F469881

General Info

Members Datasets Scaffolds Average Seq Length
620 323 591 306

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10002462|JGI25406J46586_100024622
Length 347
Sequence LKTTTQGPEGRLPAPSSHRTATRAEARRGLTPDQPRPRVDGSLRRRRRLDKLTIALFLAPALLLFVVLVVGPIALAIYTSLFKWNGFGGLPEDFIGLDNFTRLLQDEVFIGDLKRGLILVLLSVFVQLPVALGLALLLNQPLRGRAFYRLVFFAPYVLSEVITAVLFTMVFSPNQGLTNQAMSAIGLENLQQEWLADTSTVLYALFFVISWKYFGLHMILYLAGRQGIPKELTDAALTDGAGSWQVFRHVTLPLLGPTIRISIFLSIIGAIQLFDMVWVLTGGGPIHSSETMAVTMFQYGFRRSEVGYASAISVAMFLISLVFALLYQRFVMRRDIEGAITTMREKR

Samples

Sample ID Description Type Environment
1 2643221572 Leifsonia sp. Root60 Isolate Unclassified
2 2643221615 Nocardioides sp. Root224 Isolate Unclassified
3 2643221649 Leifsonia sp. Root4 Isolate Unclassified
4 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
5 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
6 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
7 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
8 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
9 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
10 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
11 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
12 2858868258 Micromonospora sp. MH33 Isolate Unclassified
13 2862574272 Streptomyces sp. AcE210 Isolate Nodule
14 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
15 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
16 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
17 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
18 2891562705 Microbispora tritici MT50 Isolate Unclassified
19 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
20 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
21 2902582711 Micromonospora sp. AP08 Isolate Unclassified
22 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
174 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
175 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
176 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
177 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
180 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
181 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
188 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
189 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
192 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
203 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
204 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
213 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
214 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
215 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
216 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
217 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
218 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
219 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
263 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
309 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
310 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
311 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
314 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
317 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
318 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
319 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
320 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
321 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
322 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
323 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.32
Metatranscriptomes 0
Isolates 4.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.58
Nodule 0.16
Rhizoplane 9.03
Rhizosphere 80.81
Stem 0
Stem Tuber 0
Unclassified 7.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002462 3300003203 Bacteria 8752
2 rootH1_10037110 3300003316 Bacteria 1922
3 Ga0070658_10004616 3300005327 Bacteria 11195
4 Ga0070658_10138652 3300005327 Bacteria 2031
5 Ga0070683_100005892 3300005329 Bacteria 10253
6 Ga0070683_100051837 3300005329 Bacteria 3800
7 Ga0070690_100040668 3300005330 Bacteria 2941
8 Ga0070680_100011523 3300005336 Bacteria 6842
9 Ga0070680_100105669 3300005336 Bacteria 2340
10 Ga0070682_100034925 3300005337 Bacteria 3065
11 Ga0070682_100074254 3300005337 Bacteria 2183
12 Ga0068868_100156643 3300005338 Bacteria 1879
13 Ga0068868_100254617 3300005338 Bacteria 1478
14 Ga0070660_100031511 3300005339 Bacteria 3983
15 Ga0070660_100164446 3300005339 Bacteria 1789
16 Ga0070689_100014575 3300005340 Bacteria 5715
17 Ga0070691_10044518 3300005341 Bacteria 2105
18 Ga0070661_100051486 3300005344 Bacteria 3014
19 Ga0070661_100214209 3300005344 Bacteria 1475
20 Ga0070668_100000364 3300005347 Bacteria 29898
21 Ga0070668_100005312 3300005347 Bacteria 9564
22 Ga0070668_100507349 3300005347 Bacteria 1045
23 Ga0070671_100067266 3300005355 Bacteria 2987
24 Ga0070674_100007305 3300005356 Bacteria 6508
25 Ga0070674_100039828 3300005356 Bacteria 3176
26 Ga0070673_100199455 3300005364 Bacteria 1723
27 Ga0070659_100000996 3300005366 Bacteria 20802
28 Ga0070659_100236302 3300005366 Bacteria 1511
29 Ga0070711_100052708 3300005439 Bacteria 2801
30 Ga0070700_100079819 3300005441 Bacteria 2110
31 Ga0070700_100233021 3300005441 Bacteria 1311
32 Ga0070694_100343917 3300005444 Bacteria 1154
33 Ga0070708_100282186 3300005445 Bacteria 1563
34 Ga0070663_100071010 3300005455 Bacteria 2533
35 Ga0070663_100253446 3300005455 Bacteria 1394
36 Ga0070678_100119534 3300005456 Bacteria 2075
37 Ga0070662_100026204 3300005457 Bacteria 4036
38 Ga0070681_10008736 3300005458 Bacteria 9936
39 Ga0068867_100004439 3300005459 Bacteria 9865
40 Ga0070685_10008452 3300005466 Bacteria 5291
41 Ga0070685_10020615 3300005466 Bacteria 3568
42 Ga0070679_100059959 3300005530 Bacteria 3792
43 Ga0070684_100010486 3300005535 Bacteria 7343
44 Ga0070684_100090948 3300005535 Bacteria 2714
45 Ga0070684_100508095 3300005535 Bacteria 1116
46 Ga0068853_100069509 3300005539 Bacteria 3064
47 Ga0070672_100006704 3300005543 Bacteria 7762
48 Ga0070672_100073213 3300005543 Bacteria 2730
49 Ga0070672_100230012 3300005543 Bacteria 1557
50 Ga0070686_100091678 3300005544 Bacteria 2034
51 Ga0070686_100098074 3300005544 Bacteria 1974
52 Ga0070696_100054324 3300005546 Bacteria 2790
53 Ga0070693_100010881 3300005547 Bacteria 4569
54 Ga0068855_100001168 3300005563 Bacteria 32549
55 Ga0068855_100036885 3300005563 Bacteria 5816
56 Ga0070664_100394791 3300005564 Bacteria 1264
57 Ga0070664_100403361 3300005564 Bacteria 1250
58 Ga0068857_100140429 3300005577 Bacteria 2183
59 Ga0068857_100234070 3300005577 Bacteria 1681
60 Ga0068854_100119873 3300005578 Bacteria 1996
61 Ga0068856_100048811 3300005614 Bacteria 4172
62 Ga0068856_100069560 3300005614 Bacteria 3481
63 Ga0068856_100391929 3300005614 Bacteria 1408
64 Ga0070702_100070846 3300005615 Bacteria 2059
65 Ga0068852_100038328 3300005616 Bacteria 4027
66 Ga0068852_100399083 3300005616 Bacteria 1352
67 Ga0068859_100010767 3300005617 Bacteria 9204
68 Ga0068859_100360628 3300005617 Bacteria 1548
69 Ga0068859_100455323 3300005617 Bacteria 1376
70 Ga0068864_100158389 3300005618 Bacteria 2057
71 Ga0068866_10004355 3300005718 Bacteria 5811
72 Ga0068866_10069199 3300005718 Bacteria 1859
73 Ga0068866_10132548 3300005718 Bacteria 1419
74 Ga0068861_100037646 3300005719 Bacteria 3596
75 Ga0068851_10000001 3300005834 Bacteria 495512
76 Ga0068870_10141315 3300005840 Bacteria 1409
77 Ga0068858_100000016 3300005842 Bacteria 193130
78 Ga0068858_100263410 3300005842 Bacteria 1639
79 Ga0068860_100120963 3300005843 Bacteria 2507
80 Ga0068860_100262705 3300005843 Bacteria 1683
81 Ga0081455_10033203 3300005937 Bacteria 4640
82 Ga0081540_1057073 3300005983 Bacteria 1890
83 Ga0081539_10000135 3300005985 Bacteria 172789
84 Ga0075365_10090446 3300006038 Bacteria 2085
85 Ga0075368_10081576 3300006042 Bacteria 1317
86 Ga0075363_100153674 3300006048 Bacteria 1300
87 Ga0075432_10033134 3300006058 Bacteria 1791
88 Ga0070715_10068621 3300006163 Bacteria 1577
89 Ga0097621_100053376 3300006237 Bacteria 3295
90 Ga0097621_100138971 3300006237 Bacteria 2074
91 Ga0097621_100154368 3300006237 Bacteria 1970
92 Ga0097621_100193896 3300006237 Bacteria 1761
93 Ga0075370_10061525 3300006353 Bacteria 2139
94 Ga0068871_100105589 3300006358 Bacteria 2364
95 Ga0075428_100006054 3300006844 Bacteria 13442
96 Ga0075428_100126928 3300006844 Bacteria 2776
97 Ga0075428_100160786 3300006844 Bacteria 2438
98 Ga0075428_100286554 3300006844 Bacteria 1772
99 Ga0075428_100480977 3300006844 Bacteria 1329
100 Ga0075430_100081788 3300006846 Bacteria 2706
101 Ga0075430_100147531 3300006846 Bacteria 1959
102 Ga0075431_100159188 3300006847 Bacteria 2322
103 Ga0075431_100188874 3300006847 Bacteria 2111
104 Ga0068865_100034891 3300006881 Bacteria 3379
105 Ga0068865_100046009 3300006881 Bacteria 2993
106 Ga0097620_100010767 3300006931 Bacteria 9204
107 Ga0097620_100360634 3300006931 Bacteria 1548
108 Ga0097620_100455350 3300006931 Bacteria 1376
109 Ga0105240_10007531 3300009093 Bacteria 15792
110 Ga0105240_10013972 3300009093 Bacteria 10990
111 Ga0105240_10553417 3300009093 Bacteria 1272
112 Ga0111539_10008475 3300009094 Bacteria 13068
113 Ga0111539_10010318 3300009094 Bacteria 11761
114 Ga0111539_10104327 3300009094 Bacteria 3326
115 Ga0111539_10138650 3300009094 Bacteria 2848
116 Ga0105245_10001472 3300009098 Bacteria 21285
117 Ga0105245_10043342 3300009098 Bacteria 4013
118 Ga0105245_10294443 3300009098 Bacteria 1590
119 Ga0114129_10007883 3300009147 Bacteria 15154
120 Ga0114129_10015263 3300009147 Bacteria 10933
121 Ga0114129_10105395 3300009147 Bacteria 3897
122 Ga0114129_10145323 3300009147 Bacteria 3249
123 Ga0114129_10156369 3300009147 Bacteria 3117
124 Ga0114129_10206513 3300009147 Bacteria 2657
125 Ga0114129_10320706 3300009147 Bacteria 2060
126 Ga0105243_10031424 3300009148 Bacteria 4094
127 Ga0105243_10033713 3300009148 Bacteria 3960
128 Ga0105243_10111442 3300009148 Bacteria 2290
129 Ga0105243_10224133 3300009148 Bacteria 1664
130 Ga0105243_10321395 3300009148 Bacteria 1410
131 Ga0105241_10001026 3300009174 Bacteria 21266
132 Ga0105242_10239554 3300009176 Bacteria 1630
133 Ga0105248_10138941 3300009177 Bacteria 2740
134 Ga0105248_10172624 3300009177 Bacteria 2437
135 Ga0105248_10179974 3300009177 Bacteria 2382
136 Ga0105248_10316236 3300009177 Bacteria 1758
137 Ga0105248_10436385 3300009177 Bacteria 1475
138 Ga0105237_10001409 3300009545 Bacteria 31790
139 Ga0105237_10047701 3300009545 Bacteria 4306
140 Ga0105249_10015170 3300009553 Bacteria 6818
141 Ga0105249_10322144 3300009553 Bacteria 1557
142 Ga0105030_101153 3300009987 Bacteria 2350
143 Ga0105239_10296617 3300010375 Bacteria 1820
144 Ga0105239_10441285 3300010375 Bacteria 1476
145 Ga0105239_10875569 3300010375 Bacteria 1030
146 Ga0157370_10278306 3300013104 Bacteria 1546
147 Ga0157374_10019965 3300013296 Bacteria 5940
148 Ga0157374_10080805 3300013296 Bacteria 3084
149 Ga0157374_10392875 3300013296 Bacteria 1383
150 Ga0157378_10005765 3300013297 Bacteria 10847
151 Ga0157378_10159003 3300013297 Bacteria 2112
152 Ga0163162_10067065 3300013306 Bacteria 3638
153 Ga0163162_10258270 3300013306 Bacteria 1874
154 Ga0157372_10216401 3300013307 Bacteria 2220
155 Ga0157372_10691781 3300013307 Bacteria 1187
156 Ga0157375_10026469 3300013308 Bacteria 5406
157 Ga0157375_10062400 3300013308 Bacteria 3703
158 Ga0157375_10073037 3300013308 Bacteria 3449
159 Ga0157375_10074609 3300013308 Bacteria 3413
160 Ga0157375_10075013 3300013308 Bacteria 3406
161 Ga0157375_10122873 3300013308 Bacteria 2708
162 Ga0163163_10018986 3300014325 Bacteria 6449
163 Ga0163163_10051781 3300014325 Bacteria 4048
164 Ga0163163_10092884 3300014325 Bacteria 3033
165 Ga0163163_10101349 3300014325 Bacteria 2902
166 Ga0157380_10007357 3300014326 Bacteria 7817
167 Ga0157380_10067649 3300014326 Bacteria 2877
168 Ga0182008_10009372 3300014497 Bacteria 5288
169 Ga0157377_10035903 3300014745 Bacteria 2723
170 Ga0157377_10188500 3300014745 Bacteria 1302
171 Ga0157379_10053107 3300014968 Bacteria 3620
172 Ga0157376_10285992 3300014969 Bacteria 1555
173 Ga0157376_10583244 3300014969 Bacteria 1111
174 Ga0182006_1082494 3300015261 Bacteria 1170
175 Ga0182007_10001270 3300015262 Bacteria 13699
176 Ga0182005_1008073 3300015265 Bacteria 3121
177 Ga0163161_10010643 3300017792 Bacteria 6371
178 Ga0213874_10005463 3300021377 Bacteria 2963
179 Ga0213876_10002357 3300021384 Bacteria 11116
180 Ga0213876_10002479 3300021384 Bacteria 10828
181 Ga0213875_10004993 3300021388 Bacteria 7197
182 Ga0209148_1000868 3300025254 Bacteria 21084
183 Ga0207656_10000005 3300025321 Bacteria 490514
184 Ga0207642_10009777 3300025899 Bacteria 3350
185 Ga0207642_10024002 3300025899 Bacteria 2446
186 Ga0207710_10038595 3300025900 Bacteria 2112
187 Ga0207688_10111455 3300025901 Bacteria 1589
188 Ga0207647_10010435 3300025904 Bacteria 6562
189 Ga0207647_10109405 3300025904 Bacteria 1634
190 Ga0207685_10072940 3300025905 Bacteria 1397
191 Ga0207643_10004234 3300025908 Bacteria 7729
192 Ga0207705_10005737 3300025909 Bacteria 9266
193 Ga0207705_10007412 3300025909 Bacteria 8069
194 Ga0207705_10133949 3300025909 Bacteria 1846
195 Ga0207654_10000001 3300025911 Bacteria 1816198
196 Ga0207707_10011531 3300025912 Bacteria 7698
197 Ga0207695_10005221 3300025913 Bacteria 17364
198 Ga0207695_10006733 3300025913 Bacteria 14831
199 Ga0207671_10000016 3300025914 Bacteria 435413
200 Ga0207671_10027283 3300025914 Bacteria 4269
201 Ga0207671_10105237 3300025914 Bacteria 2141
202 Ga0207671_10238505 3300025914 Bacteria 1428
203 Ga0207693_10249615 3300025915 Bacteria 1392
204 Ga0207663_10073100 3300025916 Bacteria 2218
205 Ga0207660_10013673 3300025917 Bacteria 5324
206 Ga0207660_10150922 3300025917 Bacteria 1785
207 Ga0207657_10037185 3300025919 Bacteria 4350
208 Ga0207657_10044681 3300025919 Bacteria 3893
209 Ga0207657_10127693 3300025919 Bacteria 2087
210 Ga0207657_10139129 3300025919 Bacteria 1984
211 Ga0207649_10087598 3300025920 Bacteria 2032
212 Ga0207649_10226645 3300025920 Bacteria 1334
213 Ga0207652_10021373 3300025921 Bacteria 5342
214 Ga0207652_10172330 3300025921 Bacteria 1942
215 Ga0207646_10570567 3300025922 Bacteria 1017
216 Ga0207681_10194415 3300025923 Bacteria 1554
217 Ga0207694_10000660 3300025924 Bacteria 31108
218 Ga0207694_10188588 3300025924 Bacteria 1674
219 Ga0207659_10246039 3300025926 Bacteria 1449
220 Ga0207687_10015934 3300025927 Bacteria 4932
221 Ga0207687_10035046 3300025927 Bacteria 3412
222 Ga0207687_10052171 3300025927 Bacteria 2853
223 Ga0207687_10266091 3300025927 Bacteria 1368
224 Ga0207690_10129919 3300025932 Bacteria 1842
225 Ga0207690_10158970 3300025932 Bacteria 1683
226 Ga0207690_10269392 3300025932 Bacteria 1322
227 Ga0207706_10098567 3300025933 Bacteria 2571
228 Ga0207686_10025028 3300025934 Bacteria 3466
229 Ga0207686_10186836 3300025934 Bacteria 1474
230 Ga0207709_10011467 3300025935 Bacteria 4889
231 Ga0207709_10080423 3300025935 Bacteria 2098
232 Ga0207670_10091013 3300025936 Bacteria 2156
233 Ga0207669_10003955 3300025937 Bacteria 6467
234 Ga0207669_10082859 3300025937 Bacteria 2060
235 Ga0207704_10012489 3300025938 Bacteria 4215
236 Ga0207691_10037509 3300025940 Bacteria 4488
237 Ga0207711_10003988 3300025941 Bacteria 12680
238 Ga0207711_10472592 3300025941 Bacteria 1168
239 Ga0207689_10024592 3300025942 Bacteria 5052
240 Ga0207661_10002823 3300025944 Bacteria 11993
241 Ga0207661_10014527 3300025944 Bacteria 5775
242 Ga0207661_10045526 3300025944 Bacteria 3473
243 Ga0207667_10001071 3300025949 Bacteria 34686
244 Ga0207667_10001561 3300025949 Bacteria 28853
245 Ga0207667_10070293 3300025949 Bacteria 3643
246 Ga0207651_10156574 3300025960 Bacteria 1781
247 Ga0207668_10000326 3300025972 Bacteria 30849
248 Ga0207668_10128218 3300025972 Bacteria 1933
249 Ga0207668_10192963 3300025972 Bacteria 1616
250 Ga0207640_10117279 3300025981 Bacteria 1900
251 Ga0207658_10043810 3300025986 Bacteria 3255
252 Ga0207677_10051270 3300026023 Bacteria 2797
253 Ga0207677_10243725 3300026023 Bacteria 1456
254 Ga0207677_10325322 3300026023 Bacteria 1279
255 Ga0207703_10000075 3300026035 Bacteria 118422
256 Ga0207639_10078220 3300026041 Bacteria 2610
257 Ga0207639_10172951 3300026041 Bacteria 1831
258 Ga0207639_10246144 3300026041 Bacteria 1557
259 Ga0207678_10007961 3300026067 Bacteria 9347
260 Ga0207708_10017779 3300026075 Bacteria 5351
261 Ga0207708_10036408 3300026075 Bacteria 3746
262 Ga0207702_10330364 3300026078 Bacteria 1454
263 Ga0207648_10006652 3300026089 Bacteria 11473
264 Ga0207676_10013267 3300026095 Bacteria 5919
265 Ga0207676_10411231 3300026095 Bacteria 1267
266 Ga0207674_10003366 3300026116 Bacteria 19630
267 Ga0207674_10113166 3300026116 Bacteria 2687
268 Ga0207674_10150565 3300026116 Bacteria 2284
269 Ga0207675_100020755 3300026118 Bacteria 6124
270 Ga0207675_100021524 3300026118 Bacteria 6005
271 Ga0207675_100114373 3300026118 Bacteria 2549
272 Ga0207683_10121380 3300026121 Bacteria 2346
273 Ga0207683_10230489 3300026121 Bacteria 1689
274 Ga0207698_10000546 3300026142 Bacteria 21869
275 Ga0207698_10011879 3300026142 Bacteria 5670
276 Ga0207698_10043297 3300026142 Bacteria 3371
277 Ga0207428_10002647 3300027907 Bacteria 17846
278 Ga0207428_10043589 3300027907 Bacteria 3622
279 Ga0268265_10014634 3300028380 Bacteria 5349
280 Ga0268265_10231085 3300028380 Bacteria 1626
281 Ga0268264_10097868 3300028381 Bacteria 2544
282 Ga0265337_1003247 3300028556 Bacteria 7107
283 Ga0265337_1028178 3300028556 Bacteria 1688
284 Ga0265326_10044140 3300028558 Bacteria 1265
285 Ga0265319_1005290 3300028563 Bacteria 6213
286 Ga0265319_1007002 3300028563 Bacteria 5130
287 Ga0265334_10009710 3300028573 Unclassified 4067
288 Ga0265318_10001224 3300028577 Bacteria 15611
289 Ga0265318_10022594 3300028577 Bacteria 2513
290 Ga0265338_10025672 3300028800 Bacteria 5971
291 Ga0265338_10078332 3300028800 Unclassified 2788
292 Ga0307512_10000296 3300030522 Bacteria 71852
293 Ga0265332_10054887 3300031238 Unclassified 1709
294 Ga0265320_10002298 3300031240 Bacteria 13393
295 Ga0265320_10002368 3300031240 Bacteria 13186
296 Ga0265340_10002753 3300031247 Bacteria 10014
297 Ga0265340_10035273 3300031247 Bacteria 2485
298 Ga0265331_10081765 3300031250 Bacteria 1500
299 Ga0265331_10082801 3300031250 Bacteria 1488
300 Ga0265327_10012837 3300031251 Bacteria 5615
301 Ga0265316_10054153 3300031344 Bacteria 3141
302 Ga0307513_10000001 3300031456 Bacteria 1660464
303 Ga0265313_10054183 3300031595 Unclassified 1906
304 Ga0307508_10012227 3300031616 Bacteria 7847
305 Ga0316579_10091363 3300031691 Bacteria 1454
306 Ga0265314_10001801 3300031711 Bacteria 23105
307 Ga0265314_10035890 3300031711 Bacteria 3610
308 Ga0316576_10021659 3300031727 Bacteria 4450
309 Ga0316576_10026237 3300031727 Bacteria 4087
310 Ga0316576_10041384 3300031727 Bacteria 3317
311 Ga0316576_10350014 3300031727 Bacteria 1099
312 Ga0307516_10094526 3300031730 Bacteria 2813
313 Ga0307516_10143912 3300031730 Bacteria 2151
314 Ga0307405_10067763 3300031731 Bacteria 2281
315 Ga0307518_10149847 3300031838 Bacteria 1615
316 Ga0307410_10118426 3300031852 Bacteria 1927
317 Ga0307406_10008519 3300031901 Bacteria 5725
318 Ga0307406_10085632 3300031901 Bacteria 2108
319 Ga0307407_10009079 3300031903 Bacteria 4611
320 Ga0307407_10133640 3300031903 Bacteria 1591
321 Ga0307412_10029994 3300031911 Bacteria 3419
322 Ga0307409_100001648 3300031995 Bacteria 11194
323 Ga0307409_100076179 3300031995 Bacteria 2689
324 Ga0307414_10113423 3300032004 Bacteria 2069
325 Ga0307415_100005147 3300032126 Bacteria 6898
326 Ga0307415_100079171 3300032126 Bacteria 2340
327 Ga0307415_100157386 3300032126 Bacteria 1756
328 Ga0316583_10020093 3300032133 Bacteria 2393
329 Ga0307507_10083915 3300033179 Bacteria 2781
330 Ga0373951_0000555 3300035091 Bacteria 10438
331 Ga0373936_0109933 3300035113 Bacteria 1170
332 Ga0316574_0054035 3300035398 Bacteria 2508
333 Ga0316574_0126039 3300035398 Bacteria 1646
334 Ga0316574_0132999 3300035398 Bacteria 1601
335 Ga0316574_0136126 3300035398 Bacteria 1582
336 Ga0316574_0136919 3300035398 Bacteria 1577
337 Ga0373927_0308896 3300035695 Bacteria 1041
338 Ga0373947_0042168 3300035725 Bacteria 2724
339 Ga0436364_0439256 3300037853 Bacteria 14421
340 Ga0400483_018531 3300039062 Bacteria 58611
341 Ga0400483_026059 3300039062 Bacteria 3067
342 Ga0400483_157467 3300039062 Bacteria 5265
343 Ga0400483_219255 3300039062 Bacteria 53229
344 Ga0436365_1029827 3300039437 Bacteria 22692
345 Ga0436365_1407609 3300039437 Bacteria 22047
346 Ga0436362_0250117 3300039453 Bacteria 5706
347 Ga0439465_0027400 3300041413 Bacteria 1805
348 Ga0451791_1009347 3300041451 Bacteria 1875
349 Ga0451841_0096979 3300041498 Bacteria 1987
350 Ga0451843_0930883 3300041509 Bacteria 1060
351 Ga0451853_0145122 3300041512 Bacteria 2626
352 Ga0451853_0450515 3300041512 Bacteria 7912
353 Ga0439448_0029296 3300042005 Bacteria 1742
354 Ga0439449_0001034 3300042007 Bacteria 10949
355 Ga0439449_0013219 3300042007 Bacteria 3105
356 Ga0453683_0004947 3300044673 Bacteria 9362
357 Ga0453683_0058063 3300044673 Bacteria 2421
358 Ga0453684_0089989 3300044712 Bacteria 3793
359 Ga0495603_0023426 3300046455 Bacteria 3736
360 Ga0495603_0051861 3300046455 Bacteria 2436
361 Ga0495603_0061543 3300046455 Bacteria 2217
362 Ga0495590_0000141 3300046457 Bacteria 43370
363 Ga0495641_0012847 3300046461 Bacteria 4648
364 Ga0495641_0066502 3300046461 Bacteria 1622
365 Ga0495651_0251084 3300046462 Bacteria 1208
366 Ga0495653_0128635 3300046463 Bacteria 1796
367 Ga0495650_0000508 3300046471 Bacteria 58152
368 Ga0495582_0060921 3300046473 Bacteria 2083
369 Ga0495639_0067923 3300046475 Bacteria 1643
370 Ga0495662_0003349 3300046476 Bacteria 8126
371 Ga0495664_0280233 3300046477 Bacteria 1007
372 Ga0495606_0002413 3300046507 Bacteria 21807
373 Ga0495587_0202407 3300046536 Bacteria 1123
374 Ga0495635_0157011 3300046663 Bacteria 1548
375 Ga0495657_0003646 3300046675 Bacteria 12497
376 Ga0495613_0006587 3300046689 Bacteria 8682
377 Ga0495613_0060665 3300046689 Bacteria 2770
378 Ga0495589_0029796 3300046794 Bacteria 2751
379 Ga0495604_0174238 3300047317 Bacteria 1510
380 Ga0495674_0082029 3300047319 Bacteria 2765
381 Ga0495674_0234898 3300047319 Bacteria 1512
382 Ga0495672_0150089 3300047320 Bacteria 1209
383 Ga0495676_0024447 3300047321 Bacteria 5230
384 Ga0495680_0327456 3300047322 Bacteria 1071
385 Ga0495685_020288 3300047447 Bacteria 2283
386 Ga0495684_0094054 3300047471 Bacteria 2270
387 Ga0495626_0039886 3300048091 Bacteria 2220
388 Ga0496100_0006441 3300048903 Bacteria 6400
389 Ga0496101_0002535 3300048904 Bacteria 11218
390 Ga0496101_0032208 3300048904 Bacteria 3688
391 Ga0496101_0038664 3300048904 Bacteria 3389
392 Ga0496102_0001623 3300048905 Bacteria 19807
393 Ga0496103_0052292 3300048906 Bacteria 2530
394 Ga0496103_0082653 3300048906 Bacteria 2021
395 Ga0496104_0000254 3300048907 Bacteria 47479
396 Ga0496104_0006435 3300048907 Bacteria 10325
397 Ga0496104_0028591 3300048907 Bacteria 5167
398 Ga0496104_0036151 3300048907 Bacteria 4615
399 Ga0496104_0270477 3300048907 Bacteria 1612
400 Ga0496104_0330088 3300048907 Bacteria 1438
401 Ga0496105_0000055 3300048908 Bacteria 88389
402 Ga0496105_0006658 3300048908 Bacteria 8895
403 Ga0496105_0012523 3300048908 Bacteria 6715
404 Ga0496105_0050467 3300048908 Bacteria 3436
405 Ga0496105_0227772 3300048908 Bacteria 1515
406 Ga0496106_0018472 3300048909 Bacteria 5156
407 Ga0496106_0211833 3300048909 Bacteria 1544
408 Ga0496106_0224660 3300048909 Bacteria 1498
409 Ga0496107_0030922 3300048910 Bacteria 3818
410 Ga0496107_0138803 3300048910 Bacteria 1797
411 Ga0496108_0000983 3300048911 Bacteria 22185
412 Ga0496108_0004832 3300048911 Bacteria 10872
413 Ga0496108_0013658 3300048911 Bacteria 6629
414 Ga0496108_0030064 3300048911 Bacteria 4503
415 Ga0496108_0052881 3300048911 Bacteria 3405
416 Ga0496109_0024333 3300048912 Bacteria 5383
417 Ga0496109_0040031 3300048912 Bacteria 4244
418 Ga0496109_0058454 3300048912 Bacteria 3522
419 Ga0496109_0101409 3300048912 Bacteria 2671
420 Ga0496109_0106525 3300048912 Bacteria 2604
421 Ga0496109_0184610 3300048912 Bacteria 1960
422 Ga0496109_0223279 3300048912 Bacteria 1772
423 Ga0496110_0000306 3300048913 Bacteria 32370
424 Ga0496110_0097562 3300048913 Bacteria 2633
425 Ga0496111_0000092 3300048914 Bacteria 38172
426 Ga0496111_0010428 3300048914 Bacteria 6235
427 Ga0496111_0121387 3300048914 Bacteria 1930
428 Ga0496112_0009046 3300048915 Bacteria 8946
429 Ga0496112_0129549 3300048915 Bacteria 2494
430 Ga0496112_0267470 3300048915 Bacteria 1658
431 Ga0496113_0002577 3300048916 Bacteria 10590
432 Ga0496113_0092257 3300048916 Bacteria 2336
433 Ga0496113_0275467 3300048916 Bacteria 1345
434 Ga0496114_0000256 3300048917 Bacteria 38442
435 Ga0496114_0004277 3300048917 Bacteria 11054
436 Ga0496114_0005571 3300048917 Bacteria 9870
437 Ga0496114_0044504 3300048917 Bacteria 3683
438 Ga0496114_0054316 3300048917 Bacteria 3340
439 Ga0496114_0069692 3300048917 Bacteria 2953
440 Ga0496114_0112074 3300048917 Bacteria 2338
441 Ga0496114_0452707 3300048917 Bacteria 1137
442 Ga0496115_0018044 3300048918 Bacteria 5408
443 Ga0496119_0000959 3300048922 Bacteria 37115
444 Ga0496120_0000257 3300048923 Bacteria 88760
445 Ga0496126_0260894 3300048929 Bacteria 1441
446 Ga0501031_0007713 3300049568 Bacteria 7006
447 Ga0501031_0021925 3300049568 Bacteria 4162
448 Ga0501031_0141729 3300049568 Bacteria 1571
449 Ga0501031_0174424 3300049568 Bacteria 1405
450 Ga0501032_0067972 3300049569 Bacteria 2379
451 Ga0501032_0128654 3300049569 Bacteria 1672
452 Ga0501033_0060719 3300049570 Bacteria 2788
453 Ga0501033_0170010 3300049570 Bacteria 1566
454 Ga0501034_0021251 3300049571 Bacteria 6618
455 Ga0501034_0044015 3300049571 Bacteria 4515
456 Ga0501034_0077004 3300049571 Bacteria 3341
457 Ga0501034_0199864 3300049571 Bacteria 1957
458 Ga0501036_0024728 3300049572 Bacteria 5063
459 Ga0501036_0051443 3300049572 Bacteria 3488
460 Ga0501037_0041131 3300049573 Bacteria 3400
461 Ga0501037_0104857 3300049573 Bacteria 2038
462 Ga0501038_0017723 3300049574 Bacteria 6436
463 Ga0501038_0038980 3300049574 Bacteria 4158
464 Ga0501038_0183187 3300049574 Bacteria 1689
465 Ga0501038_0373736 3300049574 Bacteria 1107
466 Ga0501039_0030290 3300049575 Bacteria 4171
467 Ga0501039_0081526 3300049575 Bacteria 2519
468 Ga0501039_0354784 3300049575 Bacteria 1152
469 Ga0501040_0090764 3300049576 Bacteria 2123
470 Ga0501041_0011146 3300049577 Bacteria 5309
471 Ga0501041_0217375 3300049577 Bacteria 1199
472 Ga0501042_0039037 3300049578 Bacteria 3374
473 Ga0501042_0251791 3300049578 Bacteria 1274
474 Ga0501046_0017001 3300049580 Bacteria 6082
475 Ga0501046_0056569 3300049580 Bacteria 3079
476 Ga0501046_0064721 3300049580 Bacteria 2854
477 Ga0501046_0144716 3300049580 Bacteria 1796
478 Ga0501046_0329269 3300049580 Bacteria 1112
479 Ga0501047_0140170 3300049581 Bacteria 2297
480 Ga0501047_0155461 3300049581 Bacteria 2161
481 Ga0501048_0011265 3300049582 Bacteria 6669
482 Ga0501048_0027774 3300049582 Bacteria 4109
483 Ga0501048_0034961 3300049582 Bacteria 3621
484 Ga0501048_0046549 3300049582 Bacteria 3096
485 Ga0501048_0177462 3300049582 Bacteria 1510
486 Ga0501048_0204833 3300049582 Bacteria 1399
487 Ga0501067_0029347 3300049583 Bacteria 3048
488 Ga0501067_0063195 3300049583 Bacteria 2050
489 Ga0501068_0020958 3300049584 Bacteria 3814
490 Ga0501068_0102063 3300049584 Bacteria 1779
491 Ga0501069_0006943 3300049585 Bacteria 5919
492 Ga0501070_0010209 3300049586 Bacteria 7945
493 Ga0501070_0021140 3300049586 Bacteria 5461
494 Ga0501070_0023607 3300049586 Bacteria 5152
495 Ga0501070_0071645 3300049586 Bacteria 2869
496 Ga0501070_0115682 3300049586 Bacteria 2215
497 Ga0501070_0120765 3300049586 Bacteria 2166
498 Ga0501071_0006580 3300049587 Bacteria 7548
499 Ga0501071_0018214 3300049587 Bacteria 4858
500 Ga0501071_0020602 3300049587 Bacteria 4584
501 Ga0501071_0176364 3300049587 Bacteria 1601
502 Ga0501071_0204996 3300049587 Bacteria 1482
503 Ga0501072_0011816 3300049588 Bacteria 6670
504 Ga0501072_0023324 3300049588 Bacteria 4805
505 Ga0501072_0046231 3300049588 Bacteria 3425
506 Ga0501072_0217992 3300049588 Bacteria 1521
507 Ga0501072_0488989 3300049588 Bacteria 973
508 Ga0501073_0008149 3300049589 Bacteria 7773
509 Ga0501073_0040007 3300049589 Bacteria 3320
510 Ga0501073_0115147 3300049589 Bacteria 1864
511 Ga0501074_0009891 3300049590 Bacteria 6928
512 Ga0501074_0113400 3300049590 Bacteria 1939
513 Ga0501074_0135673 3300049590 Bacteria 1760
514 Ga0501074_0180406 3300049590 Bacteria 1506
515 Ga0501075_0023907 3300049591 Bacteria 4475
516 Ga0501075_0041828 3300049591 Bacteria 3435
517 Ga0501075_0079655 3300049591 Bacteria 2479
518 Ga0501075_0104185 3300049591 Bacteria 2156
519 Ga0501075_0274594 3300049591 Bacteria 1284
520 Ga0501075_0386565 3300049591 Bacteria 1067
521 Ga0501076_0005549 3300049592 Bacteria 9087
522 Ga0501076_0006148 3300049592 Bacteria 8691
523 Ga0501076_0019041 3300049592 Bacteria 5237
524 Ga0501076_0024689 3300049592 Bacteria 4648
525 Ga0501076_0060775 3300049592 Bacteria 3007
526 Ga0501076_0065881 3300049592 Bacteria 2890
527 Ga0501076_0468356 3300049592 Bacteria 1038
528 Ga0501077_0015358 3300049593 Bacteria 4821
529 Ga0501077_0049089 3300049593 Bacteria 2682
530 Ga0501079_0025854 3300049741 Bacteria 4503
531 Ga0501079_0026178 3300049741 Bacteria 4472
532 Ga0501079_0196667 3300049741 Bacteria 1574
533 Ga0501079_0215935 3300049741 Bacteria 1498
534 Ga0501079_0263011 3300049741 Bacteria 1348
535 Ga0501080_0001999 3300049742 Bacteria 17601
536 Ga0501080_0028590 3300049742 Bacteria 5188
537 Ga0501080_0029937 3300049742 Bacteria 5068
538 Ga0501080_0089022 3300049742 Bacteria 2867
539 Ga0501080_0104322 3300049742 Bacteria 2629
540 Ga0501080_0293876 3300049742 Bacteria 1475
541 Ga0501081_0004295 3300049743 Bacteria 9129
542 Ga0501083_0001849 3300049744 Bacteria 14523
543 Ga0501083_0036635 3300049744 Bacteria 3345
544 Ga0501035_0031050 3300049822 Bacteria 4866
545 Ga0501035_0299114 3300049822 Bacteria 1356
546 Ga0501044_0158662 3300049823 Bacteria 2240
547 Ga0501044_0270455 3300049823 Bacteria 1635
548 Ga0501045_0004608 3300049824 Bacteria 9522
549 Ga0501045_0036638 3300049824 Bacteria 3563
550 Ga0501045_0061550 3300049824 Bacteria 2754
551 Ga0501045_0107462 3300049824 Bacteria 2068
552 Ga0501045_0126834 3300049824 Bacteria 1896
553 Ga0501045_0155301 3300049824 Bacteria 1703
554 nmdc:mga03n38_109777_c1 3300050490 Bacteria 1342
555 nmdc:mga00v17_81914_c1 3300050491 Bacteria 2016
556 nmdc:mga07m45_6304_c1 3300050496 Bacteria 5990
557 nmdc:mga07m45_86225_c1 3300050496 Bacteria 1796
558 nmdc:mga05p37_121038_c1 3300050507 Bacteria 3215
559 nmdc:mga05p37_126438_c1 3300050507 Bacteria 3139
560 nmdc:mga05p37_5351_c1 3300050507 Bacteria 15084
561 nmdc:mga09592_7679_c1 3300050508 Bacteria 8768
562 nmdc:mga0qj67_16_c1 3300050509 Bacteria 124323
563 nmdc:mga0qj67_17318_c1 3300050509 Bacteria 5477
564 nmdc:mga0qj67_213678_c1 3300050509 Bacteria 1566
565 nmdc:mga06r32_38_c1 3300050510 Bacteria 13919
566 nmdc:mga08y16_183897_c1 3300050511 Bacteria 2169
567 nmdc:mga08y16_22515_c1 3300050511 Bacteria 6652
568 nmdc:mga08y16_2792_c1 3300050511 Bacteria 17902
569 nmdc:mga0rr50_279989_c1 3300050513 Bacteria 1391
570 Ga0500635_0013383 3300053080 Bacteria 2382
571 Ga0495619_0058017 3300053085 Bacteria 2569
572 Ga0495619_0254926 3300053085 Bacteria 1216
573 Ga0500628_029249 3300053129 Bacteria 1183
574 Ga0500559_0000078 3300053136 Bacteria 76033
575 Ga0500568_0004651 3300053139 Bacteria 7301
576 Ga0500573_0000011 3300053140 Bacteria 209484
577 Ga0500616_0001398 3300053153 Bacteria 23244
578 Ga0500620_000016 3300053155 Bacteria 36323
579 Ga0501084_0013022 3300054114 Bacteria 6882
580 Ga0501084_0052176 3300054114 Bacteria 3422
581 Ga0501084_0092773 3300054114 Bacteria 2535
582 Ga0501084_0099264 3300054114 Bacteria 2445
583 Ga0501084_0191354 3300054114 Bacteria 1726
584 Ga0501084_0347770 3300054114 Bacteria 1252
585 Ga0501082_0045538 3300060353 Unclassified 3783
586 Ga0501082_0094682 3300060353 Bacteria 2581
587 Ga0501082_0114551 3300060353 Bacteria 2334
588 Ga0530510_0003441 3300061734 Bacteria 10880
589 Ga0530510_0137587 3300061734 Bacteria 1798
590 Ga0530510_0156941 3300061734 Bacteria 1682
591 Ga0530510_0420243 3300061734 Bacteria 1009

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006847 Ga0075431_100188874 Ga0075431_1001888742 268
2 3300049591 Ga0501075_0104185 Ga0501075_0104185_611_1477 269
3 3300006846 Ga0075430_100081788 Ga0075430_1000817882 270
4 3300050509 nmdc:mga0qj67_17318_c1 nmdc:mga0qj67_17318_c1_607_1614 270
5 3300048912 Ga0496109_0223279 Ga0496109_0223279_795_1742 273
6 3300048915 Ga0496112_0267470 Ga0496112_0267470_65_1012 273
7 3300048906 Ga0496103_0082653 Ga0496103_0082653_1170_2003 277
8 3300048911 Ga0496108_0030064 Ga0496108_0030064_23_901 277
9 3300049742 Ga0501080_0293876 Ga0501080_0293876_228_1064 278
10 3300054114 Ga0501084_0013022 Ga0501084_0013022_2450_3286 278
11 3300005843 Ga0068860_100262705 Ga0068860_1002627052 280
12 3300028573 Ga0265334_10009710 Ga0265334_100097102 280
13 3300028800 Ga0265338_10078332 Ga0265338_100783322 280
14 3300031238 Ga0265332_10054887 Ga0265332_100548872 280
15 3300031247 Ga0265340_10002753 Ga0265340_100027537 280
16 3300031595 Ga0265313_10054183 Ga0265313_100541831 280
17 3300031727 Ga0316576_10350014 Ga0316576_103500142 280
18 3300035398 Ga0316574_0126039 Ga0316574_0126039_104_1039 280
19 3300048917 Ga0496114_0112074 Ga0496114_0112074_28_870 280
20 3300049568 Ga0501031_0007713 Ga0501031_0007713_3683_4621 280
21 3300049569 Ga0501032_0067972 Ga0501032_0067972_59_997 280
22 3300049570 Ga0501033_0060719 Ga0501033_0060719_221_1159 280
23 3300049572 Ga0501036_0024728 Ga0501036_0024728_127_1065 280
24 3300049573 Ga0501037_0041131 Ga0501037_0041131_1966_2904 280
25 3300049574 Ga0501038_0017723 Ga0501038_0017723_3863_4801 280
26 3300049575 Ga0501039_0030290 Ga0501039_0030290_2570_3508 280
27 3300049576 Ga0501040_0090764 Ga0501040_0090764_615_1553 280
28 3300049577 Ga0501041_0011146 Ga0501041_0011146_1927_2865 280
29 3300049580 Ga0501046_0017001 Ga0501046_0017001_1755_2693 280
30 3300049582 Ga0501048_0011265 Ga0501048_0011265_4126_5064 280
31 3300049584 Ga0501068_0020958 Ga0501068_0020958_308_1246 280
32 3300049585 Ga0501069_0006943 Ga0501069_0006943_3292_4230 280
33 3300049586 Ga0501070_0071645 Ga0501070_0071645_521_1459 280
34 3300049587 Ga0501071_0018214 Ga0501071_0018214_3805_4743 280
35 3300049590 Ga0501074_0009891 Ga0501074_0009891_2386_3324 280
36 3300049591 Ga0501075_0023907 Ga0501075_0023907_1435_2373 280
37 3300049592 Ga0501076_0019041 Ga0501076_0019041_4102_5040 280
38 3300049593 Ga0501077_0015358 Ga0501077_0015358_1330_2268 280
39 3300049742 Ga0501080_0029937 Ga0501080_0029937_503_1441 280
40 3300049822 Ga0501035_0031050 Ga0501035_0031050_2569_3507 280
41 3300054114 Ga0501084_0052176 Ga0501084_0052176_616_1554 280
42 3300061734 Ga0530510_0137587 Ga0530510_0137587_562_1500 280
43 iso_pu_bacteria 2887478801 2887487046 280
44 3300046457 Ga0495590_0000141 Ga0495590_0000141_4258_5103 281
45 3300025972 Ga0207668_10192963 Ga0207668_101929632 282
46 3300028577 Ga0265318_10022594 Ga0265318_100225941 282
47 3300031240 Ga0265320_10002298 Ga0265320_100022982 283
48 3300031250 Ga0265331_10081765 Ga0265331_100817652 283
49 3300044673 Ga0453683_0004947 Ga0453683_0004947_430_1287 283
50 3300049592 Ga0501076_0468356 Ga0501076_0468356_115_966 283
51 3300005983 Ga0081540_1057073 Ga0081540_10570732 284
52 3300006844 Ga0075428_100160786 Ga0075428_1001607862 284
53 3300026121 Ga0207683_10121380 Ga0207683_101213802 284
54 3300031903 Ga0307407_10133640 Ga0307407_101336402 284
55 3300031995 Ga0307409_100076179 Ga0307409_1000761791 284
56 3300041413 Ga0439465_0027400 Ga0439465_0027400_63_1019 284
57 3300042007 Ga0439449_0001034 Ga0439449_0001034_9945_10802 284
58 3300048929 Ga0496126_0260894 Ga0496126_0260894_86_940 284
59 3300013308 Ga0157375_10062400 Ga0157375_100624002 285
60 3300049570 Ga0501033_0170010 Ga0501033_0170010_11_868 285
61 3300049578 Ga0501042_0251791 Ga0501042_0251791_355_1212 285
62 3300049580 Ga0501046_0064721 Ga0501046_0064721_1632_2489 285
63 3300049582 Ga0501048_0046549 Ga0501048_0046549_1770_2627 285
64 3300049589 Ga0501073_0115147 Ga0501073_0115147_896_1753 285
65 3300049591 Ga0501075_0274594 Ga0501075_0274594_380_1237 285
66 3300049741 Ga0501079_0263011 Ga0501079_0263011_473_1330 285
67 3300049824 Ga0501045_0061550 Ga0501045_0061550_1812_2669 285
68 3300054114 Ga0501084_0347770 Ga0501084_0347770_13_870 285
69 3300060353 Ga0501082_0045538 Ga0501082_0045538_1084_1941 285
70 3300061734 Ga0530510_0420243 Ga0530510_0420243_117_974 285
71 iso_pu_bacteria 2891968417 2891970562 285
72 3300025916 Ga0207663_10073100 Ga0207663_100731002 286
73 3300025923 Ga0207681_10194415 Ga0207681_101944152 286
74 3300025972 Ga0207668_10128218 Ga0207668_101282182 286
75 3300039062 Ga0400483_026059 Ga0400483_026059_264_1124 286
76 3300039062 Ga0400483_157467 Ga0400483_157467_3271_4131 286
77 3300005330 Ga0070690_100040668 Ga0070690_1000406682 288
78 3300005347 Ga0070668_100005312 Ga0070668_1000053124 288
79 3300005356 Ga0070674_100039828 Ga0070674_1000398282 288
80 3300005563 Ga0068855_100036885 Ga0068855_1000368851 288
81 3300005564 Ga0070664_100403361 Ga0070664_1004033612 288
82 3300005718 Ga0068866_10004355 Ga0068866_100043553 288
83 3300005842 Ga0068858_100263410 Ga0068858_1002634102 288
84 3300005843 Ga0068860_100120963 Ga0068860_1001209633 288
85 3300006048 Ga0075363_100153674 Ga0075363_1001536742 288
86 3300006237 Ga0097621_100138971 Ga0097621_1001389713 288
87 3300006353 Ga0075370_10061525 Ga0075370_100615253 288
88 3300006844 Ga0075428_100286554 Ga0075428_1002865542 288
89 3300006881 Ga0068865_100046009 Ga0068865_1000460092 288
90 3300009148 Ga0105243_10031424 Ga0105243_100314242 288
91 3300009177 Ga0105248_10172624 Ga0105248_101726244 288
92 3300009177 Ga0105248_10316236 Ga0105248_103162362 288
93 3300009553 Ga0105249_10015170 Ga0105249_100151705 288
94 3300013297 Ga0157378_10005765 Ga0157378_100057654 288
95 3300013306 Ga0163162_10258270 Ga0163162_102582702 288
96 3300013308 Ga0157375_10122873 Ga0157375_101228732 288
97 3300014325 Ga0163163_10092884 Ga0163163_100928844 288
98 3300014968 Ga0157379_10053107 Ga0157379_100531073 288
99 3300025899 Ga0207642_10009777 Ga0207642_100097773 288
100 3300025909 Ga0207705_10133949 Ga0207705_101339492 288
101 3300025934 Ga0207686_10025028 Ga0207686_100250283 288
102 3300025935 Ga0207709_10011467 Ga0207709_100114671 288
103 3300025936 Ga0207670_10091013 Ga0207670_100910132 288
104 3300025937 Ga0207669_10082859 Ga0207669_100828592 288
105 3300025938 Ga0207704_10012489 Ga0207704_100124893 288
106 3300025949 Ga0207667_10070293 Ga0207667_100702933 288
107 3300026089 Ga0207648_10006652 Ga0207648_100066527 288
108 3300026095 Ga0207676_10411231 Ga0207676_104112312 288
109 3300027907 Ga0207428_10002647 Ga0207428_100026478 288
110 3300028381 Ga0268264_10097868 Ga0268264_100978682 288
111 3300041451 Ga0451791_1009347 Ga0451791_1009347_208_1134 288
112 3300046477 Ga0495664_0280233 Ga0495664_0280233_54_920 288
113 3300048904 Ga0496101_0032208 Ga0496101_0032208_1720_2586 288
114 3300048906 Ga0496103_0052292 Ga0496103_0052292_1079_1945 288
115 3300048907 Ga0496104_0036151 Ga0496104_0036151_128_994 288
116 3300048907 Ga0496104_0330088 Ga0496104_0330088_407_1336 288
117 3300048908 Ga0496105_0050467 Ga0496105_0050467_1744_2673 288
118 3300048909 Ga0496106_0018472 Ga0496106_0018472_2204_3070 288
119 3300048909 Ga0496106_0211833 Ga0496106_0211833_112_1041 288
120 3300048910 Ga0496107_0030922 Ga0496107_0030922_1078_1944 288
121 3300048912 Ga0496109_0024333 Ga0496109_0024333_3191_4120 288
122 3300048913 Ga0496110_0097562 Ga0496110_0097562_798_1664 288
123 3300048914 Ga0496111_0010428 Ga0496111_0010428_1006_1872 288
124 3300048916 Ga0496113_0092257 Ga0496113_0092257_791_1720 288
125 3300048917 Ga0496114_0005571 Ga0496114_0005571_3750_4616 288
126 3300049574 Ga0501038_0183187 Ga0501038_0183187_72_938 288
127 3300049575 Ga0501039_0081526 Ga0501039_0081526_145_1011 288
128 3300049577 Ga0501041_0217375 Ga0501041_0217375_258_1124 288
129 3300049578 Ga0501042_0039037 Ga0501042_0039037_546_1412 288
130 3300049580 Ga0501046_0056569 Ga0501046_0056569_403_1269 288
131 3300049588 Ga0501072_0488989 Ga0501072_0488989_21_887 288
132 3300049592 Ga0501076_0005549 Ga0501076_0005549_59_925 288
133 3300049593 Ga0501077_0049089 Ga0501077_0049089_48_914 288
134 3300049741 Ga0501079_0026178 Ga0501079_0026178_2327_3193 288
135 3300049743 Ga0501081_0004295 Ga0501081_0004295_3422_4288 288
136 3300050491 nmdc:mga00v17_81914_c1 nmdc:mga00v17_81914_c1_182_1048 288
137 iso_pu_bacteria 8056054917 8056057345 288
138 3300006846 Ga0075430_100147531 Ga0075430_1001475312 289
139 3300048910 Ga0496107_0138803 Ga0496107_0138803_561_1481 289
140 3300049582 Ga0501048_0034961 Ga0501048_0034961_2035_2970 289
141 3300049587 Ga0501071_0020602 Ga0501071_0020602_2278_3213 289
142 3300049592 Ga0501076_0006148 Ga0501076_0006148_262_1197 289
143 3300049741 Ga0501079_0215935 Ga0501079_0215935_402_1337 289
144 3300049824 Ga0501045_0004608 Ga0501045_0004608_5220_6155 289
145 3300050509 nmdc:mga0qj67_213678_c1 nmdc:mga0qj67_213678_c1_188_1057 289
146 3300054114 Ga0501084_0191354 Ga0501084_0191354_17_952 289
147 3300060353 Ga0501082_0114551 Ga0501082_0114551_340_1275 289
148 3300046461 Ga0495641_0066502 Ga0495641_0066502_169_1089 290
149 3300049581 Ga0501047_0140170 Ga0501047_0140170_481_1437 290
150 3300049586 Ga0501070_0010209 Ga0501070_0010209_4706_5662 290
151 3300049590 Ga0501074_0135673 Ga0501074_0135673_284_1240 290
152 3300049741 Ga0501079_0025854 Ga0501079_0025854_587_1543 290
153 3300049742 Ga0501080_0028590 Ga0501080_0028590_330_1286 290
154 3300049744 Ga0501083_0001849 Ga0501083_0001849_8862_9818 290
155 3300009093 Ga0105240_10007531 Ga0105240_1000753111 291
156 3300009174 Ga0105241_10001026 Ga0105241_100010267 291
157 3300013104 Ga0157370_10278306 Ga0157370_102783061 291
158 3300025254 Ga0209148_1000868 Ga0209148_10008684 291
159 3300025911 Ga0207654_10000001 Ga0207654_10000001962 291
160 3300025913 Ga0207695_10006733 Ga0207695_1000673310 291
161 3300025914 Ga0207671_10238505 Ga0207671_102385051 291
162 3300026078 Ga0207702_10330364 Ga0207702_103303642 291
163 3300031730 Ga0307516_10094526 Ga0307516_100945262 291
164 3300049571 Ga0501034_0044015 Ga0501034_0044015_1817_2692 291
165 3300009147 Ga0114129_10105395 Ga0114129_101053954 292
166 3300031711 Ga0265314_10001801 Ga0265314_1000180111 292
167 3300031727 Ga0316576_10026237 Ga0316576_100262373 292
168 3300044673 Ga0453683_0058063 Ga0453683_0058063_443_1330 292
169 3300044712 Ga0453684_0089989 Ga0453684_0089989_1639_2526 292
170 3300047320 Ga0495672_0150089 Ga0495672_0150089_282_1160 292
171 3300048907 Ga0496104_0270477 Ga0496104_0270477_373_1335 292
172 3300049582 Ga0501048_0204833 Ga0501048_0204833_214_1119 292
173 3300049588 Ga0501072_0217992 Ga0501072_0217992_292_1197 292
174 3300009098 Ga0105245_10294443 Ga0105245_102944432 293
175 3300010375 Ga0105239_10441285 Ga0105239_104412852 293
176 3300025927 Ga0207687_10266091 Ga0207687_102660912 293
177 3300032126 Ga0307415_100079171 Ga0307415_1000791712 293
178 3300042007 Ga0439449_0013219 Ga0439449_0013219_777_1661 293
179 3300048911 Ga0496108_0004832 Ga0496108_0004832_7466_8434 293
180 3300048916 Ga0496113_0275467 Ga0496113_0275467_11_910 293
181 3300049584 Ga0501068_0102063 Ga0501068_0102063_730_1677 293
182 3300032126 Ga0307415_100157386 Ga0307415_1001573862 294
183 3300005445 Ga0070708_100282186 Ga0070708_1002821862 295
184 3300053155 Ga0500620_000016 Ga0500620_000016_35382_36272 295
185 3300031730 Ga0307516_10143912 Ga0307516_101439122 296
186 3300031903 Ga0307407_10009079 Ga0307407_100090794 296
187 3300031911 Ga0307412_10029994 Ga0307412_100299942 296
188 3300049571 Ga0501034_0021251 Ga0501034_0021251_5421_6365 296
189 3300049586 Ga0501070_0120765 Ga0501070_0120765_385_1275 296
190 3300049589 Ga0501073_0008149 Ga0501073_0008149_5666_6556 296
191 3300049590 Ga0501074_0180406 Ga0501074_0180406_127_1071 296
192 3300049742 Ga0501080_0104322 Ga0501080_0104322_1001_1891 296
193 3300049823 Ga0501044_0270455 Ga0501044_0270455_172_1116 296
194 3300050496 nmdc:mga07m45_6304_c1 nmdc:mga07m45_6304_c1_1304_2194 296
195 3300053080 Ga0500635_0013383 Ga0500635_0013383_11_901 296
196 3300053140 Ga0500573_0000011 Ga0500573_0000011_76015_77031 296
197 3300009148 Ga0105243_10111442 Ga0105243_101114422 297
198 3300021377 Ga0213874_10005463 Ga0213874_100054632 297
199 3300021384 Ga0213876_10002357 Ga0213876_100023573 297
200 3300021384 Ga0213876_10002479 Ga0213876_100024793 297
201 3300021388 Ga0213875_10004993 Ga0213875_100049932 297
202 3300028556 Ga0265337_1003247 Ga0265337_10032475 297
203 3300037853 Ga0436364_0439256 Ga0436364_0439256_4590_5537 297
204 3300039437 Ga0436365_1029827 Ga0436365_1029827_2862_3809 297
205 3300039437 Ga0436365_1407609 Ga0436365_1407609_12737_13684 297
206 3300039453 Ga0436362_0250117 Ga0436362_0250117_4591_5538 297
207 3300049568 Ga0501031_0174424 Ga0501031_0174424_123_1028 297
208 3300049580 Ga0501046_0329269 Ga0501046_0329269_159_1064 297
209 3300049582 Ga0501048_0027774 Ga0501048_0027774_3040_3945 297
210 3300049586 Ga0501070_0115682 Ga0501070_0115682_779_1726 297
211 3300049824 Ga0501045_0036638 Ga0501045_0036638_278_1183 297
212 3300060353 Ga0501082_0094682 Ga0501082_0094682_202_1152 297
213 3300005563 Ga0068855_100001168 Ga0068855_10000116810 298
214 3300009987 Ga0105030_101153 Ga0105030_1011532 298
215 3300025944 Ga0207661_10045526 Ga0207661_100455263 298
216 3300025949 Ga0207667_10001071 Ga0207667_1000107112 298
217 3300028563 Ga0265319_1007002 Ga0265319_10070023 298
218 3300032133 Ga0316583_10020093 Ga0316583_100200932 298
219 3300035398 Ga0316574_0054035 Ga0316574_0054035_11_967 298
220 3300035695 Ga0373927_0308896 Ga0373927_0308896_70_990 298
221 3300048912 Ga0496109_0184610 Ga0496109_0184610_297_1217 298
222 3300048917 Ga0496114_0069692 Ga0496114_0069692_54_974 298
223 3300048922 Ga0496119_0000959 Ga0496119_0000959_9897_10841 299
224 3300005344 Ga0070661_100214209 Ga0070661_1002142092 300
225 3300005466 Ga0070685_10008452 Ga0070685_100084523 300
226 3300005614 Ga0068856_100048811 Ga0068856_1000488113 300
227 3300009093 Ga0105240_10553417 Ga0105240_105534172 300
228 3300009094 Ga0111539_10008475 Ga0111539_100084756 300
229 3300009098 Ga0105245_10043342 Ga0105245_100433422 300
230 3300010375 Ga0105239_10296617 Ga0105239_102966172 300
231 3300025919 Ga0207657_10139129 Ga0207657_101391292 300
232 3300025920 Ga0207649_10087598 Ga0207649_100875982 300
233 3300025924 Ga0207694_10000660 Ga0207694_1000066024 300
234 3300025927 Ga0207687_10052171 Ga0207687_100521713 300
235 3300025949 Ga0207667_10001561 Ga0207667_1000156110 300
236 3300026142 Ga0207698_10011879 Ga0207698_100118794 300
237 3300031727 Ga0316576_10041384 Ga0316576_100413842 300
238 3300046471 Ga0495650_0000508 Ga0495650_0000508_3929_4909 300
239 3300046475 Ga0495639_0067923 Ga0495639_0067923_14_922 300
240 3300050511 nmdc:mga08y16_22515_c1 nmdc:mga08y16_22515_c1_1069_2040 300
241 3300005327 Ga0070658_10004616 Ga0070658_100046162 301
242 3300005338 Ga0068868_100254617 Ga0068868_1002546172 301
243 3300005339 Ga0070660_100164446 Ga0070660_1001644462 301
244 3300005366 Ga0070659_100000996 Ga0070659_10000099617 301
245 3300005539 Ga0068853_100069509 Ga0068853_1000695093 301
246 3300005577 Ga0068857_100140429 Ga0068857_1001404292 301
247 3300005578 Ga0068854_100119873 Ga0068854_1001198732 301
248 3300005617 Ga0068859_100010767 Ga0068859_1000107673 301
249 3300005834 Ga0068851_10000001 Ga0068851_1000000117 301
250 3300005842 Ga0068858_100000016 Ga0068858_10000001675 301
251 3300006931 Ga0097620_100010767 Ga0097620_1000107675 301
252 3300009093 Ga0105240_10013972 Ga0105240_100139722 301
253 3300009545 Ga0105237_10001409 Ga0105237_100014092 301
254 3300025321 Ga0207656_10000005 Ga0207656_10000005406 301
255 3300025909 Ga0207705_10005737 Ga0207705_100057373 301
256 3300025909 Ga0207705_10007412 Ga0207705_100074124 301
257 3300025913 Ga0207695_10005221 Ga0207695_1000522111 301
258 3300025914 Ga0207671_10000016 Ga0207671_1000001652 301
259 3300025919 Ga0207657_10127693 Ga0207657_101276932 301
260 3300025932 Ga0207690_10158970 Ga0207690_101589702 301
261 3300025981 Ga0207640_10117279 Ga0207640_101172792 301
262 3300025986 Ga0207658_10043810 Ga0207658_100438103 301
263 3300026023 Ga0207677_10243725 Ga0207677_102437252 301
264 3300026035 Ga0207703_10000075 Ga0207703_1000007511 301
265 3300026041 Ga0207639_10078220 Ga0207639_100782203 301
266 3300026041 Ga0207639_10172951 Ga0207639_101729512 301
267 3300026116 Ga0207674_10003366 Ga0207674_1000336614 301
268 3300013307 Ga0157372_10691781 Ga0157372_106917811 302
269 3300053139 Ga0500568_0004651 Ga0500568_0004651_5456_6388 302
270 3300005616 Ga0068852_100399083 Ga0068852_1003990832 303
271 3300026142 Ga0207698_10000546 Ga0207698_1000054616 303
272 3300035398 Ga0316574_0132999 Ga0316574_0132999_54_980 303
273 3300049568 Ga0501031_0021925 Ga0501031_0021925_1548_2489 303
274 3300049568 Ga0501031_0141729 Ga0501031_0141729_501_1442 303
275 3300049569 Ga0501032_0128654 Ga0501032_0128654_240_1181 303
276 3300049571 Ga0501034_0199864 Ga0501034_0199864_609_1550 303
277 3300049573 Ga0501037_0104857 Ga0501037_0104857_815_1756 303
278 3300049574 Ga0501038_0038980 Ga0501038_0038980_838_1779 303
279 3300049581 Ga0501047_0155461 Ga0501047_0155461_1090_2031 303
280 3300049583 Ga0501067_0063195 Ga0501067_0063195_778_1719 303
281 3300049586 Ga0501070_0021140 Ga0501070_0021140_3785_4726 303
282 3300049586 Ga0501070_0023607 Ga0501070_0023607_3738_4673 303
283 3300049588 Ga0501072_0046231 Ga0501072_0046231_366_1301 303
284 3300049589 Ga0501073_0040007 Ga0501073_0040007_794_1735 303
285 3300049590 Ga0501074_0113400 Ga0501074_0113400_282_1223 303
286 3300049742 Ga0501080_0089022 Ga0501080_0089022_1145_2086 303
287 3300049822 Ga0501035_0299114 Ga0501035_0299114_22_963 303
288 3300049823 Ga0501044_0158662 Ga0501044_0158662_893_1834 303
289 3300053129 Ga0500628_029249 Ga0500628_029249_37_963 303
290 3300005347 Ga0070668_100507349 Ga0070668_1005073491 304
291 3300005364 Ga0070673_100199455 Ga0070673_1001994552 304
292 3300005466 Ga0070685_10020615 Ga0070685_100206152 304
293 3300005543 Ga0070672_100073213 Ga0070672_1000732132 304
294 3300005564 Ga0070664_100394791 Ga0070664_1003947912 304
295 3300005618 Ga0068864_100158389 Ga0068864_1001583892 304
296 3300005719 Ga0068861_100037646 Ga0068861_1000376462 304
297 3300006237 Ga0097621_100154368 Ga0097621_1001543682 304
298 3300009177 Ga0105248_10138941 Ga0105248_101389412 304
299 3300013308 Ga0157375_10026469 Ga0157375_100264694 304
300 3300014325 Ga0163163_10101349 Ga0163163_101013492 304
301 3300014326 Ga0157380_10067649 Ga0157380_100676493 304
302 3300014969 Ga0157376_10583244 Ga0157376_105832441 304
303 3300025960 Ga0207651_10156574 Ga0207651_101565742 304
304 3300026023 Ga0207677_10325322 Ga0207677_103253221 304
305 3300026118 Ga0207675_100021524 Ga0207675_1000215245 304
306 3300035398 Ga0316574_0136919 Ga0316574_0136919_603_1538 304
307 iso_pu_bacteria 2856741275 2856744292 304
308 iso_pu_bacteria 2891395885 2891398984 304
309 iso_pu_bacteria 2891554331 2891560210 304
310 iso_pu_bacteria 2891562705 2891569361 304
311 3300005441 Ga0070700_100079819 Ga0070700_1000798191 305
312 3300005577 Ga0068857_100234070 Ga0068857_1002340702 305
313 3300005617 Ga0068859_100455323 Ga0068859_1004553231 305
314 3300006931 Ga0097620_100455350 Ga0097620_1004553501 305
315 3300009147 Ga0114129_10320706 Ga0114129_103207062 305
316 3300013296 Ga0157374_10080805 Ga0157374_100808053 305
317 3300013297 Ga0157378_10159003 Ga0157378_101590032 305
318 3300013306 Ga0163162_10067065 Ga0163162_100670653 305
319 3300013308 Ga0157375_10075013 Ga0157375_100750133 305
320 3300025922 Ga0207646_10570567 Ga0207646_105705671 305
321 3300025927 Ga0207687_10035046 Ga0207687_100350462 305
322 3300026075 Ga0207708_10036408 Ga0207708_100364083 305
323 3300026116 Ga0207674_10113166 Ga0207674_101131662 305
324 3300027907 Ga0207428_10043589 Ga0207428_100435893 305
325 3300031727 Ga0316576_10021659 Ga0316576_100216592 305
326 3300035113 Ga0373936_0109933 Ga0373936_0109933_155_1087 305
327 3300035398 Ga0316574_0136126 Ga0316574_0136126_62_997 305
328 3300035725 Ga0373947_0042168 Ga0373947_0042168_769_1701 305
329 3300041512 Ga0451853_0145122 Ga0451853_0145122_720_1649 305
330 3300047322 Ga0495680_0327456 Ga0495680_0327456_78_1010 305
331 3300048907 Ga0496104_0028591 Ga0496104_0028591_392_1321 305
332 3300048908 Ga0496105_0012523 Ga0496105_0012523_3805_4734 305
333 3300048911 Ga0496108_0013658 Ga0496108_0013658_1548_2477 305
334 3300048912 Ga0496109_0101409 Ga0496109_0101409_1296_2225 305
335 3300048915 Ga0496112_0009046 Ga0496112_0009046_1128_2057 305
336 3300048916 Ga0496113_0002577 Ga0496113_0002577_3245_4174 305
337 3300048917 Ga0496114_0054316 Ga0496114_0054316_1493_2422 305
338 3300048923 Ga0496120_0000257 Ga0496120_0000257_76666_77631 305
339 3300049575 Ga0501039_0354784 Ga0501039_0354784_186_1121 305
340 3300049580 Ga0501046_0144716 Ga0501046_0144716_314_1249 305
341 3300049591 Ga0501075_0386565 Ga0501075_0386565_94_1029 305
342 3300049741 Ga0501079_0196667 Ga0501079_0196667_301_1236 305
343 3300049824 Ga0501045_0107462 Ga0501045_0107462_578_1513 305
344 3300053085 Ga0495619_0254926 Ga0495619_0254926_247_1179 305
345 3300005329 Ga0070683_100051837 Ga0070683_1000518373 306
346 3300005338 Ga0068868_100156643 Ga0068868_1001566432 306
347 3300005340 Ga0070689_100014575 Ga0070689_1000145753 306
348 3300005341 Ga0070691_10044518 Ga0070691_100445182 306
349 3300005356 Ga0070674_100007305 Ga0070674_1000073053 306
350 3300005459 Ga0068867_100004439 Ga0068867_1000044393 306
351 3300005535 Ga0070684_100090948 Ga0070684_1000909482 306
352 3300005718 Ga0068866_10132548 Ga0068866_101325482 306
353 3300005840 Ga0068870_10141315 Ga0068870_101413152 306
354 3300006881 Ga0068865_100034891 Ga0068865_1000348912 306
355 3300009148 Ga0105243_10224133 Ga0105243_102241332 306
356 3300009176 Ga0105242_10239554 Ga0105242_102395542 306
357 3300014325 Ga0163163_10051781 Ga0163163_100517812 306
358 3300014326 Ga0157380_10007357 Ga0157380_100073575 306
359 3300014745 Ga0157377_10035903 Ga0157377_100359032 306
360 3300017792 Ga0163161_10010643 Ga0163161_100106435 306
361 3300025901 Ga0207688_10111455 Ga0207688_101114552 306
362 3300025937 Ga0207669_10003955 Ga0207669_100039553 306
363 3300025944 Ga0207661_10014527 Ga0207661_100145274 306
364 3300028380 Ga0268265_10231085 Ga0268265_102310852 306
365 3300041509 Ga0451843_0930883 Ga0451843_0930883_66_1001 306
366 3300046455 Ga0495603_0061543 Ga0495603_0061543_801_1739 306
367 3300046463 Ga0495653_0128635 Ga0495653_0128635_182_1120 306
368 3300046536 Ga0495587_0202407 Ga0495587_0202407_115_1053 306
369 3300047319 Ga0495674_0234898 Ga0495674_0234898_531_1469 306
370 3300048911 Ga0496108_0052881 Ga0496108_0052881_1087_2025 306
371 3300048912 Ga0496109_0058454 Ga0496109_0058454_2319_3254 306
372 3300048912 Ga0496109_0106525 Ga0496109_0106525_1354_2292 306
373 3300048915 Ga0496112_0129549 Ga0496112_0129549_241_1179 306
374 3300048917 Ga0496114_0452707 Ga0496114_0452707_127_1062 306
375 3300049582 Ga0501048_0177462 Ga0501048_0177462_158_1168 306
376 3300049587 Ga0501071_0176364 Ga0501071_0176364_436_1374 306
377 3300049587 Ga0501071_0204996 Ga0501071_0204996_30_968 306
378 3300049591 Ga0501075_0079655 Ga0501075_0079655_1197_2135 306
379 3300049592 Ga0501076_0060775 Ga0501076_0060775_1952_2962 306
380 3300049824 Ga0501045_0126834 Ga0501045_0126834_587_1597 306
381 3300049824 Ga0501045_0155301 Ga0501045_0155301_410_1348 306
382 3300050490 nmdc:mga03n38_109777_c1 nmdc:mga03n38_109777_c1_216_1247 306
383 3300050496 nmdc:mga07m45_86225_c1 nmdc:mga07m45_86225_c1_650_1681 306
384 3300054114 Ga0501084_0099264 Ga0501084_0099264_347_1285 306
385 3300061734 Ga0530510_0003441 Ga0530510_0003441_696_1706 306
386 3300005444 Ga0070694_100343917 Ga0070694_1003439172 307
387 3300005546 Ga0070696_100054324 Ga0070696_1000543242 307
388 3300010375 Ga0105239_10875569 Ga0105239_108755691 307
389 3300013307 Ga0157372_10216401 Ga0157372_102164012 307
390 3300014497 Ga0182008_10009372 Ga0182008_100093722 307
391 3300015261 Ga0182006_1082494 Ga0182006_10824941 307
392 3300015262 Ga0182007_10001270 Ga0182007_100012706 307
393 3300015265 Ga0182005_1008073 Ga0182005_10080732 307
394 3300025904 Ga0207647_10010435 Ga0207647_100104353 307
395 3300030522 Ga0307512_10000296 Ga0307512_1000029665 307
396 3300031616 Ga0307508_10012227 Ga0307508_100122275 307
397 3300031838 Ga0307518_10149847 Ga0307518_101498472 307
398 3300033179 Ga0307507_10083915 Ga0307507_100839153 307
399 3300035091 Ga0373951_0000555 Ga0373951_0000555_3067_4041 307
400 3300005329 Ga0070683_100005892 Ga0070683_1000058924 308
401 3300005336 Ga0070680_100011523 Ga0070680_1000115234 308
402 3300005337 Ga0070682_100074254 Ga0070682_1000742542 308
403 3300005339 Ga0070660_100031511 Ga0070660_1000315113 308
404 3300005344 Ga0070661_100051486 Ga0070661_1000514862 308
405 3300005366 Ga0070659_100236302 Ga0070659_1002363022 308
406 3300005456 Ga0070678_100119534 Ga0070678_1001195342 308
407 3300005458 Ga0070681_10008736 Ga0070681_100087362 308
408 3300005530 Ga0070679_100059959 Ga0070679_1000599593 308
409 3300005535 Ga0070684_100010486 Ga0070684_1000104862 308
410 3300005544 Ga0070686_100098074 Ga0070686_1000980742 308
411 3300005547 Ga0070693_100010881 Ga0070693_1000108812 308
412 3300005614 Ga0068856_100391929 Ga0068856_1003919292 308
413 3300005615 Ga0070702_100070846 Ga0070702_1000708462 308
414 3300006163 Ga0070715_10068621 Ga0070715_100686212 308
415 3300006237 Ga0097621_100053376 Ga0097621_1000533762 308
416 3300009098 Ga0105245_10001472 Ga0105245_100014724 308
417 3300009148 Ga0105243_10033713 Ga0105243_100337133 308
418 3300009177 Ga0105248_10179974 Ga0105248_101799743 308
419 3300009545 Ga0105237_10047701 Ga0105237_100477013 308
420 3300013296 Ga0157374_10019965 Ga0157374_100199652 308
421 3300013296 Ga0157374_10392875 Ga0157374_103928752 308
422 3300013308 Ga0157375_10073037 Ga0157375_100730372 308
423 3300025900 Ga0207710_10038595 Ga0207710_100385952 308
424 3300025905 Ga0207685_10072940 Ga0207685_100729402 308
425 3300025912 Ga0207707_10011531 Ga0207707_100115313 308
426 3300025914 Ga0207671_10027283 Ga0207671_100272832 308
427 3300025917 Ga0207660_10013673 Ga0207660_100136734 308
428 3300025919 Ga0207657_10044681 Ga0207657_100446813 308
429 3300025921 Ga0207652_10021373 Ga0207652_100213734 308
430 3300025926 Ga0207659_10246039 Ga0207659_102460392 308
431 3300025932 Ga0207690_10269392 Ga0207690_102693922 308
432 3300025934 Ga0207686_10186836 Ga0207686_101868362 308
433 3300025935 Ga0207709_10080423 Ga0207709_100804232 308
434 3300025941 Ga0207711_10003988 Ga0207711_100039882 308
435 3300025941 Ga0207711_10472592 Ga0207711_104725922 308
436 3300025944 Ga0207661_10002823 Ga0207661_100028236 308
437 3300026023 Ga0207677_10051270 Ga0207677_100512703 308
438 3300026121 Ga0207683_10230489 Ga0207683_102304891 308
439 3300031691 Ga0316579_10091363 Ga0316579_100913631 308
440 3300048903 Ga0496100_0006441 Ga0496100_0006441_4997_5932 308
441 3300048904 Ga0496101_0002535 Ga0496101_0002535_7842_8780 308
442 3300048904 Ga0496101_0038664 Ga0496101_0038664_2392_3327 308
443 3300048905 Ga0496102_0001623 Ga0496102_0001623_4304_5239 308
444 3300048907 Ga0496104_0000254 Ga0496104_0000254_32284_33219 308
445 3300048907 Ga0496104_0006435 Ga0496104_0006435_5499_6434 308
446 3300048908 Ga0496105_0000055 Ga0496105_0000055_51572_52507 308
447 3300048908 Ga0496105_0227772 Ga0496105_0227772_518_1453 308
448 3300048911 Ga0496108_0000983 Ga0496108_0000983_1209_2144 308
449 3300048912 Ga0496109_0040031 Ga0496109_0040031_1159_2094 308
450 3300048913 Ga0496110_0000306 Ga0496110_0000306_14782_15717 308
451 3300048914 Ga0496111_0000092 Ga0496111_0000092_9536_10471 308
452 3300048917 Ga0496114_0000256 Ga0496114_0000256_31570_32505 308
453 3300048917 Ga0496114_0004277 Ga0496114_0004277_5816_6751 308
454 3300048918 Ga0496115_0018044 Ga0496115_0018044_2414_3349 308
455 3300049583 Ga0501067_0029347 Ga0501067_0029347_104_1075 308
456 3300049592 Ga0501076_0065881 Ga0501076_0065881_1202_2146 308
457 3300050513 nmdc:mga0rr50_279989_c1 nmdc:mga0rr50_279989_c1_264_1202 308
458 3300006844 Ga0075428_100480977 Ga0075428_1004809771 309
459 3300046476 Ga0495662_0003349 Ga0495662_0003349_3298_4302 309
460 3300046675 Ga0495657_0003646 Ga0495657_0003646_2891_3895 309
461 3300046689 Ga0495613_0006587 Ga0495613_0006587_3429_4433 309
462 3300049587 Ga0501071_0006580 Ga0501071_0006580_4486_5460 309
463 3300053153 Ga0500616_0001398 Ga0500616_0001398_15372_16304 309
464 3300054114 Ga0501084_0092773 Ga0501084_0092773_600_1586 309
465 3300061734 Ga0530510_0156941 Ga0530510_0156941_27_974 309
466 3300049574 Ga0501038_0373736 Ga0501038_0373736_41_991 310
467 3300049588 Ga0501072_0011816 Ga0501072_0011816_5098_6048 310
468 iso_pu_bacteria 2675903060 2676489194 311
469 3300005327 Ga0070658_10138652 Ga0070658_101386522 312
470 3300005336 Ga0070680_100105669 Ga0070680_1001056692 312
471 3300005337 Ga0070682_100034925 Ga0070682_1000349252 312
472 3300005355 Ga0070671_100067266 Ga0070671_1000672663 312
473 3300005439 Ga0070711_100052708 Ga0070711_1000527082 312
474 3300005441 Ga0070700_100233021 Ga0070700_1002330212 312
475 3300005455 Ga0070663_100253446 Ga0070663_1002534461 312
476 3300005457 Ga0070662_100026204 Ga0070662_1000262043 312
477 3300005535 Ga0070684_100508095 Ga0070684_1005080951 312
478 3300005543 Ga0070672_100230012 Ga0070672_1002300122 312
479 3300005544 Ga0070686_100091678 Ga0070686_1000916782 312
480 3300005614 Ga0068856_100069560 Ga0068856_1000695603 312
481 3300005616 Ga0068852_100038328 Ga0068852_1000383282 312
482 3300005718 Ga0068866_10069199 Ga0068866_100691992 312
483 3300005937 Ga0081455_10033203 Ga0081455_100332032 312
484 3300006058 Ga0075432_10033134 Ga0075432_100331342 312
485 3300006237 Ga0097621_100193896 Ga0097621_1001938962 312
486 3300006358 Ga0068871_100105589 Ga0068871_1001055892 312
487 3300009094 Ga0111539_10010318 Ga0111539_1001031810 312
488 3300009094 Ga0111539_10138650 Ga0111539_101386502 312
489 3300009147 Ga0114129_10015263 Ga0114129_100152633 312
490 3300009148 Ga0105243_10321395 Ga0105243_103213952 312
491 3300009177 Ga0105248_10436385 Ga0105248_104363851 312
492 3300009553 Ga0105249_10322144 Ga0105249_103221442 312
493 3300013308 Ga0157375_10074609 Ga0157375_100746093 312
494 3300014745 Ga0157377_10188500 Ga0157377_101885002 312
495 3300014969 Ga0157376_10285992 Ga0157376_102859922 312
496 3300025899 Ga0207642_10024002 Ga0207642_100240022 312
497 3300025904 Ga0207647_10109405 Ga0207647_101094052 312
498 3300025908 Ga0207643_10004234 Ga0207643_100042345 312
499 3300025914 Ga0207671_10105237 Ga0207671_101052372 312
500 3300025915 Ga0207693_10249615 Ga0207693_102496151 312
501 3300025917 Ga0207660_10150922 Ga0207660_101509222 312
502 3300025919 Ga0207657_10037185 Ga0207657_100371852 312
503 3300025920 Ga0207649_10226645 Ga0207649_102266452 312
504 3300025921 Ga0207652_10172330 Ga0207652_101723302 312
505 3300025924 Ga0207694_10188588 Ga0207694_101885882 312
506 3300025927 Ga0207687_10015934 Ga0207687_100159344 312
507 3300025932 Ga0207690_10129919 Ga0207690_101299192 312
508 3300025933 Ga0207706_10098567 Ga0207706_100985672 312
509 3300025942 Ga0207689_10024592 Ga0207689_100245924 312
510 3300026041 Ga0207639_10246144 Ga0207639_102461442 312
511 3300026075 Ga0207708_10017779 Ga0207708_100177793 312
512 3300026116 Ga0207674_10150565 Ga0207674_101505652 312
513 3300026118 Ga0207675_100114373 Ga0207675_1001143732 312
514 3300026142 Ga0207698_10043297 Ga0207698_100432973 312
515 3300042005 Ga0439448_0029296 Ga0439448_0029296_446_1399 312
516 3300048909 Ga0496106_0224660 Ga0496106_0224660_507_1460 312
517 3300048914 Ga0496111_0121387 Ga0496111_0121387_830_1783 312
518 3300049572 Ga0501036_0051443 Ga0501036_0051443_2043_2996 312
519 3300049588 Ga0501072_0023324 Ga0501072_0023324_3835_4788 312
520 3300049591 Ga0501075_0041828 Ga0501075_0041828_330_1283 312
521 3300049592 Ga0501076_0024689 Ga0501076_0024689_1226_2179 312
522 3300050507 nmdc:mga05p37_121038_c1 nmdc:mga05p37_121038_c1_1744_2706 312
523 3300050511 nmdc:mga08y16_2792_c1 nmdc:mga08y16_2792_c1_7160_8113 312
524 3300028556 Ga0265337_1028178 Ga0265337_10281781 313
525 3300028558 Ga0265326_10044140 Ga0265326_100441402 313
526 3300028563 Ga0265319_1005290 Ga0265319_10052902 313
527 3300028577 Ga0265318_10001224 Ga0265318_1000122411 313
528 3300028800 Ga0265338_10025672 Ga0265338_100256722 313
529 3300031240 Ga0265320_10002368 Ga0265320_100023686 313
530 3300031247 Ga0265340_10035273 Ga0265340_100352732 313
531 3300031250 Ga0265331_10082801 Ga0265331_100828012 313
532 3300031251 Ga0265327_10012837 Ga0265327_100128375 313
533 3300031344 Ga0265316_10054153 Ga0265316_100541533 313
534 3300031711 Ga0265314_10035890 Ga0265314_100358904 313
535 3300046462 Ga0495651_0251084 Ga0495651_0251084_192_1142 313
536 3300046663 Ga0495635_0157011 Ga0495635_0157011_50_1000 313
537 3300046689 Ga0495613_0060665 Ga0495613_0060665_32_982 313
538 3300047317 Ga0495604_0174238 Ga0495604_0174238_489_1439 313
539 3300047319 Ga0495674_0082029 Ga0495674_0082029_890_1840 313
540 3300047471 Ga0495684_0094054 Ga0495684_0094054_522_1487 313
541 3300053085 Ga0495619_0058017 Ga0495619_0058017_1273_2223 313
542 iso_pu_bacteria 2643221615 2644089217 313
543 iso_pu_bacteria 2643221657 2644319062 313
544 3300006038 Ga0075365_10090446 Ga0075365_100904463 314
545 3300039062 Ga0400483_018531 Ga0400483_018531_25942_26946 314
546 3300039062 Ga0400483_219255 Ga0400483_219255_26369_27373 314
547 3300046455 Ga0495603_0023426 Ga0495603_0023426_237_1199 314
548 3300046455 Ga0495603_0051861 Ga0495603_0051861_357_1415 314
549 3300046461 Ga0495641_0012847 Ga0495641_0012847_286_1248 314
550 3300046473 Ga0495582_0060921 Ga0495582_0060921_961_1923 314
551 3300046794 Ga0495589_0029796 Ga0495589_0029796_1005_2063 314
552 3300047321 Ga0495676_0024447 Ga0495676_0024447_1030_2088 314
553 3300047447 Ga0495685_020288 Ga0495685_020288_217_1275 314
554 3300006042 Ga0075368_10081576 Ga0075368_100815762 315
555 3300009094 Ga0111539_10104327 Ga0111539_101043273 316
556 3300009147 Ga0114129_10206513 Ga0114129_102065132 316
557 3300031901 Ga0307406_10008519 Ga0307406_100085193 316
558 3300050511 nmdc:mga08y16_183897_c1 nmdc:mga08y16_183897_c1_644_1675 316
559 3300031731 Ga0307405_10067763 Ga0307405_100677632 317
560 3300031852 Ga0307410_10118426 Ga0307410_101184262 317
561 3300031995 Ga0307409_100001648 Ga0307409_1000016485 317
562 3300032004 Ga0307414_10113423 Ga0307414_101134232 317
563 3300032126 Ga0307415_100005147 Ga0307415_1000051475 317
564 iso_pu_bacteria 2643221572 2643877780 317
565 iso_pu_bacteria 2643221669 2644384835 317
566 iso_pu_bacteria 2895660088 2895662649 317
567 iso_pu_bacteria 2857733635 2857736136 318
568 3300005543 Ga0070672_100006704 Ga0070672_1000067043 319
569 3300014325 Ga0163163_10018986 Ga0163163_100189863 319
570 3300025940 Ga0207691_10037509 Ga0207691_100375092 319
571 3300026095 Ga0207676_10013267 Ga0207676_100132674 319
572 3300049571 Ga0501034_0077004 Ga0501034_0077004_436_1398 319
573 3300049742 Ga0501080_0001999 Ga0501080_0001999_15818_16780 319
574 3300049744 Ga0501083_0036635 Ga0501083_0036635_889_1851 319
575 iso_pu_bacteria 8003856774 8003861134 319
576 3300041498 Ga0451841_0096979 Ga0451841_0096979_935_1912 320
577 3300048908 Ga0496105_0006658 Ga0496105_0006658_982_1989 320
578 3300048917 Ga0496114_0044504 Ga0496114_0044504_1307_2314 320
579 iso_pu_bacteria 2643221649 2644278809 320
580 iso_pu_bacteria 2862574272 2862576863 321
581 3300005347 Ga0070668_100000364 Ga0070668_10000036410 322
582 3300005455 Ga0070663_100071010 Ga0070663_1000710102 322
583 3300005617 Ga0068859_100360628 Ga0068859_1003606282 322
584 3300006931 Ga0097620_100360634 Ga0097620_1003606342 322
585 3300025972 Ga0207668_10000326 Ga0207668_1000032616 322
586 3300026067 Ga0207678_10007961 Ga0207678_100079617 322
587 3300028380 Ga0268265_10014634 Ga0268265_100146343 322
588 3300041512 Ga0451853_0450515 Ga0451853_0450515_1427_2395 322
589 3300031901 Ga0307406_10085632 Ga0307406_100856322 325
590 3300031456 Ga0307513_10000001 Ga0307513_1000000139 326
591 3300053136 Ga0500559_0000078 Ga0500559_0000078_33362_34381 326
592 iso_pu_bacteria 2784746768 2785367006 326
593 iso_pu_bacteria 2808606375 2808918240 326
594 3300026118 Ga0207675_100020755 Ga0207675_1000207552 327
595 3300048091 Ga0495626_0039886 Ga0495626_0039886_479_1495 327
596 iso_pu_bacteria 8055172936 8055174484 327
597 iso_pu_bacteria 2772190715 2772645990 328
598 iso_pu_bacteria 2858868258 2858870292 328
599 iso_pu_bacteria 2880495981 2880501848 328
600 iso_pu_bacteria 2902582711 2902584524 328
601 iso_pu_bacteria 8003830390 8003831086 328
602 iso_pu_bacteria 8003870546 8003876786 328
603 iso_pu_bacteria 8055066027 8055067941 328
604 3300003316 rootH1_10037110 rootH1_100371101 329
605 3300046507 Ga0495606_0002413 Ga0495606_0002413_1720_2715 330
606 iso_pu_bacteria 2887478801 2887482806 330
607 iso_pu_bacteria 8056829672 8056832463 330
608 3300006844 Ga0075428_100006054 Ga0075428_10000605411 333
609 3300006847 Ga0075431_100159188 Ga0075431_1001591882 333
610 3300009147 Ga0114129_10007883 Ga0114129_100078834 333
611 3300050507 nmdc:mga05p37_5351_c1 nmdc:mga05p37_5351_c1_2222_3229 333
612 3300050508 nmdc:mga09592_7679_c1 nmdc:mga09592_7679_c1_1856_2863 333
613 3300050509 nmdc:mga0qj67_16_c1 nmdc:mga0qj67_16_c1_121461_122468 333
614 3300050510 nmdc:mga06r32_38_c1 nmdc:mga06r32_38_c1_2897_3904 333
615 3300009147 Ga0114129_10156369 Ga0114129_101563692 334
616 3300050507 nmdc:mga05p37_126438_c1 nmdc:mga05p37_126438_c1_154_1164 334
617 3300006844 Ga0075428_100126928 Ga0075428_1001269282 336
618 3300009147 Ga0114129_10145323 Ga0114129_101453233 336
619 3300003203 JGI25406J46586_10002462 JGI25406J46586_100024622 347
620 3300005985 Ga0081539_10000135 Ga0081539_1000013565 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

127

336

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.9138 91 327
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.9035 48 329
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8912 48 329
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8897 48 330
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8863 48 328
ID Description Score Start End Superfamily
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9469 94 334 1.10.3720.10
af_P10905_52_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9397 93 333 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9317 94 334 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9314 94 334 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9288 94 335 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7X9PE46-F1-model_v4 Sugar ABC transporter permease 0.9743 209 329 GO:0005886
GO:0055085
AF-A0A3C1QLW6-F1-model_v4 deleted 0.9736 134 328
AF-A0A7W2BS02-F1-model_v4 deleted 0.9727 176 333
AF-A0A7C2NL66-F1-model_v4 Sugar ABC transporter permease 0.9662 65 337 GO:0005886
GO:0055085
AF-A0A0H3D816-F1-model_v4 Permease component of ABC-type sugar transport system 0.9655 63 331 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
82.12 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map