303774_2807_3724 300
556 3300039450 Ga0436363_0624304 Ga0436363_0624304_2976_3902 300
557 3300039453 Ga0436362_0749635 Ga0436362_0749635_83_1003 300
558 3300039453 Ga0436362_1085911 Ga0436362_1085911_240_1166 300
559 3300044712 Ga0453684_0002426 Ga0453684_0002426_34718_35620 300
560 3300044712 Ga0453684_0006387 Ga0453684_0006387_18558_19499 300
561 3300044712 Ga0453684_0015242 Ga0453684_0015242_11085_12029 300
562 3300044712 Ga0453684_0026747 Ga0453684_0026747_4422_5351 300
563 3300046463 Ga0495653_0002194 Ga0495653_0002194_5088_6008 300
564 3300046473 Ga0495582_0074040 Ga0495582_0074040_272_1192 300
565 3300046475 Ga0495639_0022713 Ga0495639_0022713_266_1186 300
566 3300046491 Ga0495584_0130044 Ga0495584_0130044_243_1175 300
567 3300046511 Ga0495608_0085910 Ga0495608_0085910_312_1232 300
568 3300046514 Ga0495618_0028612 Ga0495618_0028612_769_1689 300
569 3300046516 Ga0495628_0021920 Ga0495628_0021920_3543_4463 300
570 3300046517 Ga0495630_0047439 Ga0495630_0047439_906_1826 300
571 3300046529 Ga0495652_0031195 Ga0495652_0031195_994_1914 300
572 3300046531 Ga0495665_0066442 Ga0495665_0066442_475_1395 300
573 3300046533 Ga0495640_0082906 Ga0495640_0082906_779_1699 300
574 3300046543 Ga0495645_0053396 Ga0495645_0053396_1360_2280 300
575 3300046559 Ga0495667_0004069 Ga0495667_0004069_7866_8786 300
576 3300046642 Ga0495634_0033832 Ga0495634_0033832_1700_2620 300
577 3300046663 Ga0495635_0000459 Ga0495635_0000459_11748_12668 300
578 3300046675 Ga0495657_0156632 Ga0495657_0156632_268_1188 300
579 3300046678 Ga0495599_0049095 Ga0495599_0049095_1154_2074 300
580 3300046690 Ga0495624_0006532 Ga0495624_0006532_5390_6310 300
581 3300047315 Ga0495581_0029249 Ga0495581_0029249_1436_2356 300
582 3300047319 Ga0495674_0006061 Ga0495674_0006061_10042_10962 300
583 3300047321 Ga0495676_0011793 Ga0495676_0011793_880_1800 300
584 3300047322 Ga0495680_0035336 Ga0495680_0035336_2323_3243 300
585 3300047471 Ga0495684_0003770 Ga0495684_0003770_4465_5385 300
586 3300047673 Ga0495593_0033987 Ga0495593_0033987_1291_2211 300
587 3300048905 Ga0496102_0254320 Ga0496102_0254320_225_1139 300
588 3300048913 Ga0496110_0349060 Ga0496110_0349060_240_1172 300
589 3300050511 nmdc:mga08y16_223347_c1 nmdc:mga08y16_223347_c1_491_1480 300
590 3300050514 nmdc:mga08x19_101180_c1 nmdc:mga08x19_101180_c1_862_1806 300
591 3300053083 Ga0495655_0001038 Ga0495655_0001038_3116_4051 300
592 3300053085 Ga0495619_0010569 Ga0495619_0010569_1623_2552 300
593 3300005295 Ga0065707_10095319 Ga0065707_100953194 301
594 3300005435 Ga0070714_100195658 Ga0070714_1001956582 301
595 3300005985 Ga0081539_10007469 Ga0081539_100074699 301
596 3300006847 Ga0075431_100016333 Ga0075431_1000163335 301
597 3300006852 Ga0075433_10040529 Ga0075433_100405292 301
598 3300006852 Ga0075433_10246838 Ga0075433_102468382 301
599 3300006871 Ga0075434_100140982 Ga0075434_1001409822 301
600 3300009094 Ga0111539_10247061 Ga0111539_102470612 301
601 3300021384 Ga0213876_10065874 Ga0213876_100658742 301
602 3300025929 Ga0207664_10270614 Ga0207664_102706142 301
603 3300028379 Ga0268266_10413628 Ga0268266_104136282 301
604 3300039437 Ga0436365_0610234 Ga0436365_0610234_2278_3216 301
605 3300044656 Ga0466969_0067262 Ga0466969_0067262_341_1279 301
606 3300044694 Ga0466963_0007334 Ga0466963_0007334_2978_3910 301
607 3300044735 Ga0466968_0010067 Ga0466968_0010067_484_1416 301
608 3300044842 Ga0466957_0008051 Ga0466957_0008051_1422_2354 301
609 3300045049 Ga0466959_0021507 Ga0466959_0021507_1797_2729 301
610 3300045836 Ga0466958_0029234 Ga0466958_0029234_1297_2235 301
611 3300045836 Ga0466958_0185254 Ga0466958_0185254_222_1157 301
612 3300048911 Ga0496108_0163002 Ga0496108_0163002_496_1428 301
613 3300048912 Ga0496109_0008477 Ga0496109_0008477_6891_7823 301
614 3300048917 Ga0496114_0043817 Ga0496114_0043817_307_1260 301
615 3300050507 nmdc:mga05p37_237934_c1 nmdc:mga05p37_237934_c1_761_1729 301
616 3300050510 nmdc:mga06r32_138714_c1 nmdc:mga06r32_138714_c1_1075_2013 301
617 3300050511 nmdc:mga08y16_47847_c1 nmdc:mga08y16_47847_c1_1011_1949 301
618 3300050512 nmdc:mga0n895_374689_c1 nmdc:mga0n895_374689_c1_82_1020 301
619 3300050515 nmdc:mga0a205_77014_c1 nmdc:mga0a205_77014_c1_334_1293 301
620 3300061719 Ga0466962_0007829 Ga0466962_0007829_3555_4487 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

6

163

0.88

PF13460

NAD_binding_10

NAD(P)H-binding

9

160

0.87

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

6

207

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a24-assembly1.cif.gz_T assembly intermediate of the plant mitochondrial complex i 0.8502 3 280
3w1v-assembly1.cif.gz_A crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor 0.8465 2 232
5gup-assembly1.cif.gz_L cryo-em structure of mammalian respiratory supercomplex i1iii2iv1 0.8441 1 271
7ak6-assembly1.cif.gz_P cryo-em structure of nd6-p25l mutant respiratory complex i from mus musculus at 3.8 a 0.8413 1 220
6qa9-assembly1.cif.gz_A9 isolated complex i class refinement from ovine respiratory supercomplex i+iii2 0.839 1 222
ID Description Score Start End Superfamily
af_Q559Z0_43_331_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8678 5 271 3.40.50.720
af_A0A1D6K5B6_15_173_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8593 2 105 3.40.50.720
af_Q9SK66_71_329_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8586 4 250 3.40.50.720
af_Q4DU32_30_254_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8508 1 202 3.40.50.720
af_A0A2R8RUA9_55_239_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8382 1 164 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A350G5F5-F1-model_v4 NAD(P)-binding domain-containing protein 0.9801 1 173 GO:0044877
GO:1901006
AF-A0A525C0B3-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.979 2 298 GO:0044877
GO:1901006
AF-A0A7V2M250-F1-model_v4 Epimerase 0.977 137 301 GO:0044877
GO:1901006
AF-A0A7V9V8J9-F1-model_v4 NAD(P)H-binding protein 0.9693 2 300 GO:0044877
GO:1901006
AF-A0A2H6H442-F1-model_v4 NAD(P)-binding domain-containing protein 0.9677 2 298 GO:0044877
GO:1901006

Feature Viewer

pLDDT pTM Quality
87.39 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map