F469836

General Info

Members Datasets Scaffolds Average Seq Length
619 239 1238 475

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0054982|Ga0395900_0054982_797_2356
Length 519
Sequence MPVGDTAHRPIGWKPSDVLRVYGRRLFSDDQQDSKGLTDVVAAGKTRWFGLAVLLAVQFMVVLDIAIVNVALPSIQVDLGFSQENLQWVISAYALVFGGFMLLGGRAADLVGRRRVFLLGLVVFTTGSLLCGLAWSEASLIGARGIQGLGAAIITPAALSILTTTFQEGRERNIALGLWGAVGGFGAAAGVLMGGVLTDVFSWPWIFFVNVPVGVLAFVLTPFLLGESRDARAKSFDALGAVLVTGGLSLLVLAITQGNGWGWSSLTTIGTFAASAALLAGFVAWELRVEDPLMRFGIFRTRTVLGANITGFILGTALFAMFLMLTLYMQQVLHYSPLKTGVAYLAVAGTSIIWANVAAALVGRVGVKPLIASGMALLAVGMVLFTQLEVGGSYWLDLFPGFLIIAMGLAFCFVPISIAALAGVKPAEAGLASGLINTSQQIGGAVGIAVLSTVATTLTENEVADGTPVASAAVNGFQAAFWVGAGIALAGVVAALVFIRKDELEAAPASETVPVLDAA

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
149 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
150 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
151 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
152 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.91
Nodule 0
Rhizoplane 5.98
Rhizosphere 91.11
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0054982 3300037418 Bacteria 4098
2 ARSoilOldRDRAFT_c000510 3300000044 Bacteria 4361
3 ARCol0yngRDRAFT_1000715 3300000652 Bacteria 3275
4 JGI24738J21930_10005541 3300002075 Bacteria 3015
5 JGI25406J46586_10017224 3300003203 Bacteria 2992
6 JGI25407J50210_10000216 3300003373 Bacteria 9883
7 JGI25407J50210_10006644 3300003373 Bacteria 2887
8 Ga0070658_10004721 3300005327 Bacteria 11080
9 Ga0070658_10032817 3300005327 Bacteria 4175
10 Ga0070676_10076616 3300005328 Bacteria 2019
11 Ga0070683_100001338 3300005329 Bacteria 18785
12 Ga0070683_100039991 3300005329 Bacteria 4309
13 Ga0070670_100002300 3300005331 Bacteria 15745
14 Ga0068869_100010087 3300005334 Bacteria 6145
15 Ga0070680_100030193 3300005336 Bacteria 4354
16 Ga0070682_100025749 3300005337 Bacteria 3514
17 Ga0068868_100029894 3300005338 Bacteria 4175
18 Ga0068868_100031110 3300005338 Bacteria 4096
19 Ga0068868_100092731 3300005338 Bacteria 2434
20 Ga0068868_100132862 3300005338 Bacteria 2038
21 Ga0070660_100006111 3300005339 Bacteria 8327
22 Ga0070660_100039536 3300005339 Bacteria 3586
23 Ga0070689_100020324 3300005340 Bacteria 4925
24 Ga0070687_100065483 3300005343 Bacteria 1934
25 Ga0070692_10011838 3300005345 Bacteria 4020
26 Ga0070675_100008850 3300005354 Bacteria 7826
27 Ga0070671_100017477 3300005355 Bacteria 5810
28 Ga0070671_100046676 3300005355 Bacteria 3602
29 Ga0070674_100035659 3300005356 Bacteria 3333
30 Ga0070674_100073176 3300005356 Bacteria 2429
31 Ga0070673_100003596 3300005364 Bacteria 9687
32 Ga0070673_100047875 3300005364 Bacteria 3329
33 Ga0070688_100038465 3300005365 Bacteria 2921
34 Ga0070659_100021607 3300005366 Bacteria 4904
35 Ga0070701_10007714 3300005438 Bacteria 4617
36 Ga0070700_100000701 3300005441 Bacteria 16540
37 Ga0070694_100080156 3300005444 Bacteria 2268
38 Ga0070708_100038171 3300005445 Bacteria 4196
39 Ga0070708_100126495 3300005445 Bacteria 2363
40 Ga0070663_100037030 3300005455 Bacteria 3393
41 Ga0070678_100037886 3300005456 Bacteria 3390
42 Ga0070678_100065907 3300005456 Bacteria 2691
43 Ga0070662_100053446 3300005457 Bacteria 2924
44 Ga0070662_100109475 3300005457 Bacteria 2102
45 Ga0070681_10088471 3300005458 Bacteria 3049
46 Ga0068867_100041283 3300005459 Bacteria 3371
47 Ga0068867_100041644 3300005459 Bacteria 3356
48 Ga0068867_100048800 3300005459 Bacteria 3115
49 Ga0070685_10011116 3300005466 Bacteria 4702
50 Ga0070685_10048142 3300005466 Bacteria 2454
51 Ga0070698_100066431 3300005471 Bacteria 3630
52 Ga0070699_100037161 3300005518 Bacteria 4214
53 Ga0070679_100035781 3300005530 Bacteria 4925
54 Ga0070679_100046467 3300005530 Bacteria 4327
55 Ga0070679_100091064 3300005530 Bacteria 3037
56 Ga0070684_100058602 3300005535 Bacteria 3366
57 Ga0070684_100071040 3300005535 Bacteria 3064
58 Ga0070684_100074357 3300005535 Bacteria 2995
59 Ga0070684_100230250 3300005535 Bacteria 1692
60 Ga0068853_100038618 3300005539 Bacteria 4067
61 Ga0070672_100023829 3300005543 Bacteria 4515
62 Ga0070672_100088122 3300005543 Bacteria 2498
63 Ga0070696_100038500 3300005546 Bacteria 3300
64 Ga0070696_100131903 3300005546 Bacteria 1818
65 Ga0070693_100001952 3300005547 Bacteria 9440
66 Ga0070665_100044435 3300005548 Bacteria 4461
67 Ga0070665_100098927 3300005548 Bacteria 2921
68 Ga0070704_100048854 3300005549 Bacteria 2964
69 Ga0070704_100198524 3300005549 Bacteria 1618
70 Ga0068855_100088877 3300005563 Bacteria 3568
71 Ga0068855_100141433 3300005563 Bacteria 2742
72 Ga0070664_100051717 3300005564 Bacteria 3478
73 Ga0068857_100008583 3300005577 Bacteria 8839
74 Ga0068854_100022287 3300005578 Bacteria 4311
75 Ga0068856_100056192 3300005614 Bacteria 3883
76 Ga0068856_100058696 3300005614 Bacteria 3800
77 Ga0068856_100059531 3300005614 Bacteria 3773
78 Ga0070702_100006111 3300005615 Bacteria 5675
79 Ga0070702_100020059 3300005615 Bacteria 3496
80 Ga0068852_100001675 3300005616 Bacteria 15093
81 Ga0068852_100078602 3300005616 Bacteria 2919
82 Ga0068859_100138058 3300005617 Bacteria 2511
83 Ga0068864_100053736 3300005618 Bacteria 3475
84 Ga0068861_100056353 3300005719 Bacteria 3000
85 Ga0068861_100071335 3300005719 Bacteria 2692
86 Ga0068863_100222707 3300005841 Bacteria 1818
87 Ga0068860_100000321 3300005843 Bacteria 65077
88 Ga0068860_100056383 3300005843 Bacteria 3736
89 Ga0081455_10000030 3300005937 Bacteria 148346
90 Ga0081455_10009922 3300005937 Bacteria 9741
91 Ga0081455_10021282 3300005937 Bacteria 6086
92 Ga0081455_10025101 3300005937 Bacteria 5506
93 Ga0081455_10027567 3300005937 Bacteria 5205
94 Ga0081455_10044803 3300005937 Bacteria 3854
95 Ga0081455_10073985 3300005937 Bacteria 2815
96 Ga0081455_10079950 3300005937 Bacteria 2682
97 Ga0081455_10083833 3300005937 Bacteria 2603
98 Ga0081455_10089038 3300005937 Bacteria 2506
99 Ga0081455_10097345 3300005937 Bacteria 2371
100 Ga0081455_10101725 3300005937 Unclassified 2306
101 Ga0081538_10000076 3300005981 Bacteria 94022
102 Ga0081538_10000254 3300005981 Bacteria 60558
103 Ga0081538_10000300 3300005981 Bacteria 57016
104 Ga0081538_10000820 3300005981 Bacteria 33705
105 Ga0081538_10001484 3300005981 Bacteria 24111
106 Ga0081538_10002122 3300005981 Bacteria 19771
107 Ga0081538_10002472 3300005981 Bacteria 18043
108 Ga0081538_10005699 3300005981 Bacteria 11139
109 Ga0081538_10050462 3300005981 Bacteria 2512
110 Ga0081538_10056724 3300005981 Bacteria 2291
111 Ga0081540_1003715 3300005983 Bacteria 11960
112 Ga0081539_10000181 3300005985 Bacteria 148250
113 Ga0081539_10000552 3300005985 Bacteria 77323
114 Ga0081539_10017497 3300005985 Bacteria 5028
115 Ga0075365_10012135 3300006038 Bacteria 5101
116 Ga0075365_10012229 3300006038 Bacteria 5086
117 Ga0075365_10065637 3300006038 Bacteria 2433
118 Ga0075368_10000857 3300006042 Bacteria 9406
119 Ga0075368_10031235 3300006042 Bacteria 2064
120 Ga0075363_100003532 3300006048 Bacteria 6673
121 Ga0075363_100015158 3300006048 Bacteria 3783
122 Ga0075432_10001749 3300006058 Bacteria 7152
123 Ga0075362_10008041 3300006177 Bacteria 4018
124 Ga0075367_10042876 3300006178 Bacteria 2649
125 Ga0097621_100116025 3300006237 Bacteria 2267
126 Ga0075370_10041478 3300006353 Bacteria 2598
127 Ga0075428_100004811 3300006844 Bacteria 14973
128 Ga0075428_100037811 3300006844 Bacteria 5311
129 Ga0075428_100074029 3300006844 Bacteria 3720
130 Ga0075431_100002333 3300006847 Bacteria 18236
131 Ga0075431_100007882 3300006847 Bacteria 10612
132 Ga0075431_100192763 3300006847 Bacteria 2088
133 Ga0075434_100078907 3300006871 Bacteria 3289
134 Ga0075429_100002439 3300006880 Bacteria 15654
135 Ga0068865_100019245 3300006881 Bacteria 4417
136 Ga0068865_100029965 3300006881 Bacteria 3615
137 Ga0068865_100099136 3300006881 Bacteria 2130
138 Ga0097620_100138059 3300006931 Bacteria 2511
139 Ga0075435_100030839 3300007076 Bacteria 4219
140 Ga0105240_10262493 3300009093 Bacteria 1991
141 Ga0111539_10002716 3300009094 Bacteria 23474
142 Ga0111539_10004864 3300009094 Bacteria 17499
143 Ga0111539_10006276 3300009094 Bacteria 15347
144 Ga0111539_10021446 3300009094 Bacteria 7949
145 Ga0111539_10022713 3300009094 Bacteria 7705
146 Ga0111539_10084720 3300009094 Bacteria 3726
147 Ga0111539_10091414 3300009094 Bacteria 3575
148 Ga0105245_10012380 3300009098 Bacteria 7424
149 Ga0105245_10030117 3300009098 Bacteria 4798
150 Ga0105247_10026340 3300009101 Bacteria 3510
151 Ga0114129_10005340 3300009147 Bacteria 18132
152 Ga0114129_10052458 3300009147 Bacteria 5723
153 Ga0114129_10077804 3300009147 Bacteria 4614
154 Ga0114129_10090055 3300009147 Bacteria 4253
155 Ga0114129_10098907 3300009147 Bacteria 4038
156 Ga0114129_10125171 3300009147 Bacteria 3535
157 Ga0114129_10228419 3300009147 Bacteria 2507
158 Ga0105243_10005247 3300009148 Bacteria 10139
159 Ga0105243_10037279 3300009148 Bacteria 3777
160 Ga0105243_10047336 3300009148 Bacteria 3385
161 Ga0105243_10073192 3300009148 Bacteria 2776
162 Ga0105248_10042356 3300009177 Bacteria 5106
163 Ga0105248_10102498 3300009177 Bacteria 3226
164 Ga0105248_10109820 3300009177 Bacteria 3109
165 Ga0105248_10142677 3300009177 Bacteria 2702
166 Ga0105238_10051071 3300009551 Bacteria 4160
167 Ga0105249_10036623 3300009553 Bacteria 4451
168 Ga0105249_10042799 3300009553 Bacteria 4120
169 Ga0105239_10015425 3300010375 Bacteria 8463
170 Ga0105239_10017706 3300010375 Bacteria 7883
171 Ga0105239_10032293 3300010375 Bacteria 5754
172 Ga0105246_10019439 3300011119 Bacteria 4340
173 Ga0105246_10023536 3300011119 Bacteria 3987
174 Ga0105246_10056660 3300011119 Bacteria 2710
175 Ga0105246_10063519 3300011119 Bacteria 2576
176 Ga0157371_10067898 3300013102 Bacteria 2523
177 Ga0157369_10018281 3300013105 Bacteria 7863
178 Ga0157369_10077102 3300013105 Bacteria 3572
179 Ga0157374_10140553 3300013296 Bacteria 2344
180 Ga0163162_10045279 3300013306 Bacteria 4408
181 Ga0163162_10058502 3300013306 Bacteria 3883
182 Ga0163162_10085075 3300013306 Bacteria 3239
183 Ga0163162_10250768 3300013306 Bacteria 1902
184 Ga0157372_10032394 3300013307 Bacteria 5731
185 Ga0157375_10061066 3300013308 Bacteria 3741
186 Ga0157375_10172624 3300013308 Bacteria 2310
187 Ga0157375_10333436 3300013308 Bacteria 1682
188 Ga0163163_10015139 3300014325 Bacteria 7120
189 Ga0157380_10067759 3300014326 Bacteria 2875
190 Ga0157380_10088808 3300014326 Bacteria 2544
191 Ga0157377_10002199 3300014745 Bacteria 8573
192 Ga0157377_10006739 3300014745 Bacteria 5501
193 Ga0157377_10030613 3300014745 Bacteria 2917
194 Ga0157379_10016928 3300014968 Bacteria 6414
195 Ga0207682_10033062 3300025893 Bacteria 2081
196 Ga0207688_10000729 3300025901 Bacteria 16307
197 Ga0207688_10004570 3300025901 Bacteria 7534
198 Ga0207643_10028952 3300025908 Bacteria 3079
199 Ga0207705_10047361 3300025909 Bacteria 3091
200 Ga0207705_10087343 3300025909 Bacteria 2280
201 Ga0207707_10065588 3300025912 Bacteria 3162
202 Ga0207695_10215114 3300025913 Bacteria 1831
203 Ga0207660_10044951 3300025917 Bacteria 3109
204 Ga0207662_10021680 3300025918 Bacteria 3675
205 Ga0207662_10079959 3300025918 Bacteria 1993
206 Ga0207662_10095251 3300025918 Bacteria 1837
207 Ga0207657_10006437 3300025919 Bacteria 12173
208 Ga0207657_10021949 3300025919 Bacteria 5993
209 Ga0207657_10049289 3300025919 Bacteria 3671
210 Ga0207652_10081282 3300025921 Bacteria 2834
211 Ga0207652_10092295 3300025921 Bacteria 2663
212 Ga0207652_10097271 3300025921 Bacteria 2594
213 Ga0207650_10022888 3300025925 Bacteria 4427
214 Ga0207659_10089511 3300025926 Bacteria 2295
215 Ga0207659_10106517 3300025926 Bacteria 2123
216 Ga0207687_10009015 3300025927 Bacteria 6522
217 Ga0207687_10018343 3300025927 Bacteria 4617
218 Ga0207687_10019355 3300025927 Bacteria 4510
219 Ga0207687_10041953 3300025927 Bacteria 3145
220 Ga0207687_10043517 3300025927 Bacteria 3094
221 Ga0207687_10099906 3300025927 Bacteria 2133
222 Ga0207690_10051262 3300025932 Bacteria 2759
223 Ga0207690_10057441 3300025932 Bacteria 2629
224 Ga0207690_10085417 3300025932 Bacteria 2215
225 Ga0207706_10037400 3300025933 Bacteria 4310
226 Ga0207706_10105906 3300025933 Bacteria 2474
227 Ga0207686_10069537 3300025934 Bacteria 2259
228 Ga0207709_10022545 3300025935 Bacteria 3572
229 Ga0207669_10062387 3300025937 Bacteria 2295
230 Ga0207669_10161194 3300025937 Bacteria 1584
231 Ga0207704_10059326 3300025938 Bacteria 2361
232 Ga0207691_10019338 3300025940 Bacteria 6445
233 Ga0207691_10162084 3300025940 Bacteria 1961
234 Ga0207711_10086353 3300025941 Bacteria 2751
235 Ga0207661_10036254 3300025944 Bacteria 3848
236 Ga0207679_10016924 3300025945 Bacteria 4849
237 Ga0207667_10144319 3300025949 Bacteria 2451
238 Ga0207667_10191701 3300025949 Bacteria 2097
239 Ga0207640_10038593 3300025981 Bacteria 3016
240 Ga0207677_10047072 3300026023 Bacteria 2893
241 Ga0207677_10167610 3300026023 Bacteria 1714
242 Ga0207703_10029993 3300026035 Bacteria 4295
243 Ga0207708_10002857 3300026075 Bacteria 12714
244 Ga0207708_10003523 3300026075 Bacteria 11535
245 Ga0207702_10196585 3300026078 Bacteria 1867
246 Ga0207648_10030117 3300026089 Bacteria 4810
247 Ga0207648_10044084 3300026089 Bacteria 3914
248 Ga0207676_10079903 3300026095 Bacteria 2653
249 Ga0207674_10008596 3300026116 Bacteria 11768
250 Ga0207674_10018009 3300026116 Bacteria 7694
251 Ga0207674_10056231 3300026116 Bacteria 3997
252 Ga0207675_100003466 3300026118 Bacteria 15420
253 Ga0207683_10019827 3300026121 Bacteria 5744
254 Ga0207683_10061197 3300026121 Bacteria 3313
255 Ga0207683_10122501 3300026121 Bacteria 2335
256 Ga0207698_10163246 3300026142 Bacteria 1951
257 Ga0209813_10001849 3300027866 Bacteria 4772
258 Ga0207428_10000961 3300027907 Bacteria 31972
259 Ga0207428_10006438 3300027907 Bacteria 10844
260 Ga0207428_10017848 3300027907 Bacteria 6082
261 Ga0207428_10022243 3300027907 Bacteria 5354
262 Ga0207428_10024870 3300027907 Bacteria 5022
263 Ga0207428_10071849 3300027907 Bacteria 2717
264 Ga0207428_10123392 3300027907 Bacteria 1985
265 Ga0268266_10101953 3300028379 Bacteria 2531
266 Ga0268264_10000677 3300028381 Bacteria 39767
267 Ga0268264_10099376 3300028381 Bacteria 2525
268 Ga0307413_10028098 3300031824 Bacteria 3127
269 Ga0307410_10028116 3300031852 Bacteria 3563
270 Ga0307410_10039825 3300031852 Bacteria 3088
271 Ga0307407_10093036 3300031903 Bacteria 1853
272 Ga0307409_100085998 3300031995 Bacteria 2558
273 Ga0307409_100180608 3300031995 Bacteria 1868
274 Ga0307416_100018407 3300032002 Bacteria 4920
275 Ga0307416_100241483 3300032002 Bacteria 1751
276 Ga0307414_10092565 3300032004 Bacteria 2251
277 Ga0373960_0005042 3300035121 Bacteria 3043
278 Ga0373962_0013102 3300035242 Bacteria 2096
279 Ga0395899_0003321 3300037312 Bacteria 12748
280 Ga0395899_0003419 3300037312 Bacteria 12595
281 Ga0395899_0003587 3300037312 Bacteria 12284
282 Ga0395900_0011682 3300037418 Bacteria 8982
283 Ga0395900_0014266 3300037418 Bacteria 8110
284 Ga0395900_0020869 3300037418 Bacteria 6693
285 Ga0395900_0028547 3300037418 Bacteria 5717
286 Ga0395900_0030823 3300037418 Bacteria 5507
287 Ga0395900_0132857 3300037418 Bacteria 2550
288 Ga0395900_0186918 3300037418 Bacteria 2103
289 Ga0395900_0190200 3300037418 Bacteria 2082
290 Ga0395900_0192971 3300037418 Bacteria 2065
291 Ga0395898_0011722 3300037466 Bacteria 9088
292 Ga0395898_0016030 3300037466 Bacteria 7675
293 Ga0395898_0103119 3300037466 Bacteria 2737
294 Ga0395898_0105911 3300037466 Bacteria 2697
295 Ga0395905_0011728 3300037471 Bacteria 8461
296 Ga0395905_0014592 3300037471 Bacteria 7494
297 Ga0395905_0031126 3300037471 Bacteria 5024
298 Ga0395901_0005037 3300038443 Bacteria 13339
299 Ga0395901_0010036 3300038443 Bacteria 9601
300 Ga0395901_0011022 3300038443 Bacteria 9158
301 Ga0395901_0025405 3300038443 Bacteria 6080
302 Ga0395901_0066174 3300038443 Bacteria 3764
303 Ga0395901_0067741 3300038443 Bacteria 3718
304 Ga0395901_0078063 3300038443 Bacteria 3457
305 Ga0395901_0125972 3300038443 Bacteria 2692
306 Ga0395901_0276245 3300038443 Bacteria 1746
307 Ga0439439_0001206 3300041406 Bacteria 5002
308 Ga0439461_0005539 3300041410 Bacteria 2156
309 Ga0439433_0005094 3300041999 Bacteria 2823
310 Ga0439441_006233 3300042001 Bacteria 1884
311 Ga0450906_011788 3300042145 Bacteria 1629
312 Ga0439446_0014124 3300042156 Bacteria 2200
313 Ga0439434_0015870 3300042435 Bacteria 2246
314 Ga0466961_0015021 3300044693 Bacteria 4972
315 Ga0466963_0097798 3300044694 Bacteria 2006
316 Ga0466971_0007252 3300044719 Bacteria 4828
317 Ga0466970_0055919 3300044765 Bacteria 2108
318 Ga0466959_0039927 3300045049 Bacteria 3469
319 Ga0451576_0080518 3300045051 Bacteria 3388
320 Ga0466958_0012386 3300045836 Bacteria 4831
321 Ga0466967_0012681 3300045976 Bacteria 6467
322 Ga0466967_0027836 3300045976 Bacteria 4708
323 Ga0466967_0046340 3300045976 Bacteria 3785
324 Ga0466967_0087215 3300045976 Bacteria 2829
325 Ga0466967_0105168 3300045976 Bacteria 2585
326 Ga0495603_0013002 3300046455 Bacteria 5032
327 Ga0495641_0040921 3300046461 Bacteria 2154
328 Ga0495594_0060492 3300046499 Bacteria 2095
329 Ga0495607_0053022 3300046501 Bacteria 2346
330 Ga0495667_0129540 3300046559 Bacteria 1628
331 Ga0495588_0055807 3300046674 Bacteria 2039
332 Ga0495613_0157347 3300046689 Bacteria 1618
333 Ga0495581_0062991 3300047315 Bacteria 2143
334 Ga0496101_0023625 3300048904 Bacteria 4249
335 Ga0496101_0141739 3300048904 Bacteria 1832
336 Ga0496102_0009367 3300048905 Bacteria 8413
337 Ga0496102_0069090 3300048905 Bacteria 3243
338 Ga0496102_0070226 3300048905 Bacteria 3216
339 Ga0496102_0159021 3300048905 Bacteria 2125
340 Ga0496105_0046152 3300048908 Bacteria 3596
341 Ga0496106_0032416 3300048909 Bacteria 3895
342 Ga0496106_0067865 3300048909 Bacteria 2719
343 Ga0496107_0005976 3300048910 Bacteria 8340
344 Ga0496107_0170043 3300048910 Bacteria 1617
345 Ga0496108_0019272 3300048911 Bacteria 5600
346 Ga0496108_0023203 3300048911 Bacteria 5104
347 Ga0496108_0038987 3300048911 Bacteria 3960
348 Ga0496108_0064345 3300048911 Bacteria 3089
349 Ga0496108_0143395 3300048911 Bacteria 2058
350 Ga0496109_0004116 3300048912 Bacteria 12151
351 Ga0496109_0042898 3300048912 Bacteria 4100
352 Ga0496109_0129454 3300048912 Bacteria 2355
353 Ga0496109_0185535 3300048912 Bacteria 1954
354 Ga0496110_0003134 3300048913 Bacteria 12559
355 Ga0496110_0004680 3300048913 Bacteria 10643
356 Ga0496110_0080448 3300048913 Bacteria 2903
357 Ga0496110_0095212 3300048913 Bacteria 2666
358 Ga0496110_0111627 3300048913 Bacteria 2458
359 Ga0496111_0003150 3300048914 Bacteria 10152
360 Ga0496111_0014452 3300048914 Bacteria 5393
361 Ga0496111_0018164 3300048914 Bacteria 4869
362 Ga0496112_0111539 3300048915 Bacteria 2705
363 Ga0496113_0025067 3300048916 Bacteria 4247
364 Ga0496113_0093679 3300048916 Bacteria 2319
365 Ga0496113_0123539 3300048916 Bacteria 2026
366 Ga0496114_0025551 3300048917 Bacteria 4828
367 Ga0496114_0070430 3300048917 Bacteria 2937
368 Ga0496114_0102919 3300048917 Bacteria 2440
369 Ga0496114_0135731 3300048917 Bacteria 2127
370 Ga0496115_0113940 3300048918 Bacteria 2222
371 Ga0501311_002887 3300049527 Bacteria 1696
372 Ga0501312_006229 3300049528 Bacteria 1482
373 Ga0501318_002266 3300049534 Bacteria 1645
374 Ga0501031_0000045 3300049568 Bacteria 66639
375 Ga0501031_0002370 3300049568 Bacteria 11952
376 Ga0501031_0004351 3300049568 Bacteria 9163
377 Ga0501031_0010035 3300049568 Bacteria 6167
378 Ga0501032_0006390 3300049569 Bacteria 8679
379 Ga0501032_0021385 3300049569 Bacteria 4496
380 Ga0501033_0000194 3300049570 Bacteria 58635
381 Ga0501033_0000939 3300049570 Bacteria 26506
382 Ga0501033_0032316 3300049570 Bacteria 3931
383 Ga0501033_0070663 3300049570 Bacteria 2564
384 Ga0501033_0128967 3300049570 Bacteria 1833
385 Ga0501033_0131561 3300049570 Bacteria 1812
386 Ga0501034_0207464 3300049571 Bacteria 1915
387 Ga0501036_0000186 3300049572 Bacteria 41220
388 Ga0501036_0013015 3300049572 Bacteria 6907
389 Ga0501036_0051990 3300049572 Bacteria 3470
390 Ga0501036_0082783 3300049572 Bacteria 2712
391 Ga0501036_0101447 3300049572 Bacteria 2434
392 Ga0501037_0009224 3300049573 Bacteria 7233
393 Ga0501037_0013435 3300049573 Bacteria 6030
394 Ga0501038_0000412 3300049574 Bacteria 37074
395 Ga0501038_0001935 3300049574 Bacteria 19107
396 Ga0501038_0004512 3300049574 Bacteria 12952
397 Ga0501038_0073449 3300049574 Bacteria 2896
398 Ga0501038_0087806 3300049574 Bacteria 2611
399 Ga0501039_0000100 3300049575 Bacteria 60151
400 Ga0501039_0000364 3300049575 Bacteria 32385
401 Ga0501039_0010536 3300049575 Bacteria 7045
402 Ga0501039_0021825 3300049575 Bacteria 4912
403 Ga0501039_0090225 3300049575 Bacteria 2388
404 Ga0501039_0106713 3300049575 Bacteria 2187
405 Ga0501040_0000151 3300049576 Bacteria 38289
406 Ga0501040_0008979 3300049576 Bacteria 6501
407 Ga0501040_0012933 3300049576 Bacteria 5486
408 Ga0501040_0032145 3300049576 Bacteria 3550
409 Ga0501040_0041648 3300049576 Bacteria 3128
410 Ga0501041_0000647 3300049577 Bacteria 18264
411 Ga0501041_0001318 3300049577 Bacteria 13657
412 Ga0501041_0010736 3300049577 Bacteria 5404
413 Ga0501041_0017494 3300049577 Bacteria 4265
414 Ga0501041_0054450 3300049577 Bacteria 2440
415 Ga0501041_0072003 3300049577 Bacteria 2122
416 Ga0501042_0000021 3300049578 Bacteria 50302
417 Ga0501042_0006121 3300049578 Bacteria 7794
418 Ga0501042_0012931 3300049578 Bacteria 5669
419 Ga0501042_0036378 3300049578 Bacteria 3492
420 Ga0501042_0043855 3300049578 Bacteria 3185
421 Ga0501042_0074294 3300049578 Bacteria 2432
422 Ga0501043_0001153 3300049579 Bacteria 23223
423 Ga0501043_0001258 3300049579 Bacteria 22340
424 Ga0501043_0106272 3300049579 Bacteria 2205
425 Ga0501046_0000425 3300049580 Bacteria 42189
426 Ga0501046_0003462 3300049580 Bacteria 14484
427 Ga0501046_0020345 3300049580 Bacteria 5491
428 Ga0501046_0026745 3300049580 Bacteria 4712
429 Ga0501046_0098535 3300049580 Bacteria 2244
430 Ga0501047_0000723 3300049581 Bacteria 34341
431 Ga0501048_0000086 3300049582 Bacteria 48595
432 Ga0501048_0002423 3300049582 Bacteria 14233
433 Ga0501048_0014828 3300049582 Bacteria 5764
434 Ga0501048_0041983 3300049582 Bacteria 3276
435 Ga0501048_0048498 3300049582 Bacteria 3029
436 Ga0501048_0052876 3300049582 Bacteria 2890
437 Ga0501048_0065951 3300049582 Bacteria 2559
438 Ga0501067_0000550 3300049583 Bacteria 20334
439 Ga0501067_0094971 3300049583 Bacteria 1655
440 Ga0501067_0113965 3300049583 Bacteria 1503
441 Ga0501068_0000079 3300049584 Bacteria 39387
442 Ga0501068_0000695 3300049584 Bacteria 17241
443 Ga0501068_0000760 3300049584 Bacteria 16570
444 Ga0501068_0009916 3300049584 Bacteria 5338
445 Ga0501068_0080131 3300049584 Bacteria 2003
446 Ga0501069_0002170 3300049585 Bacteria 9880
447 Ga0501069_0002679 3300049585 Bacteria 9093
448 Ga0501069_0007635 3300049585 Bacteria 5674
449 Ga0501069_0014699 3300049585 Bacteria 4187
450 Ga0501069_0094563 3300049585 Bacteria 1691
451 Ga0501070_0003609 3300049586 Bacteria 13381
452 Ga0501070_0006696 3300049586 Bacteria 9814
453 Ga0501070_0009516 3300049586 Bacteria 8212
454 Ga0501070_0024884 3300049586 Bacteria 5020
455 Ga0501070_0050775 3300049586 Bacteria 3442
456 Ga0501070_0074896 3300049586 Bacteria 2802
457 Ga0501071_0000014 3300049587 Bacteria 60053
458 Ga0501071_0000033 3300049587 Bacteria 45630
459 Ga0501071_0001970 3300049587 Bacteria 12257
460 Ga0501071_0011242 3300049587 Bacteria 6022
461 Ga0501071_0014250 3300049587 Bacteria 5437
462 Ga0501071_0030424 3300049587 Bacteria 3818
463 Ga0501071_0034773 3300049587 Bacteria 3588
464 Ga0501071_0059048 3300049587 Bacteria 2774
465 Ga0501071_0146012 3300049587 Bacteria 1763
466 Ga0501071_0185630 3300049587 Bacteria 1559
467 Ga0501071_0194199 3300049587 Bacteria 1523
468 Ga0501072_0000351 3300049588 Bacteria 32834
469 Ga0501072_0009102 3300049588 Bacteria 7542
470 Ga0501072_0011814 3300049588 Bacteria 6670
471 Ga0501072_0018728 3300049588 Bacteria 5337
472 Ga0501072_0042770 3300049588 Bacteria 3559
473 Ga0501072_0047061 3300049588 Bacteria 3396
474 Ga0501072_0052114 3300049588 Bacteria 3221
475 Ga0501072_0055967 3300049588 Bacteria 3108
476 Ga0501072_0062050 3300049588 Bacteria 2948
477 Ga0501072_0095744 3300049588 Bacteria 2359
478 Ga0501072_0100101 3300049588 Bacteria 2304
479 Ga0501073_0000769 3300049589 Bacteria 22750
480 Ga0501073_0002039 3300049589 Bacteria 15080
481 Ga0501073_0006095 3300049589 Bacteria 8996
482 Ga0501073_0017355 3300049589 Bacteria 5213
483 Ga0501073_0111130 3300049589 Bacteria 1901
484 Ga0501073_0129703 3300049589 Bacteria 1747
485 Ga0501074_0002015 3300049590 Bacteria 13995
486 Ga0501074_0006486 3300049590 Bacteria 8450
487 Ga0501074_0009071 3300049590 Bacteria 7223
488 Ga0501074_0020796 3300049590 Bacteria 4767
489 Ga0501074_0023235 3300049590 Bacteria 4509
490 Ga0501075_0000159 3300049591 Bacteria 34415
491 Ga0501075_0000893 3300049591 Bacteria 18824
492 Ga0501075_0006036 3300049591 Bacteria 8305
493 Ga0501075_0006594 3300049591 Bacteria 7998
494 Ga0501075_0009487 3300049591 Bacteria 6810
495 Ga0501075_0011121 3300049591 Bacteria 6358
496 Ga0501075_0039944 3300049591 Bacteria 3512
497 Ga0501075_0058606 3300049591 Bacteria 2900
498 Ga0501076_0000240 3300049592 Bacteria 33579
499 Ga0501076_0003334 3300049592 Bacteria 11265
500 Ga0501076_0017668 3300049592 Bacteria 5422
501 Ga0501076_0022215 3300049592 Bacteria 4874
502 Ga0501076_0033331 3300049592 Bacteria 4021
503 Ga0501076_0053294 3300049592 Bacteria 3205
504 Ga0501076_0079279 3300049592 Bacteria 2635
505 Ga0501077_0000107 3300049593 Bacteria 43983
506 Ga0501077_0001451 3300049593 Bacteria 14287
507 Ga0501077_0003220 3300049593 Bacteria 9831
508 Ga0501077_0006550 3300049593 Bacteria 7149
509 Ga0501077_0013242 3300049593 Bacteria 5168
510 Ga0501077_0018427 3300049593 Bacteria 4418
511 Ga0501077_0029918 3300049593 Bacteria 3464
512 Ga0501077_0045937 3300049593 Bacteria 2774
513 Ga0501077_0051817 3300049593 Bacteria 2607
514 Ga0501079_0000130 3300049741 Bacteria 40553
515 Ga0501079_0000349 3300049741 Bacteria 29438
516 Ga0501079_0003907 3300049741 Bacteria 11003
517 Ga0501079_0010912 3300049741 Bacteria 6920
518 Ga0501079_0024046 3300049741 Bacteria 4673
519 Ga0501079_0053361 3300049741 Bacteria 3118
520 Ga0501079_0088292 3300049741 Bacteria 2400
521 Ga0501079_0103220 3300049741 Bacteria 2211
522 Ga0501079_0104794 3300049741 Bacteria 2194
523 Ga0501079_0112833 3300049741 Bacteria 2113
524 Ga0501080_0000771 3300049742 Bacteria 26032
525 Ga0501080_0005135 3300049742 Bacteria 11661
526 Ga0501080_0011869 3300049742 Bacteria 7980
527 Ga0501080_0019877 3300049742 Bacteria 6219
528 Ga0501080_0019964 3300049742 Bacteria 6202
529 Ga0501080_0034225 3300049742 Bacteria 4741
530 Ga0501080_0071721 3300049742 Bacteria 3221
531 Ga0501080_0120654 3300049742 Bacteria 2430
532 Ga0501080_0130209 3300049742 Bacteria 2329
533 Ga0501081_0000009 3300049743 Bacteria 70386
534 Ga0501081_0001035 3300049743 Bacteria 16639
535 Ga0501081_0025675 3300049743 Bacteria 3966
536 Ga0501081_0027260 3300049743 Bacteria 3853
537 Ga0501081_0054077 3300049743 Bacteria 2773
538 Ga0501081_0089553 3300049743 Bacteria 2162
539 Ga0501083_0000077 3300049744 Bacteria 65581
540 Ga0501083_0011179 3300049744 Bacteria 6297
541 Ga0501083_0022801 3300049744 Bacteria 4344
542 Ga0501083_0024445 3300049744 Bacteria 4185
543 Ga0501083_0031140 3300049744 Bacteria 3661
544 Ga0501035_0000298 3300049822 Bacteria 58731
545 Ga0501035_0002436 3300049822 Bacteria 18188
546 Ga0501035_0009238 3300049822 Bacteria 9167
547 Ga0501035_0059641 3300049822 Bacteria 3398
548 Ga0501035_0096756 3300049822 Bacteria 2593
549 Ga0501044_0001267 3300049823 Bacteria 29849
550 Ga0501044_0020213 3300049823 Bacteria 7107
551 Ga0501045_0000190 3300049824 Bacteria 34526
552 Ga0501045_0000191 3300049824 Bacteria 34468
553 Ga0501045_0002999 3300049824 Bacteria 11555
554 Ga0501045_0048568 3300049824 Bacteria 3093
555 Ga0501045_0071766 3300049824 Bacteria 2548
556 Ga0501045_0091011 3300049824 Bacteria 2254
557 Ga0501045_0115920 3300049824 Bacteria 1987
558 Ga0501045_0120147 3300049824 Bacteria 1951
559 nmdc:mga03n38_26599_c1 3300050490 Bacteria 2391
560 nmdc:mga00v17_45660_c1 3300050491 Bacteria 2648
561 nmdc:mga0yw44_106346_c1 3300050492 Bacteria 1793
562 nmdc:mga06z11_90063_c1 3300050494 Bacteria 1664
563 nmdc:mga04h51_3128_c1 3300050495 Bacteria 3994
564 nmdc:mga07m45_105381_c1 3300050496 Bacteria 1622
565 nmdc:mga07m45_49088_c1 3300050496 Bacteria 2375
566 nmdc:mga05p37_12773_c1 3300050507 Bacteria 10038
567 nmdc:mga05p37_179141_c1 3300050507 Bacteria 2580
568 nmdc:mga05p37_2206_c1 3300050507 Bacteria 22683
569 nmdc:mga05p37_30677_c1 3300050507 Bacteria 6560
570 nmdc:mga05p37_49607_c1 3300050507 Bacteria 5163
571 nmdc:mga05p37_5584_c1 3300050507 Bacteria 14789
572 nmdc:mga09592_25762_c1 3300050508 Bacteria 4869
573 nmdc:mga09592_459_c1 3300050508 Bacteria 30394
574 nmdc:mga09592_5585_c1 3300050508 Bacteria 10245
575 nmdc:mga0qj67_1811_c1 3300050509 Bacteria 15114
576 nmdc:mga0qj67_7180_c1 3300050509 Bacteria 8221
577 nmdc:mga06r32_1120_c1 3300050510 Bacteria 24028
578 nmdc:mga06r32_152_c1 3300050510 Bacteria 52842
579 nmdc:mga06r32_95932_c1 3300050510 Bacteria 2903
580 nmdc:mga08y16_16523_c1 3300050511 Bacteria 7764
581 nmdc:mga08y16_16867_c1 3300050511 Bacteria 7689
582 nmdc:mga08y16_44385_c1 3300050511 Bacteria 4657
583 nmdc:mga08y16_49778_c1 3300050511 Bacteria 4385
584 nmdc:mga08y16_57052_c1 3300050511 Bacteria 4082
585 nmdc:mga08y16_73868_c1 3300050511 Bacteria 3553
586 nmdc:mga08y16_823_c1 3300050511 Bacteria 29766
587 nmdc:mga08y16_93777_c1 3300050511 Bacteria 3127
588 nmdc:mga0n895_122880_c1 3300050512 Bacteria 2618
589 nmdc:mga0n895_37680_c1 3300050512 Bacteria 4679
590 nmdc:mga0n895_55564_c1 3300050512 Bacteria 3896
591 nmdc:mga0rr50_42611_c1 3300050513 Bacteria 3316
592 nmdc:mga08x19_111593_c1 3300050514 Bacteria 1824
593 nmdc:mga0a205_67507_c1 3300050515 Bacteria 3455
594 Ga0501084_0000378 3300054114 Bacteria 34200
595 Ga0501084_0009449 3300054114 Bacteria 8069
596 Ga0501084_0017955 3300054114 Bacteria 5891
597 Ga0501084_0028566 3300054114 Bacteria 4662
598 Ga0501084_0029415 3300054114 Bacteria 4595
599 Ga0501084_0047088 3300054114 Bacteria 3611
600 Ga0501084_0070414 3300054114 Bacteria 2928
601 Ga0501084_0084825 3300054114 Bacteria 2659
602 Ga0501084_0090596 3300054114 Bacteria 2567
603 Ga0501084_0126343 3300054114 Bacteria 2152
604 Ga0590074_002300 3300059423 Bacteria 3136
605 Ga0590075_003509 3300059424 Bacteria 3728
606 Ga0501082_0000426 3300060353 Bacteria 37339
607 Ga0501082_0002924 3300060353 Bacteria 14906
608 Ga0501082_0015441 3300060353 Bacteria 6572
609 Ga0501082_0017896 3300060353 Bacteria 6104
610 Ga0501082_0021466 3300060353 Bacteria 5569
611 Ga0501082_0056799 3300060353 Bacteria 3372
612 Ga0501082_0062705 3300060353 Bacteria 3200
613 Ga0501082_0092777 3300060353 Bacteria 2608
614 Ga0501082_0105066 3300060353 Bacteria 2443
615 Ga0501082_0183633 3300060353 Bacteria 1819
616 Ga0530510_0000256 3300061734 Bacteria 33416
617 Ga0530510_0004228 3300061734 Bacteria 9929
618 Ga0530510_0006298 3300061734 Bacteria 8258
619 Ga0530510_0024973 3300061734 Bacteria 4271
620 Ga0395900_0054982
621 ARSoilOldRDRAFT_c000510
622 ARCol0yngRDRAFT_1000715
623 JGI24738J21930_10005541
624 JGI25406J46586_10017224
625 JGI25407J50210_10000216
626 JGI25407J50210_10006644
627 Ga0070658_10004721
628 Ga0070658_10032817
629 Ga0070676_10076616
630 Ga0070683_100001338
631 Ga0070683_100039991
632 Ga0070670_100002300
633 Ga0068869_100010087
634 Ga0070680_100030193
635 Ga0070682_100025749
636 Ga0068868_100029894
637 Ga0068868_100031110
638 Ga0068868_100092731
639 Ga0068868_100132862
640 Ga0070660_100006111
641 Ga0070660_100039536
642 Ga0070689_100020324
643 Ga0070687_100065483
644 Ga0070692_10011838
645 Ga0070675_100008850
646 Ga0070671_100017477
647 Ga0070671_100046676
648 Ga0070674_100035659
649 Ga0070674_100073176
650 Ga0070673_100003596
651 Ga0070673_100047875
652 Ga0070688_100038465
653 Ga0070659_100021607
654 Ga0070701_10007714
655 Ga0070700_100000701
656 Ga0070694_100080156
657 Ga0070708_100038171
658 Ga0070708_100126495
659 Ga0070663_100037030
660 Ga0070678_100037886
661 Ga0070678_100065907
662 Ga0070662_100053446
663 Ga0070662_100109475
664 Ga0070681_10088471
665 Ga0068867_100041283
666 Ga0068867_100041644
667 Ga0068867_100048800
668 Ga0070685_10011116
669 Ga0070685_10048142
670 Ga0070698_100066431
671 Ga0070699_100037161
672 Ga0070679_100035781
673 Ga0070679_100046467
674 Ga0070679_100091064
675 Ga0070684_100058602
676 Ga0070684_100071040
677 Ga0070684_100074357
678 Ga0070684_100230250
679 Ga0068853_100038618
680 Ga0070672_100023829
681 Ga0070672_100088122
682 Ga0070696_100038500
683 Ga0070696_100131903
684 Ga0070693_100001952
685 Ga0070665_100044435
686 Ga0070665_100098927
687 Ga0070704_100048854
688 Ga0070704_100198524
689 Ga0068855_100088877
690 Ga0068855_100141433
691 Ga0070664_100051717
692 Ga0068857_100008583
693 Ga0068854_100022287
694 Ga0068856_100056192
695 Ga0068856_100058696
696 Ga0068856_100059531
697 Ga0070702_100006111
698 Ga0070702_100020059
699 Ga0068852_100001675
700 Ga0068852_100078602
701 Ga0068859_100138058
702 Ga0068864_100053736
703 Ga0068861_100056353
704 Ga0068861_100071335
705 Ga0068863_100222707
706 Ga0068860_100000321
707 Ga0068860_100056383
708 Ga0081455_10000030
709 Ga0081455_10009922
710 Ga0081455_10021282
711 Ga0081455_10025101
712 Ga0081455_10027567
713 Ga0081455_10044803
714 Ga0081455_10073985
715 Ga0081455_10079950
716 Ga0081455_10083833
717 Ga0081455_10089038
718 Ga0081455_10097345
719 Ga0081455_10101725
720 Ga0081538_10000076
721 Ga0081538_10000254
722 Ga0081538_10000300
723 Ga0081538_10000820
724 Ga0081538_10001484
725 Ga0081538_10002122
726 Ga0081538_10002472
727 Ga0081538_10005699
728 Ga0081538_10050462
729 Ga0081538_10056724
730 Ga0081540_1003715
731 Ga0081539_10000181
732 Ga0081539_10000552
733 Ga0081539_10017497
734 Ga0075365_10012135
735 Ga0075365_10012229
736 Ga0075365_10065637
737 Ga0075368_10000857
738 Ga0075368_10031235
739 Ga0075363_100003532
740 Ga0075363_100015158
741 Ga0075432_10001749
742 Ga0075362_10008041
743 Ga0075367_10042876
744 Ga0097621_100116025
745 Ga0075370_10041478
746 Ga0075428_100004811
747 Ga0075428_100037811
748 Ga0075428_100074029
749 Ga0075431_100002333
750 Ga0075431_100007882
751 Ga0075431_100192763
752 Ga0075434_100078907
753 Ga0075429_100002439
754 Ga0068865_100019245
755 Ga0068865_100029965
756 Ga0068865_100099136
757 Ga0097620_100138059
758 Ga0075435_100030839
759 Ga0105240_10262493
760 Ga0111539_10002716
761 Ga0111539_10004864
762 Ga0111539_10006276
763 Ga0111539_10021446
764 Ga0111539_10022713
765 Ga0111539_10084720
766 Ga0111539_10091414
767 Ga0105245_10012380
768 Ga0105245_10030117
769 Ga0105247_10026340
770 Ga0114129_10005340
771 Ga0114129_10052458
772 Ga0114129_10077804
773 Ga0114129_10090055
774 Ga0114129_10098907
775 Ga0114129_10125171
776 Ga0114129_10228419
777 Ga0105243_10005247
778 Ga0105243_10037279
779 Ga0105243_10047336
780 Ga0105243_10073192
781 Ga0105248_10042356
782 Ga0105248_10102498
783 Ga0105248_10109820
784 Ga0105248_10142677
785 Ga0105238_10051071
786 Ga0105249_10036623
787 Ga0105249_10042799
788 Ga0105239_10015425
789 Ga0105239_10017706
790 Ga0105239_10032293
791 Ga0105246_10019439
792 Ga0105246_10023536
793 Ga0105246_10056660
794 Ga0105246_10063519
795 Ga0157371_10067898
796 Ga0157369_10018281
797 Ga0157369_10077102
798 Ga0157374_10140553
799 Ga0163162_10045279
800 Ga0163162_10058502
801 Ga0163162_10085075
802 Ga0163162_10250768
803 Ga0157372_10032394
804 Ga0157375_10061066
805 Ga0157375_10172624
806 Ga0157375_10333436
807 Ga0163163_10015139
808 Ga0157380_10067759
809 Ga0157380_10088808
810 Ga0157377_10002199
811 Ga0157377_10006739
812 Ga0157377_10030613
813 Ga0157379_10016928
814 Ga0207682_10033062
815 Ga0207688_10000729
816 Ga0207688_10004570
817 Ga0207643_10028952
818 Ga0207705_10047361
819 Ga0207705_10087343
820 Ga0207707_10065588
821 Ga0207695_10215114
822 Ga0207660_10044951
823 Ga0207662_10021680
824 Ga0207662_10079959
825 Ga0207662_10095251
826 Ga0207657_10006437
827 Ga0207657_10021949
828 Ga0207657_10049289
829 Ga0207652_10081282
830 Ga0207652_10092295
831 Ga0207652_10097271
832 Ga0207650_10022888
833 Ga0207659_10089511
834 Ga0207659_10106517
835 Ga0207687_10009015
836 Ga0207687_10018343
837 Ga0207687_10019355
838 Ga0207687_10041953
839 Ga0207687_10043517
840 Ga0207687_10099906
841 Ga0207690_10051262
842 Ga0207690_10057441
843 Ga0207690_10085417
844 Ga0207706_10037400
845 Ga0207706_10105906
846 Ga0207686_10069537
847 Ga0207709_10022545
848 Ga0207669_10062387
849 Ga0207669_10161194
850 Ga0207704_10059326
851 Ga0207691_10019338
852 Ga0207691_10162084
853 Ga0207711_10086353
854 Ga0207661_10036254
855 Ga0207679_10016924
856 Ga0207667_10144319
857 Ga0207667_10191701
858 Ga0207640_10038593
859 Ga0207677_10047072
860 Ga0207677_10167610
861 Ga0207703_10029993
862 Ga0207708_10002857
863 Ga0207708_10003523
864 Ga0207702_10196585
865 Ga0207648_10030117
866 Ga0207648_10044084
867 Ga0207676_10079903
868 Ga0207674_10008596
869 Ga0207674_10018009
870 Ga0207674_10056231
871 Ga0207675_100003466
872 Ga0207683_10019827
873 Ga0207683_10061197
874 Ga0207683_10122501
875 Ga0207698_10163246
876 Ga0209813_10001849
877 Ga0207428_10000961
878 Ga0207428_10006438
879 Ga0207428_10017848
880 Ga0207428_10022243
881 Ga0207428_10024870
882 Ga0207428_10071849
883 Ga0207428_10123392
884 Ga0268266_10101953
885 Ga0268264_10000677
886 Ga0268264_10099376
887 Ga0307413_10028098
888 Ga0307410_10028116
889 Ga0307410_10039825
890 Ga0307407_10093036
891 Ga0307409_100085998
892 Ga0307409_100180608
893 Ga0307416_100018407
894 Ga0307416_100241483
895 Ga0307414_10092565
896 Ga0373960_0005042
897 Ga0373962_0013102
898 Ga0395899_0003321
899 Ga0395899_0003419
900 Ga0395899_0003587
901 Ga0395900_0011682
902 Ga0395900_0014266
903 Ga0395900_0020869
904 Ga0395900_0028547
905 Ga0395900_0030823
906 Ga0395900_0132857
907 Ga0395900_0186918
908 Ga0395900_0190200
909 Ga0395900_0192971
910 Ga0395898_0011722
911 Ga0395898_0016030
912 Ga0395898_0103119
913 Ga0395898_0105911
914 Ga0395905_0011728
915 Ga0395905_0014592
916 Ga0395905_0031126
917 Ga0395901_0005037
918 Ga0395901_0010036
919 Ga0395901_0011022
920 Ga0395901_0025405
921 Ga0395901_0066174
922 Ga0395901_0067741
923 Ga0395901_0078063
924 Ga0395901_0125972
925 Ga0395901_0276245
926 Ga0439439_0001206
927 Ga0439461_0005539
928 Ga0439433_0005094
929 Ga0439441_006233
930 Ga0450906_011788
931 Ga0439446_0014124
932 Ga0439434_0015870
933 Ga0466961_0015021
934 Ga0466963_0097798
935 Ga0466971_0007252
936 Ga0466970_0055919
937 Ga0466959_0039927
938 Ga0451576_0080518
939 Ga0466958_0012386
940 Ga0466967_0012681
941 Ga0466967_0027836
942 Ga0466967_0046340
943 Ga0466967_0087215
944 Ga0466967_0105168
945 Ga0495603_0013002
946 Ga0495641_0040921
947 Ga0495594_0060492
948 Ga0495607_0053022
949 Ga0495667_0129540
950 Ga0495588_0055807
951 Ga0495613_0157347
952 Ga0495581_0062991
953 Ga0496101_0023625
954 Ga0496101_0141739
955 Ga0496102_0009367
956 Ga0496102_0069090
957 Ga0496102_0070226
958 Ga0496102_0159021
959 Ga0496105_0046152
960 Ga0496106_0032416
961 Ga0496106_0067865
962 Ga0496107_0005976
963 Ga0496107_0170043
964 Ga0496108_0019272
965 Ga0496108_0023203
966 Ga0496108_0038987
967 Ga0496108_0064345
968 Ga0496108_0143395
969 Ga0496109_0004116
970 Ga0496109_0042898
971 Ga0496109_0129454
972 Ga0496109_0185535
973 Ga0496110_0003134
974 Ga0496110_0004680
975 Ga0496110_0080448
976 Ga0496110_0095212
977 Ga0496110_0111627
978 Ga0496111_0003150
979 Ga0496111_0014452
980 Ga0496111_0018164
981 Ga0496112_0111539
982 Ga0496113_0025067
983 Ga0496113_0093679
984 Ga0496113_0123539
985 Ga0496114_0025551
986 Ga0496114_0070430
987 Ga0496114_0102919
988 Ga0496114_0135731
989 Ga0496115_0113940
990 Ga0501311_002887
991 Ga0501312_006229
992 Ga0501318_002266
993 Ga0501031_0000045
994 Ga0501031_0002370
995 Ga0501031_0004351
996 Ga0501031_0010035
997 Ga0501032_0006390
998 Ga0501032_0021385
999 Ga0501033_0000194
1000 Ga0501033_0000939
1001 Ga0501033_0032316
1002 Ga0501033_0070663
1003 Ga0501033_0128967
1004 Ga0501033_0131561
1005 Ga0501034_0207464
1006 Ga0501036_0000186
1007 Ga0501036_0013015
1008 Ga0501036_0051990
1009 Ga0501036_0082783
1010 Ga0501036_0101447
1011 Ga0501037_0009224
1012 Ga0501037_0013435
1013 Ga0501038_0000412
1014 Ga0501038_0001935
1015 Ga0501038_0004512
1016 Ga0501038_0073449
1017 Ga0501038_0087806
1018 Ga0501039_0000100
1019 Ga0501039_0000364
1020 Ga0501039_0010536
1021 Ga0501039_0021825
1022 Ga0501039_0090225
1023 Ga0501039_0106713
1024 Ga0501040_0000151
1025 Ga0501040_0008979
1026 Ga0501040_0012933
1027 Ga0501040_0032145
1028 Ga0501040_0041648
1029 Ga0501041_0000647
1030 Ga0501041_0001318
1031 Ga0501041_0010736
1032 Ga0501041_0017494
1033 Ga0501041_0054450
1034 Ga0501041_0072003
1035 Ga0501042_0000021
1036 Ga0501042_0006121
1037 Ga0501042_0012931
1038 Ga0501042_0036378
1039 Ga0501042_0043855
1040 Ga0501042_0074294
1041 Ga0501043_0001153
1042 Ga0501043_0001258
1043 Ga0501043_0106272
1044 Ga0501046_0000425
1045 Ga0501046_0003462
1046 Ga0501046_0020345
1047 Ga0501046_0026745
1048 Ga0501046_0098535
1049 Ga0501047_0000723
1050 Ga0501048_0000086
1051 Ga0501048_0002423
1052 Ga0501048_0014828
1053 Ga0501048_0041983
1054 Ga0501048_0048498
1055 Ga0501048_0052876
1056 Ga0501048_0065951
1057 Ga0501067_0000550
1058 Ga0501067_0094971
1059 Ga0501067_0113965
1060 Ga0501068_0000079
1061 Ga0501068_0000695
1062 Ga0501068_0000760
1063 Ga0501068_0009916
1064 Ga0501068_0080131
1065 Ga0501069_0002170
1066 Ga0501069_0002679
1067 Ga0501069_0007635
1068 Ga0501069_0014699
1069 Ga0501069_0094563
1070 Ga0501070_0003609
1071 Ga0501070_0006696
1072 Ga0501070_0009516
1073 Ga0501070_0024884
1074 Ga0501070_0050775
1075 Ga0501070_0074896
1076 Ga0501071_0000014
1077 Ga0501071_0000033
1078 Ga0501071_0001970
1079 Ga0501071_0011242
1080 Ga0501071_0014250
1081 Ga0501071_0030424
1082 Ga0501071_0034773
1083 Ga0501071_0059048
1084 Ga0501071_0146012
1085 Ga0501071_0185630
1086 Ga0501071_0194199
1087 Ga0501072_0000351
1088 Ga0501072_0009102
1089 Ga0501072_0011814
1090 Ga0501072_0018728
1091 Ga0501072_0042770
1092 Ga0501072_0047061
1093 Ga0501072_0052114
1094 Ga0501072_0055967
1095 Ga0501072_0062050
1096 Ga0501072_0095744
1097 Ga0501072_0100101
1098 Ga0501073_0000769
1099 Ga0501073_0002039
1100 Ga0501073_0006095
1101 Ga0501073_0017355
1102 Ga0501073_0111130
1103 Ga0501073_0129703
1104 Ga0501074_0002015
1105 Ga0501074_0006486
1106 Ga0501074_0009071
1107 Ga0501074_0020796
1108 Ga0501074_0023235
1109 Ga0501075_0000159
1110 Ga0501075_0000893
1111 Ga0501075_0006036
1112 Ga0501075_0006594
1113 Ga0501075_0009487
1114 Ga0501075_0011121
1115 Ga0501075_0039944
1116 Ga0501075_0058606
1117 Ga0501076_0000240
1118 Ga0501076_0003334
1119 Ga0501076_0017668
1120 Ga0501076_0022215
1121 Ga0501076_0033331
1122 Ga0501076_0053294
1123 Ga0501076_0079279
1124 Ga0501077_0000107
1125 Ga0501077_0001451
1126 Ga0501077_0003220
1127 Ga0501077_0006550
1128 Ga0501077_0013242
1129 Ga0501077_0018427
1130 Ga0501077_0029918
1131 Ga0501077_0045937
1132 Ga0501077_0051817
1133 Ga0501079_0000130
1134 Ga0501079_0000349
1135 Ga0501079_0003907
1136 Ga0501079_0010912
1137 Ga0501079_0024046
1138 Ga0501079_0053361
1139 Ga0501079_0088292
1140 Ga0501079_0103220
1141 Ga0501079_0104794
1142 Ga0501079_0112833
1143 Ga0501080_0000771
1144 Ga0501080_0005135
1145 Ga0501080_0011869
1146 Ga0501080_0019877
1147 Ga0501080_0019964
1148 Ga0501080_0034225
1149 Ga0501080_0071721
1150 Ga0501080_0120654
1151 Ga0501080_0130209
1152 Ga0501081_0000009
1153 Ga0501081_0001035
1154 Ga0501081_0025675
1155 Ga0501081_0027260
1156 Ga0501081_0054077
1157 Ga0501081_0089553
1158 Ga0501083_0000077
1159 Ga0501083_0011179
1160 Ga0501083_0022801
1161 Ga0501083_0024445
1162 Ga0501083_0031140
1163 Ga0501035_0000298
1164 Ga0501035_0002436
1165 Ga0501035_0009238
1166 Ga0501035_0059641
1167 Ga0501035_0096756
1168 Ga0501044_0001267
1169 Ga0501044_0020213
1170 Ga0501045_0000190
1171 Ga0501045_0000191
1172 Ga0501045_0002999
1173 Ga0501045_0048568
1174 Ga0501045_0071766
1175 Ga0501045_0091011
1176 Ga0501045_0115920
1177 Ga0501045_0120147
1178 nmdc:mga03n38_26599_c1
1179 nmdc:mga00v17_45660_c1
1180 nmdc:mga0yw44_106346_c1
1181 nmdc:mga06z11_90063_c1
1182 nmdc:mga04h51_3128_c1
1183 nmdc:mga07m45_105381_c1
1184 nmdc:mga07m45_49088_c1
1185 nmdc:mga05p37_12773_c1
1186 nmdc:mga05p37_179141_c1
1187 nmdc:mga05p37_2206_c1
1188 nmdc:mga05p37_30677_c1
1189 nmdc:mga05p37_49607_c1
1190 nmdc:mga05p37_5584_c1
1191 nmdc:mga09592_25762_c1
1192 nmdc:mga09592_459_c1
1193 nmdc:mga09592_5585_c1
1194 nmdc:mga0qj67_1811_c1
1195 nmdc:mga0qj67_7180_c1
1196 nmdc:mga06r32_1120_c1
1197 nmdc:mga06r32_152_c1
1198 nmdc:mga06r32_95932_c1
1199 nmdc:mga08y16_16523_c1
1200 nmdc:mga08y16_16867_c1
1201 nmdc:mga08y16_44385_c1
1202 nmdc:mga08y16_49778_c1
1203 nmdc:mga08y16_57052_c1
1204 nmdc:mga08y16_73868_c1
1205 nmdc:mga08y16_823_c1
1206 nmdc:mga08y16_93777_c1
1207 nmdc:mga0n895_122880_c1
1208 nmdc:mga0n895_37680_c1
1209 nmdc:mga0n895_55564_c1
1210 nmdc:mga0rr50_42611_c1
1211 nmdc:mga08x19_111593_c1
1212 nmdc:mga0a205_67507_c1
1213 Ga0501084_0000378
1214 Ga0501084_0009449
1215 Ga0501084_0017955
1216 Ga0501084_0028566
1217 Ga0501084_0029415
1218 Ga0501084_0047088
1219 Ga0501084_0070414
1220 Ga0501084_0084825
1221 Ga0501084_0090596
1222 Ga0501084_0126343
1223 Ga0590074_002300
1224 Ga0590075_003509
1225 Ga0501082_0000426
1226 Ga0501082_0002924
1227 Ga0501082_0015441
1228 Ga0501082_0017896
1229 Ga0501082_0021466
1230 Ga0501082_0056799
1231 Ga0501082_0062705
1232 Ga0501082_0092777
1233 Ga0501082_0105066
1234 Ga0501082_0183633
1235 Ga0530510_0000256
1236 Ga0530510_0004228
1237 Ga0530510_0006298
1238 Ga0530510_0024973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

54

448

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.8531 4 457
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.8471 4 457
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8457 9 462
8ex4-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1) 0.8441 7 477
6oom-assembly2.cif.gz_A-2 protein a 0.8439 5 457
ID Description Score Start End Superfamily
af_O69695_42_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.968 12 204 1.20.1250.20
af_P9WJY5_55_296_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9666 14 255 1.20.1250.20
af_P9WJW9_9_219_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9655 13 221 1.20.1250.20
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9608 10 199 1.20.1250.20
af_P9WJY5_55_296_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9549 14 255 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1Y2GL01-F1-model_v4 Major facilitator superfamily domain-containing protein 0.9591 21 396 GO:0016020
GO:0022857
AF-A0A3N5M6P9-F1-model_v4 DHA2 family efflux MFS transporter permease subunit 0.9584 6 396 GO:0005886
GO:0022857
AF-A0A7A3BRB6-F1-model_v4 Multidrug efflux MFS transporter 0.9484 4 121 GO:0005886
GO:0022857
AF-A0A1Y2GL01-F1-model_v4 Major facilitator superfamily domain-containing protein 0.9444 21 396 GO:0016020
GO:0022857
AF-A0A6I1JCH0-F1-model_v4 deleted 0.9341 3 168

Map