F469881
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 620 | 323 | 591 | 306 |
Family's Representative Sequence
| Representative Sequence | 3300003203|JGI25406J46586_10002462|JGI25406J46586_100024622 |
| Length | 347 |
| Sequence | LKTTTQGPEGRLPAPSSHRTATRAEARRGLTPDQPRPRVDGSLRRRRRLDKLTIALFLAPALLLFVVLVVGPIALAIYTSLFKWNGFGGLPEDFIGLDNFTRLLQDEVFIGDLKRGLILVLLSVFVQLPVALGLALLLNQPLRGRAFYRLVFFAPYVLSEVITAVLFTMVFSPNQGLTNQAMSAIGLENLQQEWLADTSTVLYALFFVISWKYFGLHMILYLAGRQGIPKELTDAALTDGAGSWQVFRHVTLPLLGPTIRISIFLSIIGAIQLFDMVWVLTGGGPIHSSETMAVTMFQYGFRRSEVGYASAISVAMFLISLVFALLYQRFVMRRDIEGAITTMREKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 2 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 3 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 4 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 5 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 6 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 7 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 8 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 9 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 10 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 11 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 12 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 13 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 14 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 15 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 16 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 17 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 18 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 19 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 20 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 21 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 22 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 23 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 118 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 176 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 180 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 183 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 187 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 189 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 192 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 203 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 204 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 210 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 213 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 214 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 216 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 217 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 218 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 219 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 220 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 221 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 250 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 251 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 252 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 253 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 254 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 257 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 258 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 259 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 260 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 261 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 262 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 263 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 264 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 265 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 298 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 307 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 309 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 310 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 311 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 312 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 313 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 314 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 317 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 318 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 319 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 320 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 321 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 322 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 323 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.32 |
| Metatranscriptomes | 0 |
| Isolates | 4.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.58 |
| Nodule | 0.16 |
| Rhizoplane | 9.03 |
| Rhizosphere | 80.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10002462 | 3300003203 | Bacteria | 8752 |
| 2 | rootH1_10037110 | 3300003316 | Bacteria | 1922 |
| 3 | Ga0070658_10004616 | 3300005327 | Bacteria | 11195 |
| 4 | Ga0070658_10138652 | 3300005327 | Bacteria | 2031 |
| 5 | Ga0070683_100005892 | 3300005329 | Bacteria | 10253 |
| 6 | Ga0070683_100051837 | 3300005329 | Bacteria | 3800 |
| 7 | Ga0070690_100040668 | 3300005330 | Bacteria | 2941 |
| 8 | Ga0070680_100011523 | 3300005336 | Bacteria | 6842 |
| 9 | Ga0070680_100105669 | 3300005336 | Bacteria | 2340 |
| 10 | Ga0070682_100034925 | 3300005337 | Bacteria | 3065 |
| 11 | Ga0070682_100074254 | 3300005337 | Bacteria | 2183 |
| 12 | Ga0068868_100156643 | 3300005338 | Bacteria | 1879 |
| 13 | Ga0068868_100254617 | 3300005338 | Bacteria | 1478 |
| 14 | Ga0070660_100031511 | 3300005339 | Bacteria | 3983 |
| 15 | Ga0070660_100164446 | 3300005339 | Bacteria | 1789 |
| 16 | Ga0070689_100014575 | 3300005340 | Bacteria | 5715 |
| 17 | Ga0070691_10044518 | 3300005341 | Bacteria | 2105 |
| 18 | Ga0070661_100051486 | 3300005344 | Bacteria | 3014 |
| 19 | Ga0070661_100214209 | 3300005344 | Bacteria | 1475 |
| 20 | Ga0070668_100000364 | 3300005347 | Bacteria | 29898 |
| 21 | Ga0070668_100005312 | 3300005347 | Bacteria | 9564 |
| 22 | Ga0070668_100507349 | 3300005347 | Bacteria | 1045 |
| 23 | Ga0070671_100067266 | 3300005355 | Bacteria | 2987 |
| 24 | Ga0070674_100007305 | 3300005356 | Bacteria | 6508 |
| 25 | Ga0070674_100039828 | 3300005356 | Bacteria | 3176 |
| 26 | Ga0070673_100199455 | 3300005364 | Bacteria | 1723 |
| 27 | Ga0070659_100000996 | 3300005366 | Bacteria | 20802 |
| 28 | Ga0070659_100236302 | 3300005366 | Bacteria | 1511 |
| 29 | Ga0070711_100052708 | 3300005439 | Bacteria | 2801 |
| 30 | Ga0070700_100079819 | 3300005441 | Bacteria | 2110 |
| 31 | Ga0070700_100233021 | 3300005441 | Bacteria | 1311 |
| 32 | Ga0070694_100343917 | 3300005444 | Bacteria | 1154 |
| 33 | Ga0070708_100282186 | 3300005445 | Bacteria | 1563 |
| 34 | Ga0070663_100071010 | 3300005455 | Bacteria | 2533 |
| 35 | Ga0070663_100253446 | 3300005455 | Bacteria | 1394 |
| 36 | Ga0070678_100119534 | 3300005456 | Bacteria | 2075 |
| 37 | Ga0070662_100026204 | 3300005457 | Bacteria | 4036 |
| 38 | Ga0070681_10008736 | 3300005458 | Bacteria | 9936 |
| 39 | Ga0068867_100004439 | 3300005459 | Bacteria | 9865 |
| 40 | Ga0070685_10008452 | 3300005466 | Bacteria | 5291 |
| 41 | Ga0070685_10020615 | 3300005466 | Bacteria | 3568 |
| 42 | Ga0070679_100059959 | 3300005530 | Bacteria | 3792 |
| 43 | Ga0070684_100010486 | 3300005535 | Bacteria | 7343 |
| 44 | Ga0070684_100090948 | 3300005535 | Bacteria | 2714 |
| 45 | Ga0070684_100508095 | 3300005535 | Bacteria | 1116 |
| 46 | Ga0068853_100069509 | 3300005539 | Bacteria | 3064 |
| 47 | Ga0070672_100006704 | 3300005543 | Bacteria | 7762 |
| 48 | Ga0070672_100073213 | 3300005543 | Bacteria | 2730 |
| 49 | Ga0070672_100230012 | 3300005543 | Bacteria | 1557 |
| 50 | Ga0070686_100091678 | 3300005544 | Bacteria | 2034 |
| 51 | Ga0070686_100098074 | 3300005544 | Bacteria | 1974 |
| 52 | Ga0070696_100054324 | 3300005546 | Bacteria | 2790 |
| 53 | Ga0070693_100010881 | 3300005547 | Bacteria | 4569 |
| 54 | Ga0068855_100001168 | 3300005563 | Bacteria | 32549 |
| 55 | Ga0068855_100036885 | 3300005563 | Bacteria | 5816 |
| 56 | Ga0070664_100394791 | 3300005564 | Bacteria | 1264 |
| 57 | Ga0070664_100403361 | 3300005564 | Bacteria | 1250 |
| 58 | Ga0068857_100140429 | 3300005577 | Bacteria | 2183 |
| 59 | Ga0068857_100234070 | 3300005577 | Bacteria | 1681 |
| 60 | Ga0068854_100119873 | 3300005578 | Bacteria | 1996 |
| 61 | Ga0068856_100048811 | 3300005614 | Bacteria | 4172 |
| 62 | Ga0068856_100069560 | 3300005614 | Bacteria | 3481 |
| 63 | Ga0068856_100391929 | 3300005614 | Bacteria | 1408 |
| 64 | Ga0070702_100070846 | 3300005615 | Bacteria | 2059 |
| 65 | Ga0068852_100038328 | 3300005616 | Bacteria | 4027 |
| 66 | Ga0068852_100399083 | 3300005616 | Bacteria | 1352 |
| 67 | Ga0068859_100010767 | 3300005617 | Bacteria | 9204 |
| 68 | Ga0068859_100360628 | 3300005617 | Bacteria | 1548 |
| 69 | Ga0068859_100455323 | 3300005617 | Bacteria | 1376 |
| 70 | Ga0068864_100158389 | 3300005618 | Bacteria | 2057 |
| 71 | Ga0068866_10004355 | 3300005718 | Bacteria | 5811 |
| 72 | Ga0068866_10069199 | 3300005718 | Bacteria | 1859 |
| 73 | Ga0068866_10132548 | 3300005718 | Bacteria | 1419 |
| 74 | Ga0068861_100037646 | 3300005719 | Bacteria | 3596 |
| 75 | Ga0068851_10000001 | 3300005834 | Bacteria | 495512 |
| 76 | Ga0068870_10141315 | 3300005840 | Bacteria | 1409 |
| 77 | Ga0068858_100000016 | 3300005842 | Bacteria | 193130 |
| 78 | Ga0068858_100263410 | 3300005842 | Bacteria | 1639 |
| 79 | Ga0068860_100120963 | 3300005843 | Bacteria | 2507 |
| 80 | Ga0068860_100262705 | 3300005843 | Bacteria | 1683 |
| 81 | Ga0081455_10033203 | 3300005937 | Bacteria | 4640 |
| 82 | Ga0081540_1057073 | 3300005983 | Bacteria | 1890 |
| 83 | Ga0081539_10000135 | 3300005985 | Bacteria | 172789 |
| 84 | Ga0075365_10090446 | 3300006038 | Bacteria | 2085 |
| 85 | Ga0075368_10081576 | 3300006042 | Bacteria | 1317 |
| 86 | Ga0075363_100153674 | 3300006048 | Bacteria | 1300 |
| 87 | Ga0075432_10033134 | 3300006058 | Bacteria | 1791 |
| 88 | Ga0070715_10068621 | 3300006163 | Bacteria | 1577 |
| 89 | Ga0097621_100053376 | 3300006237 | Bacteria | 3295 |
| 90 | Ga0097621_100138971 | 3300006237 | Bacteria | 2074 |
| 91 | Ga0097621_100154368 | 3300006237 | Bacteria | 1970 |
| 92 | Ga0097621_100193896 | 3300006237 | Bacteria | 1761 |
| 93 | Ga0075370_10061525 | 3300006353 | Bacteria | 2139 |
| 94 | Ga0068871_100105589 | 3300006358 | Bacteria | 2364 |
| 95 | Ga0075428_100006054 | 3300006844 | Bacteria | 13442 |
| 96 | Ga0075428_100126928 | 3300006844 | Bacteria | 2776 |
| 97 | Ga0075428_100160786 | 3300006844 | Bacteria | 2438 |
| 98 | Ga0075428_100286554 | 3300006844 | Bacteria | 1772 |
| 99 | Ga0075428_100480977 | 3300006844 | Bacteria | 1329 |
| 100 | Ga0075430_100081788 | 3300006846 | Bacteria | 2706 |
| 101 | Ga0075430_100147531 | 3300006846 | Bacteria | 1959 |
| 102 | Ga0075431_100159188 | 3300006847 | Bacteria | 2322 |
| 103 | Ga0075431_100188874 | 3300006847 | Bacteria | 2111 |
| 104 | Ga0068865_100034891 | 3300006881 | Bacteria | 3379 |
| 105 | Ga0068865_100046009 | 3300006881 | Bacteria | 2993 |
| 106 | Ga0097620_100010767 | 3300006931 | Bacteria | 9204 |
| 107 | Ga0097620_100360634 | 3300006931 | Bacteria | 1548 |
| 108 | Ga0097620_100455350 | 3300006931 | Bacteria | 1376 |
| 109 | Ga0105240_10007531 | 3300009093 | Bacteria | 15792 |
| 110 | Ga0105240_10013972 | 3300009093 | Bacteria | 10990 |
| 111 | Ga0105240_10553417 | 3300009093 | Bacteria | 1272 |
| 112 | Ga0111539_10008475 | 3300009094 | Bacteria | 13068 |
| 113 | Ga0111539_10010318 | 3300009094 | Bacteria | 11761 |
| 114 | Ga0111539_10104327 | 3300009094 | Bacteria | 3326 |
| 115 | Ga0111539_10138650 | 3300009094 | Bacteria | 2848 |
| 116 | Ga0105245_10001472 | 3300009098 | Bacteria | 21285 |
| 117 | Ga0105245_10043342 | 3300009098 | Bacteria | 4013 |
| 118 | Ga0105245_10294443 | 3300009098 | Bacteria | 1590 |
| 119 | Ga0114129_10007883 | 3300009147 | Bacteria | 15154 |
| 120 | Ga0114129_10015263 | 3300009147 | Bacteria | 10933 |
| 121 | Ga0114129_10105395 | 3300009147 | Bacteria | 3897 |
| 122 | Ga0114129_10145323 | 3300009147 | Bacteria | 3249 |
| 123 | Ga0114129_10156369 | 3300009147 | Bacteria | 3117 |
| 124 | Ga0114129_10206513 | 3300009147 | Bacteria | 2657 |
| 125 | Ga0114129_10320706 | 3300009147 | Bacteria | 2060 |
| 126 | Ga0105243_10031424 | 3300009148 | Bacteria | 4094 |
| 127 | Ga0105243_10033713 | 3300009148 | Bacteria | 3960 |
| 128 | Ga0105243_10111442 | 3300009148 | Bacteria | 2290 |
| 129 | Ga0105243_10224133 | 3300009148 | Bacteria | 1664 |
| 130 | Ga0105243_10321395 | 3300009148 | Bacteria | 1410 |
| 131 | Ga0105241_10001026 | 3300009174 | Bacteria | 21266 |
| 132 | Ga0105242_10239554 | 3300009176 | Bacteria | 1630 |
| 133 | Ga0105248_10138941 | 3300009177 | Bacteria | 2740 |
| 134 | Ga0105248_10172624 | 3300009177 | Bacteria | 2437 |
| 135 | Ga0105248_10179974 | 3300009177 | Bacteria | 2382 |
| 136 | Ga0105248_10316236 | 3300009177 | Bacteria | 1758 |
| 137 | Ga0105248_10436385 | 3300009177 | Bacteria | 1475 |
| 138 | Ga0105237_10001409 | 3300009545 | Bacteria | 31790 |
| 139 | Ga0105237_10047701 | 3300009545 | Bacteria | 4306 |
| 140 | Ga0105249_10015170 | 3300009553 | Bacteria | 6818 |
| 141 | Ga0105249_10322144 | 3300009553 | Bacteria | 1557 |
| 142 | Ga0105030_101153 | 3300009987 | Bacteria | 2350 |
| 143 | Ga0105239_10296617 | 3300010375 | Bacteria | 1820 |
| 144 | Ga0105239_10441285 | 3300010375 | Bacteria | 1476 |
| 145 | Ga0105239_10875569 | 3300010375 | Bacteria | 1030 |
| 146 | Ga0157370_10278306 | 3300013104 | Bacteria | 1546 |
| 147 | Ga0157374_10019965 | 3300013296 | Bacteria | 5940 |
| 148 | Ga0157374_10080805 | 3300013296 | Bacteria | 3084 |
| 149 | Ga0157374_10392875 | 3300013296 | Bacteria | 1383 |
| 150 | Ga0157378_10005765 | 3300013297 | Bacteria | 10847 |
| 151 | Ga0157378_10159003 | 3300013297 | Bacteria | 2112 |
| 152 | Ga0163162_10067065 | 3300013306 | Bacteria | 3638 |
| 153 | Ga0163162_10258270 | 3300013306 | Bacteria | 1874 |
| 154 | Ga0157372_10216401 | 3300013307 | Bacteria | 2220 |
| 155 | Ga0157372_10691781 | 3300013307 | Bacteria | 1187 |
| 156 | Ga0157375_10026469 | 3300013308 | Bacteria | 5406 |
| 157 | Ga0157375_10062400 | 3300013308 | Bacteria | 3703 |
| 158 | Ga0157375_10073037 | 3300013308 | Bacteria | 3449 |
| 159 | Ga0157375_10074609 | 3300013308 | Bacteria | 3413 |
| 160 | Ga0157375_10075013 | 3300013308 | Bacteria | 3406 |
| 161 | Ga0157375_10122873 | 3300013308 | Bacteria | 2708 |
| 162 | Ga0163163_10018986 | 3300014325 | Bacteria | 6449 |
| 163 | Ga0163163_10051781 | 3300014325 | Bacteria | 4048 |
| 164 | Ga0163163_10092884 | 3300014325 | Bacteria | 3033 |
| 165 | Ga0163163_10101349 | 3300014325 | Bacteria | 2902 |
| 166 | Ga0157380_10007357 | 3300014326 | Bacteria | 7817 |
| 167 | Ga0157380_10067649 | 3300014326 | Bacteria | 2877 |
| 168 | Ga0182008_10009372 | 3300014497 | Bacteria | 5288 |
| 169 | Ga0157377_10035903 | 3300014745 | Bacteria | 2723 |
| 170 | Ga0157377_10188500 | 3300014745 | Bacteria | 1302 |
| 171 | Ga0157379_10053107 | 3300014968 | Bacteria | 3620 |
| 172 | Ga0157376_10285992 | 3300014969 | Bacteria | 1555 |
| 173 | Ga0157376_10583244 | 3300014969 | Bacteria | 1111 |
| 174 | Ga0182006_1082494 | 3300015261 | Bacteria | 1170 |
| 175 | Ga0182007_10001270 | 3300015262 | Bacteria | 13699 |
| 176 | Ga0182005_1008073 | 3300015265 | Bacteria | 3121 |
| 177 | Ga0163161_10010643 | 3300017792 | Bacteria | 6371 |
| 178 | Ga0213874_10005463 | 3300021377 | Bacteria | 2963 |
| 179 | Ga0213876_10002357 | 3300021384 | Bacteria | 11116 |
| 180 | Ga0213876_10002479 | 3300021384 | Bacteria | 10828 |
| 181 | Ga0213875_10004993 | 3300021388 | Bacteria | 7197 |
| 182 | Ga0209148_1000868 | 3300025254 | Bacteria | 21084 |
| 183 | Ga0207656_10000005 | 3300025321 | Bacteria | 490514 |
| 184 | Ga0207642_10009777 | 3300025899 | Bacteria | 3350 |
| 185 | Ga0207642_10024002 | 3300025899 | Bacteria | 2446 |
| 186 | Ga0207710_10038595 | 3300025900 | Bacteria | 2112 |
| 187 | Ga0207688_10111455 | 3300025901 | Bacteria | 1589 |
| 188 | Ga0207647_10010435 | 3300025904 | Bacteria | 6562 |
| 189 | Ga0207647_10109405 | 3300025904 | Bacteria | 1634 |
| 190 | Ga0207685_10072940 | 3300025905 | Bacteria | 1397 |
| 191 | Ga0207643_10004234 | 3300025908 | Bacteria | 7729 |
| 192 | Ga0207705_10005737 | 3300025909 | Bacteria | 9266 |
| 193 | Ga0207705_10007412 | 3300025909 | Bacteria | 8069 |
| 194 | Ga0207705_10133949 | 3300025909 | Bacteria | 1846 |
| 195 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 196 | Ga0207707_10011531 | 3300025912 | Bacteria | 7698 |
| 197 | Ga0207695_10005221 | 3300025913 | Bacteria | 17364 |
| 198 | Ga0207695_10006733 | 3300025913 | Bacteria | 14831 |
| 199 | Ga0207671_10000016 | 3300025914 | Bacteria | 435413 |
| 200 | Ga0207671_10027283 | 3300025914 | Bacteria | 4269 |
| 201 | Ga0207671_10105237 | 3300025914 | Bacteria | 2141 |
| 202 | Ga0207671_10238505 | 3300025914 | Bacteria | 1428 |
| 203 | Ga0207693_10249615 | 3300025915 | Bacteria | 1392 |
| 204 | Ga0207663_10073100 | 3300025916 | Bacteria | 2218 |
| 205 | Ga0207660_10013673 | 3300025917 | Bacteria | 5324 |
| 206 | Ga0207660_10150922 | 3300025917 | Bacteria | 1785 |
| 207 | Ga0207657_10037185 | 3300025919 | Bacteria | 4350 |
| 208 | Ga0207657_10044681 | 3300025919 | Bacteria | 3893 |
| 209 | Ga0207657_10127693 | 3300025919 | Bacteria | 2087 |
| 210 | Ga0207657_10139129 | 3300025919 | Bacteria | 1984 |
| 211 | Ga0207649_10087598 | 3300025920 | Bacteria | 2032 |
| 212 | Ga0207649_10226645 | 3300025920 | Bacteria | 1334 |
| 213 | Ga0207652_10021373 | 3300025921 | Bacteria | 5342 |
| 214 | Ga0207652_10172330 | 3300025921 | Bacteria | 1942 |
| 215 | Ga0207646_10570567 | 3300025922 | Bacteria | 1017 |
| 216 | Ga0207681_10194415 | 3300025923 | Bacteria | 1554 |
| 217 | Ga0207694_10000660 | 3300025924 | Bacteria | 31108 |
| 218 | Ga0207694_10188588 | 3300025924 | Bacteria | 1674 |
| 219 | Ga0207659_10246039 | 3300025926 | Bacteria | 1449 |
| 220 | Ga0207687_10015934 | 3300025927 | Bacteria | 4932 |
| 221 | Ga0207687_10035046 | 3300025927 | Bacteria | 3412 |
| 222 | Ga0207687_10052171 | 3300025927 | Bacteria | 2853 |
| 223 | Ga0207687_10266091 | 3300025927 | Bacteria | 1368 |
| 224 | Ga0207690_10129919 | 3300025932 | Bacteria | 1842 |
| 225 | Ga0207690_10158970 | 3300025932 | Bacteria | 1683 |
| 226 | Ga0207690_10269392 | 3300025932 | Bacteria | 1322 |
| 227 | Ga0207706_10098567 | 3300025933 | Bacteria | 2571 |
| 228 | Ga0207686_10025028 | 3300025934 | Bacteria | 3466 |
| 229 | Ga0207686_10186836 | 3300025934 | Bacteria | 1474 |
| 230 | Ga0207709_10011467 | 3300025935 | Bacteria | 4889 |
| 231 | Ga0207709_10080423 | 3300025935 | Bacteria | 2098 |
| 232 | Ga0207670_10091013 | 3300025936 | Bacteria | 2156 |
| 233 | Ga0207669_10003955 | 3300025937 | Bacteria | 6467 |
| 234 | Ga0207669_10082859 | 3300025937 | Bacteria | 2060 |
| 235 | Ga0207704_10012489 | 3300025938 | Bacteria | 4215 |
| 236 | Ga0207691_10037509 | 3300025940 | Bacteria | 4488 |
| 237 | Ga0207711_10003988 | 3300025941 | Bacteria | 12680 |
| 238 | Ga0207711_10472592 | 3300025941 | Bacteria | 1168 |
| 239 | Ga0207689_10024592 | 3300025942 | Bacteria | 5052 |
| 240 | Ga0207661_10002823 | 3300025944 | Bacteria | 11993 |
| 241 | Ga0207661_10014527 | 3300025944 | Bacteria | 5775 |
| 242 | Ga0207661_10045526 | 3300025944 | Bacteria | 3473 |
| 243 | Ga0207667_10001071 | 3300025949 | Bacteria | 34686 |
| 244 | Ga0207667_10001561 | 3300025949 | Bacteria | 28853 |
| 245 | Ga0207667_10070293 | 3300025949 | Bacteria | 3643 |
| 246 | Ga0207651_10156574 | 3300025960 | Bacteria | 1781 |
| 247 | Ga0207668_10000326 | 3300025972 | Bacteria | 30849 |
| 248 | Ga0207668_10128218 | 3300025972 | Bacteria | 1933 |
| 249 | Ga0207668_10192963 | 3300025972 | Bacteria | 1616 |
| 250 | Ga0207640_10117279 | 3300025981 | Bacteria | 1900 |
| 251 | Ga0207658_10043810 | 3300025986 | Bacteria | 3255 |
| 252 | Ga0207677_10051270 | 3300026023 | Bacteria | 2797 |
| 253 | Ga0207677_10243725 | 3300026023 | Bacteria | 1456 |
| 254 | Ga0207677_10325322 | 3300026023 | Bacteria | 1279 |
| 255 | Ga0207703_10000075 | 3300026035 | Bacteria | 118422 |
| 256 | Ga0207639_10078220 | 3300026041 | Bacteria | 2610 |
| 257 | Ga0207639_10172951 | 3300026041 | Bacteria | 1831 |
| 258 | Ga0207639_10246144 | 3300026041 | Bacteria | 1557 |
| 259 | Ga0207678_10007961 | 3300026067 | Bacteria | 9347 |
| 260 | Ga0207708_10017779 | 3300026075 | Bacteria | 5351 |
| 261 | Ga0207708_10036408 | 3300026075 | Bacteria | 3746 |
| 262 | Ga0207702_10330364 | 3300026078 | Bacteria | 1454 |
| 263 | Ga0207648_10006652 | 3300026089 | Bacteria | 11473 |
| 264 | Ga0207676_10013267 | 3300026095 | Bacteria | 5919 |
| 265 | Ga0207676_10411231 | 3300026095 | Bacteria | 1267 |
| 266 | Ga0207674_10003366 | 3300026116 | Bacteria | 19630 |
| 267 | Ga0207674_10113166 | 3300026116 | Bacteria | 2687 |
| 268 | Ga0207674_10150565 | 3300026116 | Bacteria | 2284 |
| 269 | Ga0207675_100020755 | 3300026118 | Bacteria | 6124 |
| 270 | Ga0207675_100021524 | 3300026118 | Bacteria | 6005 |
| 271 | Ga0207675_100114373 | 3300026118 | Bacteria | 2549 |
| 272 | Ga0207683_10121380 | 3300026121 | Bacteria | 2346 |
| 273 | Ga0207683_10230489 | 3300026121 | Bacteria | 1689 |
| 274 | Ga0207698_10000546 | 3300026142 | Bacteria | 21869 |
| 275 | Ga0207698_10011879 | 3300026142 | Bacteria | 5670 |
| 276 | Ga0207698_10043297 | 3300026142 | Bacteria | 3371 |
| 277 | Ga0207428_10002647 | 3300027907 | Bacteria | 17846 |
| 278 | Ga0207428_10043589 | 3300027907 | Bacteria | 3622 |
| 279 | Ga0268265_10014634 | 3300028380 | Bacteria | 5349 |
| 280 | Ga0268265_10231085 | 3300028380 | Bacteria | 1626 |
| 281 | Ga0268264_10097868 | 3300028381 | Bacteria | 2544 |
| 282 | Ga0265337_1003247 | 3300028556 | Bacteria | 7107 |
| 283 | Ga0265337_1028178 | 3300028556 | Bacteria | 1688 |
| 284 | Ga0265326_10044140 | 3300028558 | Bacteria | 1265 |
| 285 | Ga0265319_1005290 | 3300028563 | Bacteria | 6213 |
| 286 | Ga0265319_1007002 | 3300028563 | Bacteria | 5130 |
| 287 | Ga0265334_10009710 | 3300028573 | Unclassified | 4067 |
| 288 | Ga0265318_10001224 | 3300028577 | Bacteria | 15611 |
| 289 | Ga0265318_10022594 | 3300028577 | Bacteria | 2513 |
| 290 | Ga0265338_10025672 | 3300028800 | Bacteria | 5971 |
| 291 | Ga0265338_10078332 | 3300028800 | Unclassified | 2788 |
| 292 | Ga0307512_10000296 | 3300030522 | Bacteria | 71852 |
| 293 | Ga0265332_10054887 | 3300031238 | Unclassified | 1709 |
| 294 | Ga0265320_10002298 | 3300031240 | Bacteria | 13393 |
| 295 | Ga0265320_10002368 | 3300031240 | Bacteria | 13186 |
| 296 | Ga0265340_10002753 | 3300031247 | Bacteria | 10014 |
| 297 | Ga0265340_10035273 | 3300031247 | Bacteria | 2485 |
| 298 | Ga0265331_10081765 | 3300031250 | Bacteria | 1500 |
| 299 | Ga0265331_10082801 | 3300031250 | Bacteria | 1488 |
| 300 | Ga0265327_10012837 | 3300031251 | Bacteria | 5615 |
| 301 | Ga0265316_10054153 | 3300031344 | Bacteria | 3141 |
| 302 | Ga0307513_10000001 | 3300031456 | Bacteria | 1660464 |
| 303 | Ga0265313_10054183 | 3300031595 | Unclassified | 1906 |
| 304 | Ga0307508_10012227 | 3300031616 | Bacteria | 7847 |
| 305 | Ga0316579_10091363 | 3300031691 | Bacteria | 1454 |
| 306 | Ga0265314_10001801 | 3300031711 | Bacteria | 23105 |
| 307 | Ga0265314_10035890 | 3300031711 | Bacteria | 3610 |
| 308 | Ga0316576_10021659 | 3300031727 | Bacteria | 4450 |
| 309 | Ga0316576_10026237 | 3300031727 | Bacteria | 4087 |
| 310 | Ga0316576_10041384 | 3300031727 | Bacteria | 3317 |
| 311 | Ga0316576_10350014 | 3300031727 | Bacteria | 1099 |
| 312 | Ga0307516_10094526 | 3300031730 | Bacteria | 2813 |
| 313 | Ga0307516_10143912 | 3300031730 | Bacteria | 2151 |
| 314 | Ga0307405_10067763 | 3300031731 | Bacteria | 2281 |
| 315 | Ga0307518_10149847 | 3300031838 | Bacteria | 1615 |
| 316 | Ga0307410_10118426 | 3300031852 | Bacteria | 1927 |
| 317 | Ga0307406_10008519 | 3300031901 | Bacteria | 5725 |
| 318 | Ga0307406_10085632 | 3300031901 | Bacteria | 2108 |
| 319 | Ga0307407_10009079 | 3300031903 | Bacteria | 4611 |
| 320 | Ga0307407_10133640 | 3300031903 | Bacteria | 1591 |
| 321 | Ga0307412_10029994 | 3300031911 | Bacteria | 3419 |
| 322 | Ga0307409_100001648 | 3300031995 | Bacteria | 11194 |
| 323 | Ga0307409_100076179 | 3300031995 | Bacteria | 2689 |
| 324 | Ga0307414_10113423 | 3300032004 | Bacteria | 2069 |
| 325 | Ga0307415_100005147 | 3300032126 | Bacteria | 6898 |
| 326 | Ga0307415_100079171 | 3300032126 | Bacteria | 2340 |
| 327 | Ga0307415_100157386 | 3300032126 | Bacteria | 1756 |
| 328 | Ga0316583_10020093 | 3300032133 | Bacteria | 2393 |
| 329 | Ga0307507_10083915 | 3300033179 | Bacteria | 2781 |
| 330 | Ga0373951_0000555 | 3300035091 | Bacteria | 10438 |
| 331 | Ga0373936_0109933 | 3300035113 | Bacteria | 1170 |
| 332 | Ga0316574_0054035 | 3300035398 | Bacteria | 2508 |
| 333 | Ga0316574_0126039 | 3300035398 | Bacteria | 1646 |
| 334 | Ga0316574_0132999 | 3300035398 | Bacteria | 1601 |
| 335 | Ga0316574_0136126 | 3300035398 | Bacteria | 1582 |
| 336 | Ga0316574_0136919 | 3300035398 | Bacteria | 1577 |
| 337 | Ga0373927_0308896 | 3300035695 | Bacteria | 1041 |
| 338 | Ga0373947_0042168 | 3300035725 | Bacteria | 2724 |
| 339 | Ga0436364_0439256 | 3300037853 | Bacteria | 14421 |
| 340 | Ga0400483_018531 | 3300039062 | Bacteria | 58611 |
| 341 | Ga0400483_026059 | 3300039062 | Bacteria | 3067 |
| 342 | Ga0400483_157467 | 3300039062 | Bacteria | 5265 |
| 343 | Ga0400483_219255 | 3300039062 | Bacteria | 53229 |
| 344 | Ga0436365_1029827 | 3300039437 | Bacteria | 22692 |
| 345 | Ga0436365_1407609 | 3300039437 | Bacteria | 22047 |
| 346 | Ga0436362_0250117 | 3300039453 | Bacteria | 5706 |
| 347 | Ga0439465_0027400 | 3300041413 | Bacteria | 1805 |
| 348 | Ga0451791_1009347 | 3300041451 | Bacteria | 1875 |
| 349 | Ga0451841_0096979 | 3300041498 | Bacteria | 1987 |
| 350 | Ga0451843_0930883 | 3300041509 | Bacteria | 1060 |
| 351 | Ga0451853_0145122 | 3300041512 | Bacteria | 2626 |
| 352 | Ga0451853_0450515 | 3300041512 | Bacteria | 7912 |
| 353 | Ga0439448_0029296 | 3300042005 | Bacteria | 1742 |
| 354 | Ga0439449_0001034 | 3300042007 | Bacteria | 10949 |
| 355 | Ga0439449_0013219 | 3300042007 | Bacteria | 3105 |
| 356 | Ga0453683_0004947 | 3300044673 | Bacteria | 9362 |
| 357 | Ga0453683_0058063 | 3300044673 | Bacteria | 2421 |
| 358 | Ga0453684_0089989 | 3300044712 | Bacteria | 3793 |
| 359 | Ga0495603_0023426 | 3300046455 | Bacteria | 3736 |
| 360 | Ga0495603_0051861 | 3300046455 | Bacteria | 2436 |
| 361 | Ga0495603_0061543 | 3300046455 | Bacteria | 2217 |
| 362 | Ga0495590_0000141 | 3300046457 | Bacteria | 43370 |
| 363 | Ga0495641_0012847 | 3300046461 | Bacteria | 4648 |
| 364 | Ga0495641_0066502 | 3300046461 | Bacteria | 1622 |
| 365 | Ga0495651_0251084 | 3300046462 | Bacteria | 1208 |
| 366 | Ga0495653_0128635 | 3300046463 | Bacteria | 1796 |
| 367 | Ga0495650_0000508 | 3300046471 | Bacteria | 58152 |
| 368 | Ga0495582_0060921 | 3300046473 | Bacteria | 2083 |
| 369 | Ga0495639_0067923 | 3300046475 | Bacteria | 1643 |
| 370 | Ga0495662_0003349 | 3300046476 | Bacteria | 8126 |
| 371 | Ga0495664_0280233 | 3300046477 | Bacteria | 1007 |
| 372 | Ga0495606_0002413 | 3300046507 | Bacteria | 21807 |
| 373 | Ga0495587_0202407 | 3300046536 | Bacteria | 1123 |
| 374 | Ga0495635_0157011 | 3300046663 | Bacteria | 1548 |
| 375 | Ga0495657_0003646 | 3300046675 | Bacteria | 12497 |
| 376 | Ga0495613_0006587 | 3300046689 | Bacteria | 8682 |
| 377 | Ga0495613_0060665 | 3300046689 | Bacteria | 2770 |
| 378 | Ga0495589_0029796 | 3300046794 | Bacteria | 2751 |
| 379 | Ga0495604_0174238 | 3300047317 | Bacteria | 1510 |
| 380 | Ga0495674_0082029 | 3300047319 | Bacteria | 2765 |
| 381 | Ga0495674_0234898 | 3300047319 | Bacteria | 1512 |
| 382 | Ga0495672_0150089 | 3300047320 | Bacteria | 1209 |
| 383 | Ga0495676_0024447 | 3300047321 | Bacteria | 5230 |
| 384 | Ga0495680_0327456 | 3300047322 | Bacteria | 1071 |
| 385 | Ga0495685_020288 | 3300047447 | Bacteria | 2283 |
| 386 | Ga0495684_0094054 | 3300047471 | Bacteria | 2270 |
| 387 | Ga0495626_0039886 | 3300048091 | Bacteria | 2220 |
| 388 | Ga0496100_0006441 | 3300048903 | Bacteria | 6400 |
| 389 | Ga0496101_0002535 | 3300048904 | Bacteria | 11218 |
| 390 | Ga0496101_0032208 | 3300048904 | Bacteria | 3688 |
| 391 | Ga0496101_0038664 | 3300048904 | Bacteria | 3389 |
| 392 | Ga0496102_0001623 | 3300048905 | Bacteria | 19807 |
| 393 | Ga0496103_0052292 | 3300048906 | Bacteria | 2530 |
| 394 | Ga0496103_0082653 | 3300048906 | Bacteria | 2021 |
| 395 | Ga0496104_0000254 | 3300048907 | Bacteria | 47479 |
| 396 | Ga0496104_0006435 | 3300048907 | Bacteria | 10325 |
| 397 | Ga0496104_0028591 | 3300048907 | Bacteria | 5167 |
| 398 | Ga0496104_0036151 | 3300048907 | Bacteria | 4615 |
| 399 | Ga0496104_0270477 | 3300048907 | Bacteria | 1612 |
| 400 | Ga0496104_0330088 | 3300048907 | Bacteria | 1438 |
| 401 | Ga0496105_0000055 | 3300048908 | Bacteria | 88389 |
| 402 | Ga0496105_0006658 | 3300048908 | Bacteria | 8895 |
| 403 | Ga0496105_0012523 | 3300048908 | Bacteria | 6715 |
| 404 | Ga0496105_0050467 | 3300048908 | Bacteria | 3436 |
| 405 | Ga0496105_0227772 | 3300048908 | Bacteria | 1515 |
| 406 | Ga0496106_0018472 | 3300048909 | Bacteria | 5156 |
| 407 | Ga0496106_0211833 | 3300048909 | Bacteria | 1544 |
| 408 | Ga0496106_0224660 | 3300048909 | Bacteria | 1498 |
| 409 | Ga0496107_0030922 | 3300048910 | Bacteria | 3818 |
| 410 | Ga0496107_0138803 | 3300048910 | Bacteria | 1797 |
| 411 | Ga0496108_0000983 | 3300048911 | Bacteria | 22185 |
| 412 | Ga0496108_0004832 | 3300048911 | Bacteria | 10872 |
| 413 | Ga0496108_0013658 | 3300048911 | Bacteria | 6629 |
| 414 | Ga0496108_0030064 | 3300048911 | Bacteria | 4503 |
| 415 | Ga0496108_0052881 | 3300048911 | Bacteria | 3405 |
| 416 | Ga0496109_0024333 | 3300048912 | Bacteria | 5383 |
| 417 | Ga0496109_0040031 | 3300048912 | Bacteria | 4244 |
| 418 | Ga0496109_0058454 | 3300048912 | Bacteria | 3522 |
| 419 | Ga0496109_0101409 | 3300048912 | Bacteria | 2671 |
| 420 | Ga0496109_0106525 | 3300048912 | Bacteria | 2604 |
| 421 | Ga0496109_0184610 | 3300048912 | Bacteria | 1960 |
| 422 | Ga0496109_0223279 | 3300048912 | Bacteria | 1772 |
| 423 | Ga0496110_0000306 | 3300048913 | Bacteria | 32370 |
| 424 | Ga0496110_0097562 | 3300048913 | Bacteria | 2633 |
| 425 | Ga0496111_0000092 | 3300048914 | Bacteria | 38172 |
| 426 | Ga0496111_0010428 | 3300048914 | Bacteria | 6235 |
| 427 | Ga0496111_0121387 | 3300048914 | Bacteria | 1930 |
| 428 | Ga0496112_0009046 | 3300048915 | Bacteria | 8946 |
| 429 | Ga0496112_0129549 | 3300048915 | Bacteria | 2494 |
| 430 | Ga0496112_0267470 | 3300048915 | Bacteria | 1658 |
| 431 | Ga0496113_0002577 | 3300048916 | Bacteria | 10590 |
| 432 | Ga0496113_0092257 | 3300048916 | Bacteria | 2336 |
| 433 | Ga0496113_0275467 | 3300048916 | Bacteria | 1345 |
| 434 | Ga0496114_0000256 | 3300048917 | Bacteria | 38442 |
| 435 | Ga0496114_0004277 | 3300048917 | Bacteria | 11054 |
| 436 | Ga0496114_0005571 | 3300048917 | Bacteria | 9870 |
| 437 | Ga0496114_0044504 | 3300048917 | Bacteria | 3683 |
| 438 | Ga0496114_0054316 | 3300048917 | Bacteria | 3340 |
| 439 | Ga0496114_0069692 | 3300048917 | Bacteria | 2953 |
| 440 | Ga0496114_0112074 | 3300048917 | Bacteria | 2338 |
| 441 | Ga0496114_0452707 | 3300048917 | Bacteria | 1137 |
| 442 | Ga0496115_0018044 | 3300048918 | Bacteria | 5408 |
| 443 | Ga0496119_0000959 | 3300048922 | Bacteria | 37115 |
| 444 | Ga0496120_0000257 | 3300048923 | Bacteria | 88760 |
| 445 | Ga0496126_0260894 | 3300048929 | Bacteria | 1441 |
| 446 | Ga0501031_0007713 | 3300049568 | Bacteria | 7006 |
| 447 | Ga0501031_0021925 | 3300049568 | Bacteria | 4162 |
| 448 | Ga0501031_0141729 | 3300049568 | Bacteria | 1571 |
| 449 | Ga0501031_0174424 | 3300049568 | Bacteria | 1405 |
| 450 | Ga0501032_0067972 | 3300049569 | Bacteria | 2379 |
| 451 | Ga0501032_0128654 | 3300049569 | Bacteria | 1672 |
| 452 | Ga0501033_0060719 | 3300049570 | Bacteria | 2788 |
| 453 | Ga0501033_0170010 | 3300049570 | Bacteria | 1566 |
| 454 | Ga0501034_0021251 | 3300049571 | Bacteria | 6618 |
| 455 | Ga0501034_0044015 | 3300049571 | Bacteria | 4515 |
| 456 | Ga0501034_0077004 | 3300049571 | Bacteria | 3341 |
| 457 | Ga0501034_0199864 | 3300049571 | Bacteria | 1957 |
| 458 | Ga0501036_0024728 | 3300049572 | Bacteria | 5063 |
| 459 | Ga0501036_0051443 | 3300049572 | Bacteria | 3488 |
| 460 | Ga0501037_0041131 | 3300049573 | Bacteria | 3400 |
| 461 | Ga0501037_0104857 | 3300049573 | Bacteria | 2038 |
| 462 | Ga0501038_0017723 | 3300049574 | Bacteria | 6436 |
| 463 | Ga0501038_0038980 | 3300049574 | Bacteria | 4158 |
| 464 | Ga0501038_0183187 | 3300049574 | Bacteria | 1689 |
| 465 | Ga0501038_0373736 | 3300049574 | Bacteria | 1107 |
| 466 | Ga0501039_0030290 | 3300049575 | Bacteria | 4171 |
| 467 | Ga0501039_0081526 | 3300049575 | Bacteria | 2519 |
| 468 | Ga0501039_0354784 | 3300049575 | Bacteria | 1152 |
| 469 | Ga0501040_0090764 | 3300049576 | Bacteria | 2123 |
| 470 | Ga0501041_0011146 | 3300049577 | Bacteria | 5309 |
| 471 | Ga0501041_0217375 | 3300049577 | Bacteria | 1199 |
| 472 | Ga0501042_0039037 | 3300049578 | Bacteria | 3374 |
| 473 | Ga0501042_0251791 | 3300049578 | Bacteria | 1274 |
| 474 | Ga0501046_0017001 | 3300049580 | Bacteria | 6082 |
| 475 | Ga0501046_0056569 | 3300049580 | Bacteria | 3079 |
| 476 | Ga0501046_0064721 | 3300049580 | Bacteria | 2854 |
| 477 | Ga0501046_0144716 | 3300049580 | Bacteria | 1796 |
| 478 | Ga0501046_0329269 | 3300049580 | Bacteria | 1112 |
| 479 | Ga0501047_0140170 | 3300049581 | Bacteria | 2297 |
| 480 | Ga0501047_0155461 | 3300049581 | Bacteria | 2161 |
| 481 | Ga0501048_0011265 | 3300049582 | Bacteria | 6669 |
| 482 | Ga0501048_0027774 | 3300049582 | Bacteria | 4109 |
| 483 | Ga0501048_0034961 | 3300049582 | Bacteria | 3621 |
| 484 | Ga0501048_0046549 | 3300049582 | Bacteria | 3096 |
| 485 | Ga0501048_0177462 | 3300049582 | Bacteria | 1510 |
| 486 | Ga0501048_0204833 | 3300049582 | Bacteria | 1399 |
| 487 | Ga0501067_0029347 | 3300049583 | Bacteria | 3048 |
| 488 | Ga0501067_0063195 | 3300049583 | Bacteria | 2050 |
| 489 | Ga0501068_0020958 | 3300049584 | Bacteria | 3814 |
| 490 | Ga0501068_0102063 | 3300049584 | Bacteria | 1779 |
| 491 | Ga0501069_0006943 | 3300049585 | Bacteria | 5919 |
| 492 | Ga0501070_0010209 | 3300049586 | Bacteria | 7945 |
| 493 | Ga0501070_0021140 | 3300049586 | Bacteria | 5461 |
| 494 | Ga0501070_0023607 | 3300049586 | Bacteria | 5152 |
| 495 | Ga0501070_0071645 | 3300049586 | Bacteria | 2869 |
| 496 | Ga0501070_0115682 | 3300049586 | Bacteria | 2215 |
| 497 | Ga0501070_0120765 | 3300049586 | Bacteria | 2166 |
| 498 | Ga0501071_0006580 | 3300049587 | Bacteria | 7548 |
| 499 | Ga0501071_0018214 | 3300049587 | Bacteria | 4858 |
| 500 | Ga0501071_0020602 | 3300049587 | Bacteria | 4584 |
| 501 | Ga0501071_0176364 | 3300049587 | Bacteria | 1601 |
| 502 | Ga0501071_0204996 | 3300049587 | Bacteria | 1482 |
| 503 | Ga0501072_0011816 | 3300049588 | Bacteria | 6670 |
| 504 | Ga0501072_0023324 | 3300049588 | Bacteria | 4805 |
| 505 | Ga0501072_0046231 | 3300049588 | Bacteria | 3425 |
| 506 | Ga0501072_0217992 | 3300049588 | Bacteria | 1521 |
| 507 | Ga0501072_0488989 | 3300049588 | Bacteria | 973 |
| 508 | Ga0501073_0008149 | 3300049589 | Bacteria | 7773 |
| 509 | Ga0501073_0040007 | 3300049589 | Bacteria | 3320 |
| 510 | Ga0501073_0115147 | 3300049589 | Bacteria | 1864 |
| 511 | Ga0501074_0009891 | 3300049590 | Bacteria | 6928 |
| 512 | Ga0501074_0113400 | 3300049590 | Bacteria | 1939 |
| 513 | Ga0501074_0135673 | 3300049590 | Bacteria | 1760 |
| 514 | Ga0501074_0180406 | 3300049590 | Bacteria | 1506 |
| 515 | Ga0501075_0023907 | 3300049591 | Bacteria | 4475 |
| 516 | Ga0501075_0041828 | 3300049591 | Bacteria | 3435 |
| 517 | Ga0501075_0079655 | 3300049591 | Bacteria | 2479 |
| 518 | Ga0501075_0104185 | 3300049591 | Bacteria | 2156 |
| 519 | Ga0501075_0274594 | 3300049591 | Bacteria | 1284 |
| 520 | Ga0501075_0386565 | 3300049591 | Bacteria | 1067 |
| 521 | Ga0501076_0005549 | 3300049592 | Bacteria | 9087 |
| 522 | Ga0501076_0006148 | 3300049592 | Bacteria | 8691 |
| 523 | Ga0501076_0019041 | 3300049592 | Bacteria | 5237 |
| 524 | Ga0501076_0024689 | 3300049592 | Bacteria | 4648 |
| 525 | Ga0501076_0060775 | 3300049592 | Bacteria | 3007 |
| 526 | Ga0501076_0065881 | 3300049592 | Bacteria | 2890 |
| 527 | Ga0501076_0468356 | 3300049592 | Bacteria | 1038 |
| 528 | Ga0501077_0015358 | 3300049593 | Bacteria | 4821 |
| 529 | Ga0501077_0049089 | 3300049593 | Bacteria | 2682 |
| 530 | Ga0501079_0025854 | 3300049741 | Bacteria | 4503 |
| 531 | Ga0501079_0026178 | 3300049741 | Bacteria | 4472 |
| 532 | Ga0501079_0196667 | 3300049741 | Bacteria | 1574 |
| 533 | Ga0501079_0215935 | 3300049741 | Bacteria | 1498 |
| 534 | Ga0501079_0263011 | 3300049741 | Bacteria | 1348 |
| 535 | Ga0501080_0001999 | 3300049742 | Bacteria | 17601 |
| 536 | Ga0501080_0028590 | 3300049742 | Bacteria | 5188 |
| 537 | Ga0501080_0029937 | 3300049742 | Bacteria | 5068 |
| 538 | Ga0501080_0089022 | 3300049742 | Bacteria | 2867 |
| 539 | Ga0501080_0104322 | 3300049742 | Bacteria | 2629 |
| 540 | Ga0501080_0293876 | 3300049742 | Bacteria | 1475 |
| 541 | Ga0501081_0004295 | 3300049743 | Bacteria | 9129 |
| 542 | Ga0501083_0001849 | 3300049744 | Bacteria | 14523 |
| 543 | Ga0501083_0036635 | 3300049744 | Bacteria | 3345 |
| 544 | Ga0501035_0031050 | 3300049822 | Bacteria | 4866 |
| 545 | Ga0501035_0299114 | 3300049822 | Bacteria | 1356 |
| 546 | Ga0501044_0158662 | 3300049823 | Bacteria | 2240 |
| 547 | Ga0501044_0270455 | 3300049823 | Bacteria | 1635 |
| 548 | Ga0501045_0004608 | 3300049824 | Bacteria | 9522 |
| 549 | Ga0501045_0036638 | 3300049824 | Bacteria | 3563 |
| 550 | Ga0501045_0061550 | 3300049824 | Bacteria | 2754 |
| 551 | Ga0501045_0107462 | 3300049824 | Bacteria | 2068 |
| 552 | Ga0501045_0126834 | 3300049824 | Bacteria | 1896 |
| 553 | Ga0501045_0155301 | 3300049824 | Bacteria | 1703 |
| 554 | nmdc:mga03n38_109777_c1 | 3300050490 | Bacteria | 1342 |
| 555 | nmdc:mga00v17_81914_c1 | 3300050491 | Bacteria | 2016 |
| 556 | nmdc:mga07m45_6304_c1 | 3300050496 | Bacteria | 5990 |
| 557 | nmdc:mga07m45_86225_c1 | 3300050496 | Bacteria | 1796 |
| 558 | nmdc:mga05p37_121038_c1 | 3300050507 | Bacteria | 3215 |
| 559 | nmdc:mga05p37_126438_c1 | 3300050507 | Bacteria | 3139 |
| 560 | nmdc:mga05p37_5351_c1 | 3300050507 | Bacteria | 15084 |
| 561 | nmdc:mga09592_7679_c1 | 3300050508 | Bacteria | 8768 |
| 562 | nmdc:mga0qj67_16_c1 | 3300050509 | Bacteria | 124323 |
| 563 | nmdc:mga0qj67_17318_c1 | 3300050509 | Bacteria | 5477 |
| 564 | nmdc:mga0qj67_213678_c1 | 3300050509 | Bacteria | 1566 |
| 565 | nmdc:mga06r32_38_c1 | 3300050510 | Bacteria | 13919 |
| 566 | nmdc:mga08y16_183897_c1 | 3300050511 | Bacteria | 2169 |
| 567 | nmdc:mga08y16_22515_c1 | 3300050511 | Bacteria | 6652 |
| 568 | nmdc:mga08y16_2792_c1 | 3300050511 | Bacteria | 17902 |
| 569 | nmdc:mga0rr50_279989_c1 | 3300050513 | Bacteria | 1391 |
| 570 | Ga0500635_0013383 | 3300053080 | Bacteria | 2382 |
| 571 | Ga0495619_0058017 | 3300053085 | Bacteria | 2569 |
| 572 | Ga0495619_0254926 | 3300053085 | Bacteria | 1216 |
| 573 | Ga0500628_029249 | 3300053129 | Bacteria | 1183 |
| 574 | Ga0500559_0000078 | 3300053136 | Bacteria | 76033 |
| 575 | Ga0500568_0004651 | 3300053139 | Bacteria | 7301 |
| 576 | Ga0500573_0000011 | 3300053140 | Bacteria | 209484 |
| 577 | Ga0500616_0001398 | 3300053153 | Bacteria | 23244 |
| 578 | Ga0500620_000016 | 3300053155 | Bacteria | 36323 |
| 579 | Ga0501084_0013022 | 3300054114 | Bacteria | 6882 |
| 580 | Ga0501084_0052176 | 3300054114 | Bacteria | 3422 |
| 581 | Ga0501084_0092773 | 3300054114 | Bacteria | 2535 |
| 582 | Ga0501084_0099264 | 3300054114 | Bacteria | 2445 |
| 583 | Ga0501084_0191354 | 3300054114 | Bacteria | 1726 |
| 584 | Ga0501084_0347770 | 3300054114 | Bacteria | 1252 |
| 585 | Ga0501082_0045538 | 3300060353 | Unclassified | 3783 |
| 586 | Ga0501082_0094682 | 3300060353 | Bacteria | 2581 |
| 587 | Ga0501082_0114551 | 3300060353 | Bacteria | 2334 |
| 588 | Ga0530510_0003441 | 3300061734 | Bacteria | 10880 |
| 589 | Ga0530510_0137587 | 3300061734 | Bacteria | 1798 |
| 590 | Ga0530510_0156941 | 3300061734 | Bacteria | 1682 |
| 591 | Ga0530510_0420243 | 3300061734 | Bacteria | 1009 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006847 | Ga0075431_100188874 | Ga0075431_1001888742 | 268 |
| 2 | 3300049591 | Ga0501075_0104185 | Ga0501075_0104185_611_1477 | 269 |
| 3 | 3300006846 | Ga0075430_100081788 | Ga0075430_1000817882 | 270 |
| 4 | 3300050509 | nmdc:mga0qj67_17318_c1 | nmdc:mga0qj67_17318_c1_607_1614 | 270 |
| 5 | 3300048912 | Ga0496109_0223279 | Ga0496109_0223279_795_1742 | 273 |
| 6 | 3300048915 | Ga0496112_0267470 | Ga0496112_0267470_65_1012 | 273 |
| 7 | 3300048906 | Ga0496103_0082653 | Ga0496103_0082653_1170_2003 | 277 |
| 8 | 3300048911 | Ga0496108_0030064 | Ga0496108_0030064_23_901 | 277 |
| 9 | 3300049742 | Ga0501080_0293876 | Ga0501080_0293876_228_1064 | 278 |
| 10 | 3300054114 | Ga0501084_0013022 | Ga0501084_0013022_2450_3286 | 278 |
| 11 | 3300005843 | Ga0068860_100262705 | Ga0068860_1002627052 | 280 |
| 12 | 3300028573 | Ga0265334_10009710 | Ga0265334_100097102 | 280 |
| 13 | 3300028800 | Ga0265338_10078332 | Ga0265338_100783322 | 280 |
| 14 | 3300031238 | Ga0265332_10054887 | Ga0265332_100548872 | 280 |
| 15 | 3300031247 | Ga0265340_10002753 | Ga0265340_100027537 | 280 |
| 16 | 3300031595 | Ga0265313_10054183 | Ga0265313_100541831 | 280 |
| 17 | 3300031727 | Ga0316576_10350014 | Ga0316576_103500142 | 280 |
| 18 | 3300035398 | Ga0316574_0126039 | Ga0316574_0126039_104_1039 | 280 |
| 19 | 3300048917 | Ga0496114_0112074 | Ga0496114_0112074_28_870 | 280 |
| 20 | 3300049568 | Ga0501031_0007713 | Ga0501031_0007713_3683_4621 | 280 |
| 21 | 3300049569 | Ga0501032_0067972 | Ga0501032_0067972_59_997 | 280 |
| 22 | 3300049570 | Ga0501033_0060719 | Ga0501033_0060719_221_1159 | 280 |
| 23 | 3300049572 | Ga0501036_0024728 | Ga0501036_0024728_127_1065 | 280 |
| 24 | 3300049573 | Ga0501037_0041131 | Ga0501037_0041131_1966_2904 | 280 |
| 25 | 3300049574 | Ga0501038_0017723 | Ga0501038_0017723_3863_4801 | 280 |
| 26 | 3300049575 | Ga0501039_0030290 | Ga0501039_0030290_2570_3508 | 280 |
| 27 | 3300049576 | Ga0501040_0090764 | Ga0501040_0090764_615_1553 | 280 |
| 28 | 3300049577 | Ga0501041_0011146 | Ga0501041_0011146_1927_2865 | 280 |
| 29 | 3300049580 | Ga0501046_0017001 | Ga0501046_0017001_1755_2693 | 280 |
| 30 | 3300049582 | Ga0501048_0011265 | Ga0501048_0011265_4126_5064 | 280 |
| 31 | 3300049584 | Ga0501068_0020958 | Ga0501068_0020958_308_1246 | 280 |
| 32 | 3300049585 | Ga0501069_0006943 | Ga0501069_0006943_3292_4230 | 280 |
| 33 | 3300049586 | Ga0501070_0071645 | Ga0501070_0071645_521_1459 | 280 |
| 34 | 3300049587 | Ga0501071_0018214 | Ga0501071_0018214_3805_4743 | 280 |
| 35 | 3300049590 | Ga0501074_0009891 | Ga0501074_0009891_2386_3324 | 280 |
| 36 | 3300049591 | Ga0501075_0023907 | Ga0501075_0023907_1435_2373 | 280 |
| 37 | 3300049592 | Ga0501076_0019041 | Ga0501076_0019041_4102_5040 | 280 |
| 38 | 3300049593 | Ga0501077_0015358 | Ga0501077_0015358_1330_2268 | 280 |
| 39 | 3300049742 | Ga0501080_0029937 | Ga0501080_0029937_503_1441 | 280 |
| 40 | 3300049822 | Ga0501035_0031050 | Ga0501035_0031050_2569_3507 | 280 |
| 41 | 3300054114 | Ga0501084_0052176 | Ga0501084_0052176_616_1554 | 280 |
| 42 | 3300061734 | Ga0530510_0137587 | Ga0530510_0137587_562_1500 | 280 |
| 43 | iso_pu_bacteria | 2887478801 | 2887487046 | 280 |
| 44 | 3300046457 | Ga0495590_0000141 | Ga0495590_0000141_4258_5103 | 281 |
| 45 | 3300025972 | Ga0207668_10192963 | Ga0207668_101929632 | 282 |
| 46 | 3300028577 | Ga0265318_10022594 | Ga0265318_100225941 | 282 |
| 47 | 3300031240 | Ga0265320_10002298 | Ga0265320_100022982 | 283 |
| 48 | 3300031250 | Ga0265331_10081765 | Ga0265331_100817652 | 283 |
| 49 | 3300044673 | Ga0453683_0004947 | Ga0453683_0004947_430_1287 | 283 |
| 50 | 3300049592 | Ga0501076_0468356 | Ga0501076_0468356_115_966 | 283 |
| 51 | 3300005983 | Ga0081540_1057073 | Ga0081540_10570732 | 284 |
| 52 | 3300006844 | Ga0075428_100160786 | Ga0075428_1001607862 | 284 |
| 53 | 3300026121 | Ga0207683_10121380 | Ga0207683_101213802 | 284 |
| 54 | 3300031903 | Ga0307407_10133640 | Ga0307407_101336402 | 284 |
| 55 | 3300031995 | Ga0307409_100076179 | Ga0307409_1000761791 | 284 |
| 56 | 3300041413 | Ga0439465_0027400 | Ga0439465_0027400_63_1019 | 284 |
| 57 | 3300042007 | Ga0439449_0001034 | Ga0439449_0001034_9945_10802 | 284 |
| 58 | 3300048929 | Ga0496126_0260894 | Ga0496126_0260894_86_940 | 284 |
| 59 | 3300013308 | Ga0157375_10062400 | Ga0157375_100624002 | 285 |
| 60 | 3300049570 | Ga0501033_0170010 | Ga0501033_0170010_11_868 | 285 |
| 61 | 3300049578 | Ga0501042_0251791 | Ga0501042_0251791_355_1212 | 285 |
| 62 | 3300049580 | Ga0501046_0064721 | Ga0501046_0064721_1632_2489 | 285 |
| 63 | 3300049582 | Ga0501048_0046549 | Ga0501048_0046549_1770_2627 | 285 |
| 64 | 3300049589 | Ga0501073_0115147 | Ga0501073_0115147_896_1753 | 285 |
| 65 | 3300049591 | Ga0501075_0274594 | Ga0501075_0274594_380_1237 | 285 |
| 66 | 3300049741 | Ga0501079_0263011 | Ga0501079_0263011_473_1330 | 285 |
| 67 | 3300049824 | Ga0501045_0061550 | Ga0501045_0061550_1812_2669 | 285 |
| 68 | 3300054114 | Ga0501084_0347770 | Ga0501084_0347770_13_870 | 285 |
| 69 | 3300060353 | Ga0501082_0045538 | Ga0501082_0045538_1084_1941 | 285 |
| 70 | 3300061734 | Ga0530510_0420243 | Ga0530510_0420243_117_974 | 285 |
| 71 | iso_pu_bacteria | 2891968417 | 2891970562 | 285 |
| 72 | 3300025916 | Ga0207663_10073100 | Ga0207663_100731002 | 286 |
| 73 | 3300025923 | Ga0207681_10194415 | Ga0207681_101944152 | 286 |
| 74 | 3300025972 | Ga0207668_10128218 | Ga0207668_101282182 | 286 |
| 75 | 3300039062 | Ga0400483_026059 | Ga0400483_026059_264_1124 | 286 |
| 76 | 3300039062 | Ga0400483_157467 | Ga0400483_157467_3271_4131 | 286 |
| 77 | 3300005330 | Ga0070690_100040668 | Ga0070690_1000406682 | 288 |
| 78 | 3300005347 | Ga0070668_100005312 | Ga0070668_1000053124 | 288 |
| 79 | 3300005356 | Ga0070674_100039828 | Ga0070674_1000398282 | 288 |
| 80 | 3300005563 | Ga0068855_100036885 | Ga0068855_1000368851 | 288 |
| 81 | 3300005564 | Ga0070664_100403361 | Ga0070664_1004033612 | 288 |
| 82 | 3300005718 | Ga0068866_10004355 | Ga0068866_100043553 | 288 |
| 83 | 3300005842 | Ga0068858_100263410 | Ga0068858_1002634102 | 288 |
| 84 | 3300005843 | Ga0068860_100120963 | Ga0068860_1001209633 | 288 |
| 85 | 3300006048 | Ga0075363_100153674 | Ga0075363_1001536742 | 288 |
| 86 | 3300006237 | Ga0097621_100138971 | Ga0097621_1001389713 | 288 |
| 87 | 3300006353 | Ga0075370_10061525 | Ga0075370_100615253 | 288 |
| 88 | 3300006844 | Ga0075428_100286554 | Ga0075428_1002865542 | 288 |
| 89 | 3300006881 | Ga0068865_100046009 | Ga0068865_1000460092 | 288 |
| 90 | 3300009148 | Ga0105243_10031424 | Ga0105243_100314242 | 288 |
| 91 | 3300009177 | Ga0105248_10172624 | Ga0105248_101726244 | 288 |
| 92 | 3300009177 | Ga0105248_10316236 | Ga0105248_103162362 | 288 |
| 93 | 3300009553 | Ga0105249_10015170 | Ga0105249_100151705 | 288 |
| 94 | 3300013297 | Ga0157378_10005765 | Ga0157378_100057654 | 288 |
| 95 | 3300013306 | Ga0163162_10258270 | Ga0163162_102582702 | 288 |
| 96 | 3300013308 | Ga0157375_10122873 | Ga0157375_101228732 | 288 |
| 97 | 3300014325 | Ga0163163_10092884 | Ga0163163_100928844 | 288 |
| 98 | 3300014968 | Ga0157379_10053107 | Ga0157379_100531073 | 288 |
| 99 | 3300025899 | Ga0207642_10009777 | Ga0207642_100097773 | 288 |
| 100 | 3300025909 | Ga0207705_10133949 | Ga0207705_101339492 | 288 |
| 101 | 3300025934 | Ga0207686_10025028 | Ga0207686_100250283 | 288 |
| 102 | 3300025935 | Ga0207709_10011467 | Ga0207709_100114671 | 288 |
| 103 | 3300025936 | Ga0207670_10091013 | Ga0207670_100910132 | 288 |
| 104 | 3300025937 | Ga0207669_10082859 | Ga0207669_100828592 | 288 |
| 105 | 3300025938 | Ga0207704_10012489 | Ga0207704_100124893 | 288 |
| 106 | 3300025949 | Ga0207667_10070293 | Ga0207667_100702933 | 288 |
| 107 | 3300026089 | Ga0207648_10006652 | Ga0207648_100066527 | 288 |
| 108 | 3300026095 | Ga0207676_10411231 | Ga0207676_104112312 | 288 |
| 109 | 3300027907 | Ga0207428_10002647 | Ga0207428_100026478 | 288 |
| 110 | 3300028381 | Ga0268264_10097868 | Ga0268264_100978682 | 288 |
| 111 | 3300041451 | Ga0451791_1009347 | Ga0451791_1009347_208_1134 | 288 |
| 112 | 3300046477 | Ga0495664_0280233 | Ga0495664_0280233_54_920 | 288 |
| 113 | 3300048904 | Ga0496101_0032208 | Ga0496101_0032208_1720_2586 | 288 |
| 114 | 3300048906 | Ga0496103_0052292 | Ga0496103_0052292_1079_1945 | 288 |
| 115 | 3300048907 | Ga0496104_0036151 | Ga0496104_0036151_128_994 | 288 |
| 116 | 3300048907 | Ga0496104_0330088 | Ga0496104_0330088_407_1336 | 288 |
| 117 | 3300048908 | Ga0496105_0050467 | Ga0496105_0050467_1744_2673 | 288 |
| 118 | 3300048909 | Ga0496106_0018472 | Ga0496106_0018472_2204_3070 | 288 |
| 119 | 3300048909 | Ga0496106_0211833 | Ga0496106_0211833_112_1041 | 288 |
| 120 | 3300048910 | Ga0496107_0030922 | Ga0496107_0030922_1078_1944 | 288 |
| 121 | 3300048912 | Ga0496109_0024333 | Ga0496109_0024333_3191_4120 | 288 |
| 122 | 3300048913 | Ga0496110_0097562 | Ga0496110_0097562_798_1664 | 288 |
| 123 | 3300048914 | Ga0496111_0010428 | Ga0496111_0010428_1006_1872 | 288 |
| 124 | 3300048916 | Ga0496113_0092257 | Ga0496113_0092257_791_1720 | 288 |
| 125 | 3300048917 | Ga0496114_0005571 | Ga0496114_0005571_3750_4616 | 288 |
| 126 | 3300049574 | Ga0501038_0183187 | Ga0501038_0183187_72_938 | 288 |
| 127 | 3300049575 | Ga0501039_0081526 | Ga0501039_0081526_145_1011 | 288 |
| 128 | 3300049577 | Ga0501041_0217375 | Ga0501041_0217375_258_1124 | 288 |
| 129 | 3300049578 | Ga0501042_0039037 | Ga0501042_0039037_546_1412 | 288 |
| 130 | 3300049580 | Ga0501046_0056569 | Ga0501046_0056569_403_1269 | 288 |
| 131 | 3300049588 | Ga0501072_0488989 | Ga0501072_0488989_21_887 | 288 |
| 132 | 3300049592 | Ga0501076_0005549 | Ga0501076_0005549_59_925 | 288 |
| 133 | 3300049593 | Ga0501077_0049089 | Ga0501077_0049089_48_914 | 288 |
| 134 | 3300049741 | Ga0501079_0026178 | Ga0501079_0026178_2327_3193 | 288 |
| 135 | 3300049743 | Ga0501081_0004295 | Ga0501081_0004295_3422_4288 | 288 |
| 136 | 3300050491 | nmdc:mga00v17_81914_c1 | nmdc:mga00v17_81914_c1_182_1048 | 288 |
| 137 | iso_pu_bacteria | 8056054917 | 8056057345 | 288 |
| 138 | 3300006846 | Ga0075430_100147531 | Ga0075430_1001475312 | 289 |
| 139 | 3300048910 | Ga0496107_0138803 | Ga0496107_0138803_561_1481 | 289 |
| 140 | 3300049582 | Ga0501048_0034961 | Ga0501048_0034961_2035_2970 | 289 |
| 141 | 3300049587 | Ga0501071_0020602 | Ga0501071_0020602_2278_3213 | 289 |
| 142 | 3300049592 | Ga0501076_0006148 | Ga0501076_0006148_262_1197 | 289 |
| 143 | 3300049741 | Ga0501079_0215935 | Ga0501079_0215935_402_1337 | 289 |
| 144 | 3300049824 | Ga0501045_0004608 | Ga0501045_0004608_5220_6155 | 289 |
| 145 | 3300050509 | nmdc:mga0qj67_213678_c1 | nmdc:mga0qj67_213678_c1_188_1057 | 289 |
| 146 | 3300054114 | Ga0501084_0191354 | Ga0501084_0191354_17_952 | 289 |
| 147 | 3300060353 | Ga0501082_0114551 | Ga0501082_0114551_340_1275 | 289 |
| 148 | 3300046461 | Ga0495641_0066502 | Ga0495641_0066502_169_1089 | 290 |
| 149 | 3300049581 | Ga0501047_0140170 | Ga0501047_0140170_481_1437 | 290 |
| 150 | 3300049586 | Ga0501070_0010209 | Ga0501070_0010209_4706_5662 | 290 |
| 151 | 3300049590 | Ga0501074_0135673 | Ga0501074_0135673_284_1240 | 290 |
| 152 | 3300049741 | Ga0501079_0025854 | Ga0501079_0025854_587_1543 | 290 |
| 153 | 3300049742 | Ga0501080_0028590 | Ga0501080_0028590_330_1286 | 290 |
| 154 | 3300049744 | Ga0501083_0001849 | Ga0501083_0001849_8862_9818 | 290 |
| 155 | 3300009093 | Ga0105240_10007531 | Ga0105240_1000753111 | 291 |
| 156 | 3300009174 | Ga0105241_10001026 | Ga0105241_100010267 | 291 |
| 157 | 3300013104 | Ga0157370_10278306 | Ga0157370_102783061 | 291 |
| 158 | 3300025254 | Ga0209148_1000868 | Ga0209148_10008684 | 291 |
| 159 | 3300025911 | Ga0207654_10000001 | Ga0207654_10000001962 | 291 |
| 160 | 3300025913 | Ga0207695_10006733 | Ga0207695_1000673310 | 291 |
| 161 | 3300025914 | Ga0207671_10238505 | Ga0207671_102385051 | 291 |
| 162 | 3300026078 | Ga0207702_10330364 | Ga0207702_103303642 | 291 |
| 163 | 3300031730 | Ga0307516_10094526 | Ga0307516_100945262 | 291 |
| 164 | 3300049571 | Ga0501034_0044015 | Ga0501034_0044015_1817_2692 | 291 |
| 165 | 3300009147 | Ga0114129_10105395 | Ga0114129_101053954 | 292 |
| 166 | 3300031711 | Ga0265314_10001801 | Ga0265314_1000180111 | 292 |
| 167 | 3300031727 | Ga0316576_10026237 | Ga0316576_100262373 | 292 |
| 168 | 3300044673 | Ga0453683_0058063 | Ga0453683_0058063_443_1330 | 292 |
| 169 | 3300044712 | Ga0453684_0089989 | Ga0453684_0089989_1639_2526 | 292 |
| 170 | 3300047320 | Ga0495672_0150089 | Ga0495672_0150089_282_1160 | 292 |
| 171 | 3300048907 | Ga0496104_0270477 | Ga0496104_0270477_373_1335 | 292 |
| 172 | 3300049582 | Ga0501048_0204833 | Ga0501048_0204833_214_1119 | 292 |
| 173 | 3300049588 | Ga0501072_0217992 | Ga0501072_0217992_292_1197 | 292 |
| 174 | 3300009098 | Ga0105245_10294443 | Ga0105245_102944432 | 293 |
| 175 | 3300010375 | Ga0105239_10441285 | Ga0105239_104412852 | 293 |
| 176 | 3300025927 | Ga0207687_10266091 | Ga0207687_102660912 | 293 |
| 177 | 3300032126 | Ga0307415_100079171 | Ga0307415_1000791712 | 293 |
| 178 | 3300042007 | Ga0439449_0013219 | Ga0439449_0013219_777_1661 | 293 |
| 179 | 3300048911 | Ga0496108_0004832 | Ga0496108_0004832_7466_8434 | 293 |
| 180 | 3300048916 | Ga0496113_0275467 | Ga0496113_0275467_11_910 | 293 |
| 181 | 3300049584 | Ga0501068_0102063 | Ga0501068_0102063_730_1677 | 293 |
| 182 | 3300032126 | Ga0307415_100157386 | Ga0307415_1001573862 | 294 |
| 183 | 3300005445 | Ga0070708_100282186 | Ga0070708_1002821862 | 295 |
| 184 | 3300053155 | Ga0500620_000016 | Ga0500620_000016_35382_36272 | 295 |
| 185 | 3300031730 | Ga0307516_10143912 | Ga0307516_101439122 | 296 |
| 186 | 3300031903 | Ga0307407_10009079 | Ga0307407_100090794 | 296 |
| 187 | 3300031911 | Ga0307412_10029994 | Ga0307412_100299942 | 296 |
| 188 | 3300049571 | Ga0501034_0021251 | Ga0501034_0021251_5421_6365 | 296 |
| 189 | 3300049586 | Ga0501070_0120765 | Ga0501070_0120765_385_1275 | 296 |
| 190 | 3300049589 | Ga0501073_0008149 | Ga0501073_0008149_5666_6556 | 296 |
| 191 | 3300049590 | Ga0501074_0180406 | Ga0501074_0180406_127_1071 | 296 |
| 192 | 3300049742 | Ga0501080_0104322 | Ga0501080_0104322_1001_1891 | 296 |
| 193 | 3300049823 | Ga0501044_0270455 | Ga0501044_0270455_172_1116 | 296 |
| 194 | 3300050496 | nmdc:mga07m45_6304_c1 | nmdc:mga07m45_6304_c1_1304_2194 | 296 |
| 195 | 3300053080 | Ga0500635_0013383 | Ga0500635_0013383_11_901 | 296 |
| 196 | 3300053140 | Ga0500573_0000011 | Ga0500573_0000011_76015_77031 | 296 |
| 197 | 3300009148 | Ga0105243_10111442 | Ga0105243_101114422 | 297 |
| 198 | 3300021377 | Ga0213874_10005463 | Ga0213874_100054632 | 297 |
| 199 | 3300021384 | Ga0213876_10002357 | Ga0213876_100023573 | 297 |
| 200 | 3300021384 | Ga0213876_10002479 | Ga0213876_100024793 | 297 |
| 201 | 3300021388 | Ga0213875_10004993 | Ga0213875_100049932 | 297 |
| 202 | 3300028556 | Ga0265337_1003247 | Ga0265337_10032475 | 297 |
| 203 | 3300037853 | Ga0436364_0439256 | Ga0436364_0439256_4590_5537 | 297 |
| 204 | 3300039437 | Ga0436365_1029827 | Ga0436365_1029827_2862_3809 | 297 |
| 205 | 3300039437 | Ga0436365_1407609 | Ga0436365_1407609_12737_13684 | 297 |
| 206 | 3300039453 | Ga0436362_0250117 | Ga0436362_0250117_4591_5538 | 297 |
| 207 | 3300049568 | Ga0501031_0174424 | Ga0501031_0174424_123_1028 | 297 |
| 208 | 3300049580 | Ga0501046_0329269 | Ga0501046_0329269_159_1064 | 297 |
| 209 | 3300049582 | Ga0501048_0027774 | Ga0501048_0027774_3040_3945 | 297 |
| 210 | 3300049586 | Ga0501070_0115682 | Ga0501070_0115682_779_1726 | 297 |
| 211 | 3300049824 | Ga0501045_0036638 | Ga0501045_0036638_278_1183 | 297 |
| 212 | 3300060353 | Ga0501082_0094682 | Ga0501082_0094682_202_1152 | 297 |
| 213 | 3300005563 | Ga0068855_100001168 | Ga0068855_10000116810 | 298 |
| 214 | 3300009987 | Ga0105030_101153 | Ga0105030_1011532 | 298 |
| 215 | 3300025944 | Ga0207661_10045526 | Ga0207661_100455263 | 298 |
| 216 | 3300025949 | Ga0207667_10001071 | Ga0207667_1000107112 | 298 |
| 217 | 3300028563 | Ga0265319_1007002 | Ga0265319_10070023 | 298 |
| 218 | 3300032133 | Ga0316583_10020093 | Ga0316583_100200932 | 298 |
| 219 | 3300035398 | Ga0316574_0054035 | Ga0316574_0054035_11_967 | 298 |
| 220 | 3300035695 | Ga0373927_0308896 | Ga0373927_0308896_70_990 | 298 |
| 221 | 3300048912 | Ga0496109_0184610 | Ga0496109_0184610_297_1217 | 298 |
| 222 | 3300048917 | Ga0496114_0069692 | Ga0496114_0069692_54_974 | 298 |
| 223 | 3300048922 | Ga0496119_0000959 | Ga0496119_0000959_9897_10841 | 299 |
| 224 | 3300005344 | Ga0070661_100214209 | Ga0070661_1002142092 | 300 |
| 225 | 3300005466 | Ga0070685_10008452 | Ga0070685_100084523 | 300 |
| 226 | 3300005614 | Ga0068856_100048811 | Ga0068856_1000488113 | 300 |
| 227 | 3300009093 | Ga0105240_10553417 | Ga0105240_105534172 | 300 |
| 228 | 3300009094 | Ga0111539_10008475 | Ga0111539_100084756 | 300 |
| 229 | 3300009098 | Ga0105245_10043342 | Ga0105245_100433422 | 300 |
| 230 | 3300010375 | Ga0105239_10296617 | Ga0105239_102966172 | 300 |
| 231 | 3300025919 | Ga0207657_10139129 | Ga0207657_101391292 | 300 |
| 232 | 3300025920 | Ga0207649_10087598 | Ga0207649_100875982 | 300 |
| 233 | 3300025924 | Ga0207694_10000660 | Ga0207694_1000066024 | 300 |
| 234 | 3300025927 | Ga0207687_10052171 | Ga0207687_100521713 | 300 |
| 235 | 3300025949 | Ga0207667_10001561 | Ga0207667_1000156110 | 300 |
| 236 | 3300026142 | Ga0207698_10011879 | Ga0207698_100118794 | 300 |
| 237 | 3300031727 | Ga0316576_10041384 | Ga0316576_100413842 | 300 |
| 238 | 3300046471 | Ga0495650_0000508 | Ga0495650_0000508_3929_4909 | 300 |
| 239 | 3300046475 | Ga0495639_0067923 | Ga0495639_0067923_14_922 | 300 |
| 240 | 3300050511 | nmdc:mga08y16_22515_c1 | nmdc:mga08y16_22515_c1_1069_2040 | 300 |
| 241 | 3300005327 | Ga0070658_10004616 | Ga0070658_100046162 | 301 |
| 242 | 3300005338 | Ga0068868_100254617 | Ga0068868_1002546172 | 301 |
| 243 | 3300005339 | Ga0070660_100164446 | Ga0070660_1001644462 | 301 |
| 244 | 3300005366 | Ga0070659_100000996 | Ga0070659_10000099617 | 301 |
| 245 | 3300005539 | Ga0068853_100069509 | Ga0068853_1000695093 | 301 |
| 246 | 3300005577 | Ga0068857_100140429 | Ga0068857_1001404292 | 301 |
| 247 | 3300005578 | Ga0068854_100119873 | Ga0068854_1001198732 | 301 |
| 248 | 3300005617 | Ga0068859_100010767 | Ga0068859_1000107673 | 301 |
| 249 | 3300005834 | Ga0068851_10000001 | Ga0068851_1000000117 | 301 |
| 250 | 3300005842 | Ga0068858_100000016 | Ga0068858_10000001675 | 301 |
| 251 | 3300006931 | Ga0097620_100010767 | Ga0097620_1000107675 | 301 |
| 252 | 3300009093 | Ga0105240_10013972 | Ga0105240_100139722 | 301 |
| 253 | 3300009545 | Ga0105237_10001409 | Ga0105237_100014092 | 301 |
| 254 | 3300025321 | Ga0207656_10000005 | Ga0207656_10000005406 | 301 |
| 255 | 3300025909 | Ga0207705_10005737 | Ga0207705_100057373 | 301 |
| 256 | 3300025909 | Ga0207705_10007412 | Ga0207705_100074124 | 301 |
| 257 | 3300025913 | Ga0207695_10005221 | Ga0207695_1000522111 | 301 |
| 258 | 3300025914 | Ga0207671_10000016 | Ga0207671_1000001652 | 301 |
| 259 | 3300025919 | Ga0207657_10127693 | Ga0207657_101276932 | 301 |
| 260 | 3300025932 | Ga0207690_10158970 | Ga0207690_101589702 | 301 |
| 261 | 3300025981 | Ga0207640_10117279 | Ga0207640_101172792 | 301 |
| 262 | 3300025986 | Ga0207658_10043810 | Ga0207658_100438103 | 301 |
| 263 | 3300026023 | Ga0207677_10243725 | Ga0207677_102437252 | 301 |
| 264 | 3300026035 | Ga0207703_10000075 | Ga0207703_1000007511 | 301 |
| 265 | 3300026041 | Ga0207639_10078220 | Ga0207639_100782203 | 301 |
| 266 | 3300026041 | Ga0207639_10172951 | Ga0207639_101729512 | 301 |
| 267 | 3300026116 | Ga0207674_10003366 | Ga0207674_1000336614 | 301 |
| 268 | 3300013307 | Ga0157372_10691781 | Ga0157372_106917811 | 302 |
| 269 | 3300053139 | Ga0500568_0004651 | Ga0500568_0004651_5456_6388 | 302 |
| 270 | 3300005616 | Ga0068852_100399083 | Ga0068852_1003990832 | 303 |
| 271 | 3300026142 | Ga0207698_10000546 | Ga0207698_1000054616 | 303 |
| 272 | 3300035398 | Ga0316574_0132999 | Ga0316574_0132999_54_980 | 303 |
| 273 | 3300049568 | Ga0501031_0021925 | Ga0501031_0021925_1548_2489 | 303 |
| 274 | 3300049568 | Ga0501031_0141729 | Ga0501031_0141729_501_1442 | 303 |
| 275 | 3300049569 | Ga0501032_0128654 | Ga0501032_0128654_240_1181 | 303 |
| 276 | 3300049571 | Ga0501034_0199864 | Ga0501034_0199864_609_1550 | 303 |
| 277 | 3300049573 | Ga0501037_0104857 | Ga0501037_0104857_815_1756 | 303 |
| 278 | 3300049574 | Ga0501038_0038980 | Ga0501038_0038980_838_1779 | 303 |
| 279 | 3300049581 | Ga0501047_0155461 | Ga0501047_0155461_1090_2031 | 303 |
| 280 | 3300049583 | Ga0501067_0063195 | Ga0501067_0063195_778_1719 | 303 |
| 281 | 3300049586 | Ga0501070_0021140 | Ga0501070_0021140_3785_4726 | 303 |
| 282 | 3300049586 | Ga0501070_0023607 | Ga0501070_0023607_3738_4673 | 303 |
| 283 | 3300049588 | Ga0501072_0046231 | Ga0501072_0046231_366_1301 | 303 |
| 284 | 3300049589 | Ga0501073_0040007 | Ga0501073_0040007_794_1735 | 303 |
| 285 | 3300049590 | Ga0501074_0113400 | Ga0501074_0113400_282_1223 | 303 |
| 286 | 3300049742 | Ga0501080_0089022 | Ga0501080_0089022_1145_2086 | 303 |
| 287 | 3300049822 | Ga0501035_0299114 | Ga0501035_0299114_22_963 | 303 |
| 288 | 3300049823 | Ga0501044_0158662 | Ga0501044_0158662_893_1834 | 303 |
| 289 | 3300053129 | Ga0500628_029249 | Ga0500628_029249_37_963 | 303 |
| 290 | 3300005347 | Ga0070668_100507349 | Ga0070668_1005073491 | 304 |
| 291 | 3300005364 | Ga0070673_100199455 | Ga0070673_1001994552 | 304 |
| 292 | 3300005466 | Ga0070685_10020615 | Ga0070685_100206152 | 304 |
| 293 | 3300005543 | Ga0070672_100073213 | Ga0070672_1000732132 | 304 |
| 294 | 3300005564 | Ga0070664_100394791 | Ga0070664_1003947912 | 304 |
| 295 | 3300005618 | Ga0068864_100158389 | Ga0068864_1001583892 | 304 |
| 296 | 3300005719 | Ga0068861_100037646 | Ga0068861_1000376462 | 304 |
| 297 | 3300006237 | Ga0097621_100154368 | Ga0097621_1001543682 | 304 |
| 298 | 3300009177 | Ga0105248_10138941 | Ga0105248_101389412 | 304 |
| 299 | 3300013308 | Ga0157375_10026469 | Ga0157375_100264694 | 304 |
| 300 | 3300014325 | Ga0163163_10101349 | Ga0163163_101013492 | 304 |
| 301 | 3300014326 | Ga0157380_10067649 | Ga0157380_100676493 | 304 |
| 302 | 3300014969 | Ga0157376_10583244 | Ga0157376_105832441 | 304 |
| 303 | 3300025960 | Ga0207651_10156574 | Ga0207651_101565742 | 304 |
| 304 | 3300026023 | Ga0207677_10325322 | Ga0207677_103253221 | 304 |
| 305 | 3300026118 | Ga0207675_100021524 | Ga0207675_1000215245 | 304 |
| 306 | 3300035398 | Ga0316574_0136919 | Ga0316574_0136919_603_1538 | 304 |
| 307 | iso_pu_bacteria | 2856741275 | 2856744292 | 304 |
| 308 | iso_pu_bacteria | 2891395885 | 2891398984 | 304 |
| 309 | iso_pu_bacteria | 2891554331 | 2891560210 | 304 |
| 310 | iso_pu_bacteria | 2891562705 | 2891569361 | 304 |
| 311 | 3300005441 | Ga0070700_100079819 | Ga0070700_1000798191 | 305 |
| 312 | 3300005577 | Ga0068857_100234070 | Ga0068857_1002340702 | 305 |
| 313 | 3300005617 | Ga0068859_100455323 | Ga0068859_1004553231 | 305 |
| 314 | 3300006931 | Ga0097620_100455350 | Ga0097620_1004553501 | 305 |
| 315 | 3300009147 | Ga0114129_10320706 | Ga0114129_103207062 | 305 |
| 316 | 3300013296 | Ga0157374_10080805 | Ga0157374_100808053 | 305 |
| 317 | 3300013297 | Ga0157378_10159003 | Ga0157378_101590032 | 305 |
| 318 | 3300013306 | Ga0163162_10067065 | Ga0163162_100670653 | 305 |
| 319 | 3300013308 | Ga0157375_10075013 | Ga0157375_100750133 | 305 |
| 320 | 3300025922 | Ga0207646_10570567 | Ga0207646_105705671 | 305 |
| 321 | 3300025927 | Ga0207687_10035046 | Ga0207687_100350462 | 305 |
| 322 | 3300026075 | Ga0207708_10036408 | Ga0207708_100364083 | 305 |
| 323 | 3300026116 | Ga0207674_10113166 | Ga0207674_101131662 | 305 |
| 324 | 3300027907 | Ga0207428_10043589 | Ga0207428_100435893 | 305 |
| 325 | 3300031727 | Ga0316576_10021659 | Ga0316576_100216592 | 305 |
| 326 | 3300035113 | Ga0373936_0109933 | Ga0373936_0109933_155_1087 | 305 |
| 327 | 3300035398 | Ga0316574_0136126 | Ga0316574_0136126_62_997 | 305 |
| 328 | 3300035725 | Ga0373947_0042168 | Ga0373947_0042168_769_1701 | 305 |
| 329 | 3300041512 | Ga0451853_0145122 | Ga0451853_0145122_720_1649 | 305 |
| 330 | 3300047322 | Ga0495680_0327456 | Ga0495680_0327456_78_1010 | 305 |
| 331 | 3300048907 | Ga0496104_0028591 | Ga0496104_0028591_392_1321 | 305 |
| 332 | 3300048908 | Ga0496105_0012523 | Ga0496105_0012523_3805_4734 | 305 |
| 333 | 3300048911 | Ga0496108_0013658 | Ga0496108_0013658_1548_2477 | 305 |
| 334 | 3300048912 | Ga0496109_0101409 | Ga0496109_0101409_1296_2225 | 305 |
| 335 | 3300048915 | Ga0496112_0009046 | Ga0496112_0009046_1128_2057 | 305 |
| 336 | 3300048916 | Ga0496113_0002577 | Ga0496113_0002577_3245_4174 | 305 |
| 337 | 3300048917 | Ga0496114_0054316 | Ga0496114_0054316_1493_2422 | 305 |
| 338 | 3300048923 | Ga0496120_0000257 | Ga0496120_0000257_76666_77631 | 305 |
| 339 | 3300049575 | Ga0501039_0354784 | Ga0501039_0354784_186_1121 | 305 |
| 340 | 3300049580 | Ga0501046_0144716 | Ga0501046_0144716_314_1249 | 305 |
| 341 | 3300049591 | Ga0501075_0386565 | Ga0501075_0386565_94_1029 | 305 |
| 342 | 3300049741 | Ga0501079_0196667 | Ga0501079_0196667_301_1236 | 305 |
| 343 | 3300049824 | Ga0501045_0107462 | Ga0501045_0107462_578_1513 | 305 |
| 344 | 3300053085 | Ga0495619_0254926 | Ga0495619_0254926_247_1179 | 305 |
| 345 | 3300005329 | Ga0070683_100051837 | Ga0070683_1000518373 | 306 |
| 346 | 3300005338 | Ga0068868_100156643 | Ga0068868_1001566432 | 306 |
| 347 | 3300005340 | Ga0070689_100014575 | Ga0070689_1000145753 | 306 |
| 348 | 3300005341 | Ga0070691_10044518 | Ga0070691_100445182 | 306 |
| 349 | 3300005356 | Ga0070674_100007305 | Ga0070674_1000073053 | 306 |
| 350 | 3300005459 | Ga0068867_100004439 | Ga0068867_1000044393 | 306 |
| 351 | 3300005535 | Ga0070684_100090948 | Ga0070684_1000909482 | 306 |
| 352 | 3300005718 | Ga0068866_10132548 | Ga0068866_101325482 | 306 |
| 353 | 3300005840 | Ga0068870_10141315 | Ga0068870_101413152 | 306 |
| 354 | 3300006881 | Ga0068865_100034891 | Ga0068865_1000348912 | 306 |
| 355 | 3300009148 | Ga0105243_10224133 | Ga0105243_102241332 | 306 |
| 356 | 3300009176 | Ga0105242_10239554 | Ga0105242_102395542 | 306 |
| 357 | 3300014325 | Ga0163163_10051781 | Ga0163163_100517812 | 306 |
| 358 | 3300014326 | Ga0157380_10007357 | Ga0157380_100073575 | 306 |
| 359 | 3300014745 | Ga0157377_10035903 | Ga0157377_100359032 | 306 |
| 360 | 3300017792 | Ga0163161_10010643 | Ga0163161_100106435 | 306 |
| 361 | 3300025901 | Ga0207688_10111455 | Ga0207688_101114552 | 306 |
| 362 | 3300025937 | Ga0207669_10003955 | Ga0207669_100039553 | 306 |
| 363 | 3300025944 | Ga0207661_10014527 | Ga0207661_100145274 | 306 |
| 364 | 3300028380 | Ga0268265_10231085 | Ga0268265_102310852 | 306 |
| 365 | 3300041509 | Ga0451843_0930883 | Ga0451843_0930883_66_1001 | 306 |
| 366 | 3300046455 | Ga0495603_0061543 | Ga0495603_0061543_801_1739 | 306 |
| 367 | 3300046463 | Ga0495653_0128635 | Ga0495653_0128635_182_1120 | 306 |
| 368 | 3300046536 | Ga0495587_0202407 | Ga0495587_0202407_115_1053 | 306 |
| 369 | 3300047319 | Ga0495674_0234898 | Ga0495674_0234898_531_1469 | 306 |
| 370 | 3300048911 | Ga0496108_0052881 | Ga0496108_0052881_1087_2025 | 306 |
| 371 | 3300048912 | Ga0496109_0058454 | Ga0496109_0058454_2319_3254 | 306 |
| 372 | 3300048912 | Ga0496109_0106525 | Ga0496109_0106525_1354_2292 | 306 |
| 373 | 3300048915 | Ga0496112_0129549 | Ga0496112_0129549_241_1179 | 306 |
| 374 | 3300048917 | Ga0496114_0452707 | Ga0496114_0452707_127_1062 | 306 |
| 375 | 3300049582 | Ga0501048_0177462 | Ga0501048_0177462_158_1168 | 306 |
| 376 | 3300049587 | Ga0501071_0176364 | Ga0501071_0176364_436_1374 | 306 |
| 377 | 3300049587 | Ga0501071_0204996 | Ga0501071_0204996_30_968 | 306 |
| 378 | 3300049591 | Ga0501075_0079655 | Ga0501075_0079655_1197_2135 | 306 |
| 379 | 3300049592 | Ga0501076_0060775 | Ga0501076_0060775_1952_2962 | 306 |
| 380 | 3300049824 | Ga0501045_0126834 | Ga0501045_0126834_587_1597 | 306 |
| 381 | 3300049824 | Ga0501045_0155301 | Ga0501045_0155301_410_1348 | 306 |
| 382 | 3300050490 | nmdc:mga03n38_109777_c1 | nmdc:mga03n38_109777_c1_216_1247 | 306 |
| 383 | 3300050496 | nmdc:mga07m45_86225_c1 | nmdc:mga07m45_86225_c1_650_1681 | 306 |
| 384 | 3300054114 | Ga0501084_0099264 | Ga0501084_0099264_347_1285 | 306 |
| 385 | 3300061734 | Ga0530510_0003441 | Ga0530510_0003441_696_1706 | 306 |
| 386 | 3300005444 | Ga0070694_100343917 | Ga0070694_1003439172 | 307 |
| 387 | 3300005546 | Ga0070696_100054324 | Ga0070696_1000543242 | 307 |
| 388 | 3300010375 | Ga0105239_10875569 | Ga0105239_108755691 | 307 |
| 389 | 3300013307 | Ga0157372_10216401 | Ga0157372_102164012 | 307 |
| 390 | 3300014497 | Ga0182008_10009372 | Ga0182008_100093722 | 307 |
| 391 | 3300015261 | Ga0182006_1082494 | Ga0182006_10824941 | 307 |
| 392 | 3300015262 | Ga0182007_10001270 | Ga0182007_100012706 | 307 |
| 393 | 3300015265 | Ga0182005_1008073 | Ga0182005_10080732 | 307 |
| 394 | 3300025904 | Ga0207647_10010435 | Ga0207647_100104353 | 307 |
| 395 | 3300030522 | Ga0307512_10000296 | Ga0307512_1000029665 | 307 |
| 396 | 3300031616 | Ga0307508_10012227 | Ga0307508_100122275 | 307 |
| 397 | 3300031838 | Ga0307518_10149847 | Ga0307518_101498472 | 307 |
| 398 | 3300033179 | Ga0307507_10083915 | Ga0307507_100839153 | 307 |
| 399 | 3300035091 | Ga0373951_0000555 | Ga0373951_0000555_3067_4041 | 307 |
| 400 | 3300005329 | Ga0070683_100005892 | Ga0070683_1000058924 | 308 |
| 401 | 3300005336 | Ga0070680_100011523 | Ga0070680_1000115234 | 308 |
| 402 | 3300005337 | Ga0070682_100074254 | Ga0070682_1000742542 | 308 |
| 403 | 3300005339 | Ga0070660_100031511 | Ga0070660_1000315113 | 308 |
| 404 | 3300005344 | Ga0070661_100051486 | Ga0070661_1000514862 | 308 |
| 405 | 3300005366 | Ga0070659_100236302 | Ga0070659_1002363022 | 308 |
| 406 | 3300005456 | Ga0070678_100119534 | Ga0070678_1001195342 | 308 |
| 407 | 3300005458 | Ga0070681_10008736 | Ga0070681_100087362 | 308 |
| 408 | 3300005530 | Ga0070679_100059959 | Ga0070679_1000599593 | 308 |
| 409 | 3300005535 | Ga0070684_100010486 | Ga0070684_1000104862 | 308 |
| 410 | 3300005544 | Ga0070686_100098074 | Ga0070686_1000980742 | 308 |
| 411 | 3300005547 | Ga0070693_100010881 | Ga0070693_1000108812 | 308 |
| 412 | 3300005614 | Ga0068856_100391929 | Ga0068856_1003919292 | 308 |
| 413 | 3300005615 | Ga0070702_100070846 | Ga0070702_1000708462 | 308 |
| 414 | 3300006163 | Ga0070715_10068621 | Ga0070715_100686212 | 308 |
| 415 | 3300006237 | Ga0097621_100053376 | Ga0097621_1000533762 | 308 |
| 416 | 3300009098 | Ga0105245_10001472 | Ga0105245_100014724 | 308 |
| 417 | 3300009148 | Ga0105243_10033713 | Ga0105243_100337133 | 308 |
| 418 | 3300009177 | Ga0105248_10179974 | Ga0105248_101799743 | 308 |
| 419 | 3300009545 | Ga0105237_10047701 | Ga0105237_100477013 | 308 |
| 420 | 3300013296 | Ga0157374_10019965 | Ga0157374_100199652 | 308 |
| 421 | 3300013296 | Ga0157374_10392875 | Ga0157374_103928752 | 308 |
| 422 | 3300013308 | Ga0157375_10073037 | Ga0157375_100730372 | 308 |
| 423 | 3300025900 | Ga0207710_10038595 | Ga0207710_100385952 | 308 |
| 424 | 3300025905 | Ga0207685_10072940 | Ga0207685_100729402 | 308 |
| 425 | 3300025912 | Ga0207707_10011531 | Ga0207707_100115313 | 308 |
| 426 | 3300025914 | Ga0207671_10027283 | Ga0207671_100272832 | 308 |
| 427 | 3300025917 | Ga0207660_10013673 | Ga0207660_100136734 | 308 |
| 428 | 3300025919 | Ga0207657_10044681 | Ga0207657_100446813 | 308 |
| 429 | 3300025921 | Ga0207652_10021373 | Ga0207652_100213734 | 308 |
| 430 | 3300025926 | Ga0207659_10246039 | Ga0207659_102460392 | 308 |
| 431 | 3300025932 | Ga0207690_10269392 | Ga0207690_102693922 | 308 |
| 432 | 3300025934 | Ga0207686_10186836 | Ga0207686_101868362 | 308 |
| 433 | 3300025935 | Ga0207709_10080423 | Ga0207709_100804232 | 308 |
| 434 | 3300025941 | Ga0207711_10003988 | Ga0207711_100039882 | 308 |
| 435 | 3300025941 | Ga0207711_10472592 | Ga0207711_104725922 | 308 |
| 436 | 3300025944 | Ga0207661_10002823 | Ga0207661_100028236 | 308 |
| 437 | 3300026023 | Ga0207677_10051270 | Ga0207677_100512703 | 308 |
| 438 | 3300026121 | Ga0207683_10230489 | Ga0207683_102304891 | 308 |
| 439 | 3300031691 | Ga0316579_10091363 | Ga0316579_100913631 | 308 |
| 440 | 3300048903 | Ga0496100_0006441 | Ga0496100_0006441_4997_5932 | 308 |
| 441 | 3300048904 | Ga0496101_0002535 | Ga0496101_0002535_7842_8780 | 308 |
| 442 | 3300048904 | Ga0496101_0038664 | Ga0496101_0038664_2392_3327 | 308 |
| 443 | 3300048905 | Ga0496102_0001623 | Ga0496102_0001623_4304_5239 | 308 |
| 444 | 3300048907 | Ga0496104_0000254 | Ga0496104_0000254_32284_33219 | 308 |
| 445 | 3300048907 | Ga0496104_0006435 | Ga0496104_0006435_5499_6434 | 308 |
| 446 | 3300048908 | Ga0496105_0000055 | Ga0496105_0000055_51572_52507 | 308 |
| 447 | 3300048908 | Ga0496105_0227772 | Ga0496105_0227772_518_1453 | 308 |
| 448 | 3300048911 | Ga0496108_0000983 | Ga0496108_0000983_1209_2144 | 308 |
| 449 | 3300048912 | Ga0496109_0040031 | Ga0496109_0040031_1159_2094 | 308 |
| 450 | 3300048913 | Ga0496110_0000306 | Ga0496110_0000306_14782_15717 | 308 |
| 451 | 3300048914 | Ga0496111_0000092 | Ga0496111_0000092_9536_10471 | 308 |
| 452 | 3300048917 | Ga0496114_0000256 | Ga0496114_0000256_31570_32505 | 308 |
| 453 | 3300048917 | Ga0496114_0004277 | Ga0496114_0004277_5816_6751 | 308 |
| 454 | 3300048918 | Ga0496115_0018044 | Ga0496115_0018044_2414_3349 | 308 |
| 455 | 3300049583 | Ga0501067_0029347 | Ga0501067_0029347_104_1075 | 308 |
| 456 | 3300049592 | Ga0501076_0065881 | Ga0501076_0065881_1202_2146 | 308 |
| 457 | 3300050513 | nmdc:mga0rr50_279989_c1 | nmdc:mga0rr50_279989_c1_264_1202 | 308 |
| 458 | 3300006844 | Ga0075428_100480977 | Ga0075428_1004809771 | 309 |
| 459 | 3300046476 | Ga0495662_0003349 | Ga0495662_0003349_3298_4302 | 309 |
| 460 | 3300046675 | Ga0495657_0003646 | Ga0495657_0003646_2891_3895 | 309 |
| 461 | 3300046689 | Ga0495613_0006587 | Ga0495613_0006587_3429_4433 | 309 |
| 462 | 3300049587 | Ga0501071_0006580 | Ga0501071_0006580_4486_5460 | 309 |
| 463 | 3300053153 | Ga0500616_0001398 | Ga0500616_0001398_15372_16304 | 309 |
| 464 | 3300054114 | Ga0501084_0092773 | Ga0501084_0092773_600_1586 | 309 |
| 465 | 3300061734 | Ga0530510_0156941 | Ga0530510_0156941_27_974 | 309 |
| 466 | 3300049574 | Ga0501038_0373736 | Ga0501038_0373736_41_991 | 310 |
| 467 | 3300049588 | Ga0501072_0011816 | Ga0501072_0011816_5098_6048 | 310 |
| 468 | iso_pu_bacteria | 2675903060 | 2676489194 | 311 |
| 469 | 3300005327 | Ga0070658_10138652 | Ga0070658_101386522 | 312 |
| 470 | 3300005336 | Ga0070680_100105669 | Ga0070680_1001056692 | 312 |
| 471 | 3300005337 | Ga0070682_100034925 | Ga0070682_1000349252 | 312 |
| 472 | 3300005355 | Ga0070671_100067266 | Ga0070671_1000672663 | 312 |
| 473 | 3300005439 | Ga0070711_100052708 | Ga0070711_1000527082 | 312 |
| 474 | 3300005441 | Ga0070700_100233021 | Ga0070700_1002330212 | 312 |
| 475 | 3300005455 | Ga0070663_100253446 | Ga0070663_1002534461 | 312 |
| 476 | 3300005457 | Ga0070662_100026204 | Ga0070662_1000262043 | 312 |
| 477 | 3300005535 | Ga0070684_100508095 | Ga0070684_1005080951 | 312 |
| 478 | 3300005543 | Ga0070672_100230012 | Ga0070672_1002300122 | 312 |
| 479 | 3300005544 | Ga0070686_100091678 | Ga0070686_1000916782 | 312 |
| 480 | 3300005614 | Ga0068856_100069560 | Ga0068856_1000695603 | 312 |
| 481 | 3300005616 | Ga0068852_100038328 | Ga0068852_1000383282 | 312 |
| 482 | 3300005718 | Ga0068866_10069199 | Ga0068866_100691992 | 312 |
| 483 | 3300005937 | Ga0081455_10033203 | Ga0081455_100332032 | 312 |
| 484 | 3300006058 | Ga0075432_10033134 | Ga0075432_100331342 | 312 |
| 485 | 3300006237 | Ga0097621_100193896 | Ga0097621_1001938962 | 312 |
| 486 | 3300006358 | Ga0068871_100105589 | Ga0068871_1001055892 | 312 |
| 487 | 3300009094 | Ga0111539_10010318 | Ga0111539_1001031810 | 312 |
| 488 | 3300009094 | Ga0111539_10138650 | Ga0111539_101386502 | 312 |
| 489 | 3300009147 | Ga0114129_10015263 | Ga0114129_100152633 | 312 |
| 490 | 3300009148 | Ga0105243_10321395 | Ga0105243_103213952 | 312 |
| 491 | 3300009177 | Ga0105248_10436385 | Ga0105248_104363851 | 312 |
| 492 | 3300009553 | Ga0105249_10322144 | Ga0105249_103221442 | 312 |
| 493 | 3300013308 | Ga0157375_10074609 | Ga0157375_100746093 | 312 |
| 494 | 3300014745 | Ga0157377_10188500 | Ga0157377_101885002 | 312 |
| 495 | 3300014969 | Ga0157376_10285992 | Ga0157376_102859922 | 312 |
| 496 | 3300025899 | Ga0207642_10024002 | Ga0207642_100240022 | 312 |
| 497 | 3300025904 | Ga0207647_10109405 | Ga0207647_101094052 | 312 |
| 498 | 3300025908 | Ga0207643_10004234 | Ga0207643_100042345 | 312 |
| 499 | 3300025914 | Ga0207671_10105237 | Ga0207671_101052372 | 312 |
| 500 | 3300025915 | Ga0207693_10249615 | Ga0207693_102496151 | 312 |
| 501 | 3300025917 | Ga0207660_10150922 | Ga0207660_101509222 | 312 |
| 502 | 3300025919 | Ga0207657_10037185 | Ga0207657_100371852 | 312 |
| 503 | 3300025920 | Ga0207649_10226645 | Ga0207649_102266452 | 312 |
| 504 | 3300025921 | Ga0207652_10172330 | Ga0207652_101723302 | 312 |
| 505 | 3300025924 | Ga0207694_10188588 | Ga0207694_101885882 | 312 |
| 506 | 3300025927 | Ga0207687_10015934 | Ga0207687_100159344 | 312 |
| 507 | 3300025932 | Ga0207690_10129919 | Ga0207690_101299192 | 312 |
| 508 | 3300025933 | Ga0207706_10098567 | Ga0207706_100985672 | 312 |
| 509 | 3300025942 | Ga0207689_10024592 | Ga0207689_100245924 | 312 |
| 510 | 3300026041 | Ga0207639_10246144 | Ga0207639_102461442 | 312 |
| 511 | 3300026075 | Ga0207708_10017779 | Ga0207708_100177793 | 312 |
| 512 | 3300026116 | Ga0207674_10150565 | Ga0207674_101505652 | 312 |
| 513 | 3300026118 | Ga0207675_100114373 | Ga0207675_1001143732 | 312 |
| 514 | 3300026142 | Ga0207698_10043297 | Ga0207698_100432973 | 312 |
| 515 | 3300042005 | Ga0439448_0029296 | Ga0439448_0029296_446_1399 | 312 |
| 516 | 3300048909 | Ga0496106_0224660 | Ga0496106_0224660_507_1460 | 312 |
| 517 | 3300048914 | Ga0496111_0121387 | Ga0496111_0121387_830_1783 | 312 |
| 518 | 3300049572 | Ga0501036_0051443 | Ga0501036_0051443_2043_2996 | 312 |
| 519 | 3300049588 | Ga0501072_0023324 | Ga0501072_0023324_3835_4788 | 312 |
| 520 | 3300049591 | Ga0501075_0041828 | Ga0501075_0041828_330_1283 | 312 |
| 521 | 3300049592 | Ga0501076_0024689 | Ga0501076_0024689_1226_2179 | 312 |
| 522 | 3300050507 | nmdc:mga05p37_121038_c1 | nmdc:mga05p37_121038_c1_1744_2706 | 312 |
| 523 | 3300050511 | nmdc:mga08y16_2792_c1 | nmdc:mga08y16_2792_c1_7160_8113 | 312 |
| 524 | 3300028556 | Ga0265337_1028178 | Ga0265337_10281781 | 313 |
| 525 | 3300028558 | Ga0265326_10044140 | Ga0265326_100441402 | 313 |
| 526 | 3300028563 | Ga0265319_1005290 | Ga0265319_10052902 | 313 |
| 527 | 3300028577 | Ga0265318_10001224 | Ga0265318_1000122411 | 313 |
| 528 | 3300028800 | Ga0265338_10025672 | Ga0265338_100256722 | 313 |
| 529 | 3300031240 | Ga0265320_10002368 | Ga0265320_100023686 | 313 |
| 530 | 3300031247 | Ga0265340_10035273 | Ga0265340_100352732 | 313 |
| 531 | 3300031250 | Ga0265331_10082801 | Ga0265331_100828012 | 313 |
| 532 | 3300031251 | Ga0265327_10012837 | Ga0265327_100128375 | 313 |
| 533 | 3300031344 | Ga0265316_10054153 | Ga0265316_100541533 | 313 |
| 534 | 3300031711 | Ga0265314_10035890 | Ga0265314_100358904 | 313 |
| 535 | 3300046462 | Ga0495651_0251084 | Ga0495651_0251084_192_1142 | 313 |
| 536 | 3300046663 | Ga0495635_0157011 | Ga0495635_0157011_50_1000 | 313 |
| 537 | 3300046689 | Ga0495613_0060665 | Ga0495613_0060665_32_982 | 313 |
| 538 | 3300047317 | Ga0495604_0174238 | Ga0495604_0174238_489_1439 | 313 |
| 539 | 3300047319 | Ga0495674_0082029 | Ga0495674_0082029_890_1840 | 313 |
| 540 | 3300047471 | Ga0495684_0094054 | Ga0495684_0094054_522_1487 | 313 |
| 541 | 3300053085 | Ga0495619_0058017 | Ga0495619_0058017_1273_2223 | 313 |
| 542 | iso_pu_bacteria | 2643221615 | 2644089217 | 313 |
| 543 | iso_pu_bacteria | 2643221657 | 2644319062 | 313 |
| 544 | 3300006038 | Ga0075365_10090446 | Ga0075365_100904463 | 314 |
| 545 | 3300039062 | Ga0400483_018531 | Ga0400483_018531_25942_26946 | 314 |
| 546 | 3300039062 | Ga0400483_219255 | Ga0400483_219255_26369_27373 | 314 |
| 547 | 3300046455 | Ga0495603_0023426 | Ga0495603_0023426_237_1199 | 314 |
| 548 | 3300046455 | Ga0495603_0051861 | Ga0495603_0051861_357_1415 | 314 |
| 549 | 3300046461 | Ga0495641_0012847 | Ga0495641_0012847_286_1248 | 314 |
| 550 | 3300046473 | Ga0495582_0060921 | Ga0495582_0060921_961_1923 | 314 |
| 551 | 3300046794 | Ga0495589_0029796 | Ga0495589_0029796_1005_2063 | 314 |
| 552 | 3300047321 | Ga0495676_0024447 | Ga0495676_0024447_1030_2088 | 314 |
| 553 | 3300047447 | Ga0495685_020288 | Ga0495685_020288_217_1275 | 314 |
| 554 | 3300006042 | Ga0075368_10081576 | Ga0075368_100815762 | 315 |
| 555 | 3300009094 | Ga0111539_10104327 | Ga0111539_101043273 | 316 |
| 556 | 3300009147 | Ga0114129_10206513 | Ga0114129_102065132 | 316 |
| 557 | 3300031901 | Ga0307406_10008519 | Ga0307406_100085193 | 316 |
| 558 | 3300050511 | nmdc:mga08y16_183897_c1 | nmdc:mga08y16_183897_c1_644_1675 | 316 |
| 559 | 3300031731 | Ga0307405_10067763 | Ga0307405_100677632 | 317 |
| 560 | 3300031852 | Ga0307410_10118426 | Ga0307410_101184262 | 317 |
| 561 | 3300031995 | Ga0307409_100001648 | Ga0307409_1000016485 | 317 |
| 562 | 3300032004 | Ga0307414_10113423 | Ga0307414_101134232 | 317 |
| 563 | 3300032126 | Ga0307415_100005147 | Ga0307415_1000051475 | 317 |
| 564 | iso_pu_bacteria | 2643221572 | 2643877780 | 317 |
| 565 | iso_pu_bacteria | 2643221669 | 2644384835 | 317 |
| 566 | iso_pu_bacteria | 2895660088 | 2895662649 | 317 |
| 567 | iso_pu_bacteria | 2857733635 | 2857736136 | 318 |
| 568 | 3300005543 | Ga0070672_100006704 | Ga0070672_1000067043 | 319 |
| 569 | 3300014325 | Ga0163163_10018986 | Ga0163163_100189863 | 319 |
| 570 | 3300025940 | Ga0207691_10037509 | Ga0207691_100375092 | 319 |
| 571 | 3300026095 | Ga0207676_10013267 | Ga0207676_100132674 | 319 |
| 572 | 3300049571 | Ga0501034_0077004 | Ga0501034_0077004_436_1398 | 319 |
| 573 | 3300049742 | Ga0501080_0001999 | Ga0501080_0001999_15818_16780 | 319 |
| 574 | 3300049744 | Ga0501083_0036635 | Ga0501083_0036635_889_1851 | 319 |
| 575 | iso_pu_bacteria | 8003856774 | 8003861134 | 319 |
| 576 | 3300041498 | Ga0451841_0096979 | Ga0451841_0096979_935_1912 | 320 |
| 577 | 3300048908 | Ga0496105_0006658 | Ga0496105_0006658_982_1989 | 320 |
| 578 | 3300048917 | Ga0496114_0044504 | Ga0496114_0044504_1307_2314 | 320 |
| 579 | iso_pu_bacteria | 2643221649 | 2644278809 | 320 |
| 580 | iso_pu_bacteria | 2862574272 | 2862576863 | 321 |
| 581 | 3300005347 | Ga0070668_100000364 | Ga0070668_10000036410 | 322 |
| 582 | 3300005455 | Ga0070663_100071010 | Ga0070663_1000710102 | 322 |
| 583 | 3300005617 | Ga0068859_100360628 | Ga0068859_1003606282 | 322 |
| 584 | 3300006931 | Ga0097620_100360634 | Ga0097620_1003606342 | 322 |
| 585 | 3300025972 | Ga0207668_10000326 | Ga0207668_1000032616 | 322 |
| 586 | 3300026067 | Ga0207678_10007961 | Ga0207678_100079617 | 322 |
| 587 | 3300028380 | Ga0268265_10014634 | Ga0268265_100146343 | 322 |
| 588 | 3300041512 | Ga0451853_0450515 | Ga0451853_0450515_1427_2395 | 322 |
| 589 | 3300031901 | Ga0307406_10085632 | Ga0307406_100856322 | 325 |
| 590 | 3300031456 | Ga0307513_10000001 | Ga0307513_1000000139 | 326 |
| 591 | 3300053136 | Ga0500559_0000078 | Ga0500559_0000078_33362_34381 | 326 |
| 592 | iso_pu_bacteria | 2784746768 | 2785367006 | 326 |
| 593 | iso_pu_bacteria | 2808606375 | 2808918240 | 326 |
| 594 | 3300026118 | Ga0207675_100020755 | Ga0207675_1000207552 | 327 |
| 595 | 3300048091 | Ga0495626_0039886 | Ga0495626_0039886_479_1495 | 327 |
| 596 | iso_pu_bacteria | 8055172936 | 8055174484 | 327 |
| 597 | iso_pu_bacteria | 2772190715 | 2772645990 | 328 |
| 598 | iso_pu_bacteria | 2858868258 | 2858870292 | 328 |
| 599 | iso_pu_bacteria | 2880495981 | 2880501848 | 328 |
| 600 | iso_pu_bacteria | 2902582711 | 2902584524 | 328 |
| 601 | iso_pu_bacteria | 8003830390 | 8003831086 | 328 |
| 602 | iso_pu_bacteria | 8003870546 | 8003876786 | 328 |
| 603 | iso_pu_bacteria | 8055066027 | 8055067941 | 328 |
| 604 | 3300003316 | rootH1_10037110 | rootH1_100371101 | 329 |
| 605 | 3300046507 | Ga0495606_0002413 | Ga0495606_0002413_1720_2715 | 330 |
| 606 | iso_pu_bacteria | 2887478801 | 2887482806 | 330 |
| 607 | iso_pu_bacteria | 8056829672 | 8056832463 | 330 |
| 608 | 3300006844 | Ga0075428_100006054 | Ga0075428_10000605411 | 333 |
| 609 | 3300006847 | Ga0075431_100159188 | Ga0075431_1001591882 | 333 |
| 610 | 3300009147 | Ga0114129_10007883 | Ga0114129_100078834 | 333 |
| 611 | 3300050507 | nmdc:mga05p37_5351_c1 | nmdc:mga05p37_5351_c1_2222_3229 | 333 |
| 612 | 3300050508 | nmdc:mga09592_7679_c1 | nmdc:mga09592_7679_c1_1856_2863 | 333 |
| 613 | 3300050509 | nmdc:mga0qj67_16_c1 | nmdc:mga0qj67_16_c1_121461_122468 | 333 |
| 614 | 3300050510 | nmdc:mga06r32_38_c1 | nmdc:mga06r32_38_c1_2897_3904 | 333 |
| 615 | 3300009147 | Ga0114129_10156369 | Ga0114129_101563692 | 334 |
| 616 | 3300050507 | nmdc:mga05p37_126438_c1 | nmdc:mga05p37_126438_c1_154_1164 | 334 |
| 617 | 3300006844 | Ga0075428_100126928 | Ga0075428_1001269282 | 336 |
| 618 | 3300009147 | Ga0114129_10145323 | Ga0114129_101453233 | 336 |
| 619 | 3300003203 | JGI25406J46586_10002462 | JGI25406J46586_100024622 | 347 |
| 620 | 3300005985 | Ga0081539_10000135 | Ga0081539_1000013565 | 347 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
127
336
0.9
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jbw-assembly2.cif.gz_H | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.9138 | 91 | 327 |
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.9035 | 48 | 329 |
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.8912 | 48 | 329 |
| 8ja7-assembly1.cif.gz_A | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.8897 | 48 | 330 |
| 8hpl-assembly1.cif.gz_A | lpqy-sugabc in state 1 | 0.8863 | 48 | 328 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9469 | 94 | 334 | 1.10.3720.10 |
| af_P10905_52_292_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9397 | 93 | 333 | 1.10.3720.10 |
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9317 | 94 | 334 | 1.10.3720.10 |
| af_I6XFF3_60_302_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9314 | 94 | 334 | 1.10.3720.10 |
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9288 | 94 | 335 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X9PE46-F1-model_v4 | Sugar ABC transporter permease | 0.9743 | 209 | 329 |
GO:0005886
GO:0055085 |
| AF-A0A3C1QLW6-F1-model_v4 | deleted | 0.9736 | 134 | 328 |
|
| AF-A0A7W2BS02-F1-model_v4 | deleted | 0.9727 | 176 | 333 |
|
| AF-A0A7C2NL66-F1-model_v4 | Sugar ABC transporter permease | 0.9662 | 65 | 337 |
GO:0005886
GO:0055085 |
| AF-A0A0H3D816-F1-model_v4 | Permease component of ABC-type sugar transport system | 0.9655 | 63 | 331 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar