F469823

General Info

Members Datasets Scaffolds Average Seq Length
619 520 1238 126

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_11448875|Ga0207707_114488752
Length 148
Sequence VALARRRADAARRTGHGVTPGICLVAGALNVFVPATTFTLAWMHSIEKIRWEEDYAVRAGGLDLLEARIRGTGAGMEPPEGARLDAQGVWHYTPQVQRVPQLSLARSTYTRDYELCIDGRCRPLADYVPVAAGTTAVSPCEGSPASAQ

Samples

Sample ID Description Type Environment
1 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
64 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
65 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
106 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
107 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
113 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
116 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
117 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
146 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
147 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
148 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
149 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
150 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
151 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
152 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
217 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
236 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
254 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
255 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
256 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
257 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
258 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
259 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
260 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
261 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
262 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
263 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
264 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
265 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
271 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
272 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
273 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
274 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
275 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
276 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
277 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
278 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
279 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
280 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
281 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
282 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
283 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
284 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
285 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
286 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
287 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
288 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
289 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
290 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
291 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
292 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
293 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
294 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
295 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
296 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
297 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
298 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
299 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
300 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
301 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
302 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
303 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
304 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
305 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
306 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
307 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
308 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
309 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
310 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
311 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
312 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
313 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
314 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
315 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
316 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
317 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
318 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
319 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
320 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
321 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
322 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
323 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
324 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
325 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
326 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
327 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
328 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
329 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
330 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
331 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
332 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
333 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
334 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
335 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
336 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
337 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
338 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
339 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
340 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
341 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
342 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
343 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
344 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
345 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
346 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
347 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
348 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
349 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
350 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
351 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
352 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
353 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
354 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
355 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
356 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
357 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
358 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
359 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
360 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
361 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
362 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
363 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
364 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
365 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
366 2906610324
367 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
368 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
369 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
370 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
371 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
372 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
373 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
374 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
375 2922425934
376 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
377 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
378 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
379 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
380 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
381 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
382 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
383 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
384 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
385 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
386 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
387 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
388 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
389 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
390 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
391 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
392 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
393 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
394 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
395 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
396 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
397 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
398 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
399 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
400 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
401 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
402 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
403 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
404 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
405 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
406 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
407 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
408 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
409 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
410 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
411 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
412 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
413 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
414 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
415 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
416 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
417 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
418 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
419 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
420 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
421 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
422 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
423 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
424 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
425 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
426 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
427 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
428 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
429 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
430 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
431 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
432 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
433 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
434 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
435 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
436 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
437 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
438 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
439 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
440 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
441 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
442 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
443 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
444 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
445 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
446 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
447 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
448 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
449 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
450 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
451 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
452 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
453 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
454 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
455 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
456 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
457 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
458 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
459 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
460 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
461 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
462 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
463 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
464 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
465 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
466 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
467 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
468 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
469 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
470 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
471 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
472 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
473 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
474 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
475 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
476 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
477 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
478 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
479 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
480 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
481 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
482 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
483 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
484 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
485 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
486 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
487 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
488 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
489 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
490 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
491 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
492 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
493 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
494 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
495 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
496 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
497 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
498 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
499 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
500 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
501 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
502 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
503 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
504 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
505 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
506 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
507 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
508 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
509 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
510 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
511 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
512 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
513 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
514 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
515 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
516 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
517 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
518 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
519 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
520 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 61.75
Metatranscriptomes 0
Isolates 38.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.69
Nodule 34.57
Rhizoplane 4.2
Rhizosphere 41.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207707_11448875 3300025912 Bacteria 546
2 rootH1_10144661 3300003323 Bacteria 1441
3 Ga0065165_1001041 3300005262 Bacteria 33474
4 Ga0070658_10018017 3300005327 Bacteria 5647
5 Ga0070658_10030640 3300005327 Bacteria 4321
6 Ga0070683_101895353 3300005329 Bacteria 573
7 Ga0070680_100030013 3300005336 Bacteria 4366
8 Ga0070660_100725799 3300005339 Bacteria 834
9 Ga0070661_100344242 3300005344 Bacteria 1168
10 Ga0070668_100524139 3300005347 Bacteria 1028
11 Ga0070668_100790348 3300005347 Bacteria 842
12 Ga0070669_100193984 3300005353 Bacteria 1594
13 Ga0070659_100066374 3300005366 Bacteria 2859
14 Ga0070713_100028092 3300005436 Bacteria 4439
15 Ga0070710_10225648 3300005437 Bacteria 1194
16 Ga0070711_100022015 3300005439 Bacteria 4126
17 Ga0070711_100610526 3300005439 Bacteria 911
18 Ga0070700_100334122 3300005441 Bacteria 1118
19 Ga0070663_100268102 3300005455 Bacteria 1356
20 Ga0070678_101829298 3300005456 Bacteria 573
21 Ga0070662_100002547 3300005457 Bacteria 11222
22 Ga0070662_101782438 3300005457 Bacteria 532
23 Ga0070706_100711795 3300005467 Bacteria 931
24 Ga0070707_100218310 3300005468 Bacteria 1858
25 Ga0070698_100129432 3300005471 Bacteria 2480
26 Ga0070679_100289005 3300005530 Bacteria 1591
27 Ga0070679_100309591 3300005530 Bacteria 1529
28 Ga0068853_100927780 3300005539 Bacteria 837
29 Ga0070672_100544989 3300005543 Bacteria 1007
30 Ga0070696_101628753 3300005546 Bacteria 555
31 Ga0070693_100046844 3300005547 Bacteria 2457
32 Ga0070665_100010585 3300005548 Bacteria 9338
33 Ga0068854_100579855 3300005578 Bacteria 955
34 Ga0068854_100699552 3300005578 Bacteria 875
35 Ga0068856_100000281 3300005614 Bacteria 55460
36 Ga0068856_100043126 3300005614 Bacteria 4439
37 Ga0068856_100127672 3300005614 Bacteria 2546
38 Ga0068856_100359534 3300005614 Bacteria 1474
39 Ga0070702_100217016 3300005615 Bacteria 1277
40 Ga0070702_101174329 3300005615 Bacteria 617
41 Ga0068852_100009648 3300005616 Bacteria 7170
42 Ga0068852_100516311 3300005616 Bacteria 1192
43 Ga0068852_101790262 3300005616 Bacteria 637
44 Ga0068866_10583988 3300005718 Bacteria 752
45 Ga0068861_100061173 3300005719 Bacteria 2889
46 Ga0068851_10382500 3300005834 Bacteria 825
47 Ga0068858_102041804 3300005842 Bacteria 567
48 Ga0068860_100392493 3300005843 Bacteria 1371
49 Ga0075365_10108590 3300006038 Bacteria 1905
50 Ga0075368_10287726 3300006042 Bacteria 707
51 Ga0075363_100862948 3300006048 Bacteria 553
52 Ga0075364_10068596 3300006051 Bacteria 2332
53 Ga0070715_10321052 3300006163 Bacteria 836
54 Ga0075367_10339246 3300006178 Bacteria 948
55 Ga0075369_10092654 3300006186 Bacteria 1350
56 Ga0075369_10156044 3300006186 Bacteria 1045
57 Ga0099795_10248209 3300007788 Bacteria 767
58 Ga0105250_10129057 3300009092 Bacteria 1043
59 Ga0105240_11015923 3300009093 Bacteria 886
60 Ga0105240_11027244 3300009093 Bacteria 880
61 Ga0105245_11562343 3300009098 Bacteria 711
62 Ga0105247_10094141 3300009101 Bacteria 1905
63 Ga0105242_10878852 3300009176 Bacteria 894
64 Ga0105248_11360074 3300009177 Bacteria 803
65 Ga0105237_10465949 3300009545 Bacteria 1270
66 Ga0105237_10801766 3300009545 Bacteria 948
67 Ga0105238_10621725 3300009551 Bacteria 1089
68 Ga0105249_10973386 3300009553 Bacteria 917
69 Ga0105239_10544161 3300010375 Bacteria 1322
70 Ga0105239_11739654 3300010375 Bacteria 722
71 Ga0105239_11862571 3300010375 Bacteria 697
72 Ga0105246_10118605 3300011119 Bacteria 1957
73 Ga0105246_11630589 3300011119 Bacteria 611
74 Ga0157369_10351267 3300013105 Bacteria 1531
75 Ga0157378_10478524 3300013297 Bacteria 1240
76 Ga0157378_10925272 3300013297 Bacteria 904
77 Ga0163162_10413281 3300013306 Bacteria 1481
78 Ga0163162_10909703 3300013306 Bacteria 993
79 Ga0157375_10054545 3300013308 Bacteria 3937
80 Ga0157380_11539317 3300014326 Bacteria 719
81 Ga0182008_10443527 3300014497 Bacteria 704
82 Ga0163161_10163037 3300017792 Bacteria 1701
83 Ga0163161_10855366 3300017792 Bacteria 768
84 Ga0214542_1000007 3300021321 Bacteria 291816
85 Ga0214545_1000006 3300021324 Bacteria 291693
86 Ga0214543_1000009 3300021327 Bacteria 384302
87 Ga0209233_1003124 3300025261 Bacteria 5887
88 Ga0209758_1007632 3300025297 Bacteria 7295
89 Ga0209758_1071198 3300025297 Bacteria 1093
90 Ga0207426_1003913 3300025302 Bacteria 7643
91 Ga0207692_10515573 3300025898 Bacteria 760
92 Ga0207710_10175596 3300025900 Bacteria 1049
93 Ga0207647_10051789 3300025904 Bacteria 2536
94 Ga0207685_10194463 3300025905 Bacteria 949
95 Ga0207685_10760825 3300025905 Bacteria 531
96 Ga0207699_10672601 3300025906 Bacteria 757
97 Ga0207645_10482062 3300025907 Bacteria 839
98 Ga0207705_10010125 3300025909 Bacteria 6863
99 Ga0207684_10500980 3300025910 Bacteria 1041
100 Ga0207671_10234039 3300025914 Bacteria 1442
101 Ga0207663_10398794 3300025916 Bacteria 1052
102 Ga0207660_10342319 3300025917 Bacteria 1197
103 Ga0207657_10188400 3300025919 Bacteria 1665
104 Ga0207652_10049060 3300025921 Bacteria 3612
105 Ga0207652_10670768 3300025921 Bacteria 926
106 Ga0207646_10189271 3300025922 Bacteria 1859
107 Ga0207687_10653919 3300025927 Bacteria 889
108 Ga0207700_10040261 3300025928 Bacteria 3409
109 Ga0207690_10229466 3300025932 Bacteria 1424
110 Ga0207706_10003036 3300025933 Bacteria 16180
111 Ga0207686_10483305 3300025934 Bacteria 958
112 Ga0207669_10634033 3300025937 Bacteria 872
113 Ga0207704_10870726 3300025938 Bacteria 756
114 Ga0207689_10257342 3300025942 Bacteria 1444
115 Ga0207667_10018100 3300025949 Bacteria 7909
116 Ga0207651_10188861 3300025960 Bacteria 1642
117 Ga0207668_10599295 3300025972 Bacteria 959
118 Ga0207640_10131249 3300025981 Bacteria 1811
119 Ga0207640_10327203 3300025981 Bacteria 1222
120 Ga0207640_11779318 3300025981 Bacteria 557
121 Ga0207658_10404233 3300025986 Bacteria 1201
122 Ga0207639_11231308 3300026041 Bacteria 702
123 Ga0207678_10131526 3300026067 Bacteria 2135
124 Ga0207708_10084828 3300026075 Bacteria 2436
125 Ga0207702_10000065 3300026078 Bacteria 119449
126 Ga0207702_10112970 3300026078 Bacteria 2418
127 Ga0207702_10160990 3300026078 Bacteria 2050
128 Ga0207641_10683595 3300026088 Bacteria 1010
129 Ga0207648_10609213 3300026089 Bacteria 1007
130 Ga0207675_100119935 3300026118 Bacteria 2488
131 Ga0207683_10136989 3300026121 Bacteria 2204
132 Ga0207698_10074506 3300026142 Bacteria 2708
133 Ga0207698_10310517 3300026142 Bacteria 1472
134 Ga0207698_11114787 3300026142 Bacteria 802
135 Ga0207698_11367129 3300026142 Bacteria 723
136 Ga0209389_1000052 3300027296 Bacteria 109624
137 Ga0209589_1000058 3300027357 Bacteria 109624
138 Ga0209489_100020 3300027361 Bacteria 207541
139 Ga0209813_10055042 3300027866 Bacteria 1255
140 Ga0268266_10029543 3300028379 Bacteria 4659
141 Ga0268265_11260783 3300028380 Bacteria 738
142 Ga0268264_10198129 3300028381 Bacteria 1835
143 Ga0268264_12283902 3300028381 Bacteria 548
144 Ga0265337_1025255 3300028556 Bacteria 1809
145 Ga0265319_1002354 3300028563 Bacteria 10384
146 Ga0265334_10015036 3300028573 Bacteria 3218
147 Ga0265334_10046618 3300028573 Bacteria 1675
148 Ga0265318_10120780 3300028577 Bacteria 963
149 Ga0265323_10001870 3300028653 Bacteria 9951
150 Ga0265322_10007018 3300028654 Bacteria 3303
151 Ga0265336_10001340 3300028666 Bacteria 11454
152 Ga0307517_10204060 3300028786 Bacteria 1230
153 Ga0265338_10000076 3300028800 Bacteria 180204
154 Ga0265324_10002273 3300029957 Bacteria 10015
155 Ga0265330_10048697 3300031235 Bacteria 1863
156 Ga0265332_10048473 3300031238 Bacteria 1827
157 Ga0265325_10017665 3300031241 Bacteria 3962
158 Ga0265340_10005273 3300031247 Bacteria 7175
159 Ga0265339_10071745 3300031249 Bacteria 1844
160 Ga0265316_10108319 3300031344 Bacteria 2106
161 Ga0307508_10359829 3300031616 Bacteria 1046
162 Ga0265342_10257189 3300031712 Bacteria 930
163 Ga0307516_10185589 3300031730 Bacteria 1810
164 Ga0307405_10419166 3300031731 Bacteria 1053
165 Ga0307410_10669362 3300031852 Bacteria 872
166 Ga0307416_100610070 3300032002 Bacteria 1172
167 Ga0307414_10658048 3300032004 Bacteria 945
168 Ga0307411_10481832 3300032005 Bacteria 1045
169 Ga0307507_10452981 3300033179 Bacteria 708
170 Ga0307510_10039344 3300033180 Bacteria 5211
171 Ga0307510_10148844 3300033180 Bacteria 1965
172 Ga0315911_1000005 3300033442 Bacteria 426255
173 Ga0373936_0090253 3300035113 Bacteria 1284
174 Ga0373927_0899848 3300035695 Bacteria 584
175 Ga0373925_0593835 3300037068 Bacteria 912
176 Ga0395900_0000046 3300037418 Bacteria 230114
177 Ga0395898_0001187 3300037466 Bacteria 39599
178 Ga0395901_0887619 3300038443 Bacteria 874
179 Ga0439465_0085794 3300041413 Bacteria 1072
180 Ga0439465_0118490 3300041413 Bacteria 927
181 Ga0451793_0763619 3300041452 Bacteria 681
182 Ga0451795_0476368 3300041456 Bacteria 938
183 Ga0451798_1053011 3300041458 Bacteria 847
184 Ga0451802_0533653 3300041460 Bacteria 647
185 Ga0451835_0356216 3300041492 Bacteria 731
186 Ga0451839_1381008 3300041496 Bacteria 1165
187 Ga0451841_0772187 3300041498 Bacteria 580
188 Ga0451853_0919130 3300041512 Bacteria 703
189 Ga0466972_0198613 3300044658 Bacteria 939
190 Ga0466965_0436886 3300044683 Bacteria 727
191 Ga0466965_0614337 3300044683 Bacteria 618
192 Ga0466964_0348979 3300044706 Bacteria 760
193 Ga0466968_0011255 3300044735 Bacteria 3484
194 Ga0466968_0199685 3300044735 Bacteria 936
195 Ga0466968_0479574 3300044735 Bacteria 618
196 Ga0466960_0013365 3300044901 Bacteria 3486
197 Ga0466960_0101133 3300044901 Bacteria 1484
198 Ga0466967_1132160 3300045976 Bacteria 780
199 Ga0495592_0029518 3300046454 Bacteria 4152
200 Ga0495603_0018594 3300046455 Bacteria 4204
201 Ga0495603_0334712 3300046455 Bacteria 869
202 Ga0495590_0056276 3300046457 Bacteria 1374
203 Ga0495629_0002484 3300046459 Bacteria 14139
204 Ga0495651_0002329 3300046462 Bacteria 14659
205 Ga0495651_0022777 3300046462 Bacteria 4870
206 Ga0495653_0138333 3300046463 Bacteria 1716
207 Ga0495605_0198337 3300046474 Bacteria 876
208 Ga0495639_0385941 3300046475 Bacteria 706
209 Ga0495664_0004128 3300046477 Bacteria 7928
210 Ga0495585_0272860 3300046492 Bacteria 838
211 Ga0495596_0064901 3300046500 Bacteria 1420
212 Ga0495583_0078076 3300046506 Bacteria 1443
213 Ga0495583_0250874 3300046506 Bacteria 710
214 Ga0495606_0038767 3300046507 Bacteria 3219
215 Ga0495606_0204179 3300046507 Bacteria 1124
216 Ga0495606_0247000 3300046507 Bacteria 992
217 Ga0495608_0013065 3300046511 Bacteria 5762
218 Ga0495608_0121159 3300046511 Bacteria 1677
219 Ga0495618_0199953 3300046514 Bacteria 1265
220 Ga0495618_0213843 3300046514 Bacteria 1218
221 Ga0495620_0079939 3300046515 Bacteria 1324
222 Ga0495628_0049122 3300046516 Bacteria 3341
223 Ga0495628_0263080 3300046516 Bacteria 1285
224 Ga0495628_1030715 3300046516 Bacteria 565
225 Ga0495630_0553959 3300046517 Bacteria 882
226 Ga0495631_0134791 3300046518 Bacteria 1061
227 Ga0495632_0035985 3300046519 Bacteria 2521
228 Ga0495643_0202485 3300046522 Bacteria 952
229 Ga0495648_0019953 3300046524 Bacteria 4691
230 Ga0495648_0317404 3300046524 Bacteria 724
231 Ga0495652_0007461 3300046529 Bacteria 10080
232 Ga0495652_0037900 3300046529 Bacteria 4180
233 Ga0495654_0070604 3300046530 Bacteria 1656
234 Ga0495654_0243512 3300046530 Bacteria 752
235 Ga0495640_0036810 3300046533 Bacteria 3455
236 Ga0495609_0062492 3300046538 Bacteria 1644
237 Ga0495645_0029193 3300046543 Bacteria 4009
238 Ga0495622_0010994 3300046557 Bacteria 4176
239 Ga0495667_0021573 3300046559 Bacteria 4346
240 Ga0495656_0332294 3300046615 Bacteria 785
241 Ga0495668_0018575 3300046616 Bacteria 4018
242 Ga0495668_0066938 3300046616 Bacteria 1976
243 Ga0495668_0133211 3300046616 Bacteria 1360
244 Ga0495634_0083425 3300046642 Bacteria 2086
245 Ga0495611_0306964 3300046648 Bacteria 731
246 Ga0495625_0038953 3300046660 Bacteria 3474
247 Ga0495625_0373367 3300046660 Bacteria 896
248 Ga0495635_0002223 3300046663 Bacteria 13179
249 Ga0495661_0493163 3300046665 Bacteria 585
250 Ga0495588_0252140 3300046674 Bacteria 930
251 Ga0495588_0553685 3300046674 Bacteria 603
252 Ga0495657_0029590 3300046675 Bacteria 3840
253 Ga0495657_0065000 3300046675 Bacteria 2400
254 Ga0495599_0010505 3300046678 Bacteria 5664
255 Ga0495646_0057215 3300046680 Bacteria 2335
256 Ga0495646_0103964 3300046680 Bacteria 1624
257 Ga0495669_0212636 3300046684 Bacteria 926
258 Ga0495613_0067221 3300046689 Bacteria 2616
259 Ga0495624_0016038 3300046690 Bacteria 5043
260 Ga0495671_0305073 3300046692 Bacteria 766
261 Ga0495671_0635613 3300046692 Bacteria 507
262 Ga0495649_0136438 3300046694 Bacteria 1293
263 Ga0495649_0315992 3300046694 Bacteria 793
264 Ga0495600_0035834 3300046809 Bacteria 3224
265 Ga0495600_0369036 3300046809 Bacteria 897
266 Ga0495581_0523106 3300047315 Bacteria 689
267 Ga0495604_0001149 3300047317 Bacteria 21934
268 Ga0495604_0173225 3300047317 Bacteria 1515
269 Ga0495604_0505738 3300047317 Bacteria 783
270 Ga0495674_0068841 3300047319 Bacteria 3062
271 Ga0495672_0351375 3300047320 Bacteria 685
272 Ga0495672_0518943 3300047320 Bacteria 527
273 Ga0495680_0010460 3300047322 Bacteria 8277
274 Ga0495683_0086221 3300047323 Bacteria 1526
275 Ga0495675_0152420 3300047444 Bacteria 1427
276 Ga0495673_0251288 3300047469 Bacteria 645
277 Ga0495684_0048150 3300047471 Bacteria 3260
278 Ga0495684_0363681 3300047471 Bacteria 1024
279 Ga0495602_0062378 3300048088 Bacteria 3234
280 Ga0495602_0098051 3300048088 Bacteria 2413
281 Ga0495614_0071195 3300048089 Bacteria 1499
282 Ga0495626_0088810 3300048091 Bacteria 1362
283 Ga0496100_0295074 3300048903 Bacteria 1212
284 Ga0496100_0870202 3300048903 Bacteria 707
285 Ga0496101_0211630 3300048904 Bacteria 1502
286 Ga0496102_0163659 3300048905 Bacteria 2093
287 Ga0496103_0466884 3300048906 Bacteria 809
288 Ga0496104_0001707 3300048907 Bacteria 18962
289 Ga0496104_0136279 3300048907 Bacteria 2359
290 Ga0496105_0020677 3300048908 Bacteria 5320
291 Ga0496105_0648015 3300048908 Bacteria 815
292 Ga0496106_0943338 3300048909 Bacteria 680
293 Ga0496106_1491925 3300048909 Bacteria 520
294 Ga0496107_0124697 3300048910 Bacteria 1899
295 Ga0496107_0743881 3300048910 Bacteria 720
296 Ga0496108_0766159 3300048911 Bacteria 834
297 Ga0496109_0915428 3300048912 Bacteria 815
298 Ga0496112_0543045 3300048915 Bacteria 1096
299 Ga0496114_0353914 3300048917 Bacteria 1299
300 Ga0496114_0609562 3300048917 Bacteria 962
301 Ga0496115_0380537 3300048918 Bacteria 1148
302 Ga0496115_0475505 3300048918 Bacteria 1007
303 Ga0496117_0204540 3300048920 Bacteria 1113
304 Ga0496117_0229296 3300048920 Bacteria 1028
305 Ga0496119_0012398 3300048922 Bacteria 6928
306 Ga0496119_0168800 3300048922 Bacteria 1157
307 Ga0496120_0019824 3300048923 Bacteria 4290
308 Ga0496121_0079251 3300048924 Bacteria 2608
309 Ga0496121_0251173 3300048924 Bacteria 1226
310 Ga0496121_0270539 3300048924 Bacteria 1168
311 Ga0496121_0620403 3300048924 Bacteria 664
312 Ga0496122_0232774 3300048925 Bacteria 1046
313 Ga0496122_0322922 3300048925 Bacteria 820
314 Ga0496122_0470224 3300048925 Bacteria 619
315 Ga0496123_0110803 3300048926 Bacteria 1570
316 Ga0496123_0465703 3300048926 Bacteria 559
317 Ga0496124_0022228 3300048927 Bacteria 5820
318 Ga0496124_0167984 3300048927 Bacteria 1703
319 Ga0496124_0205264 3300048927 Bacteria 1495
320 Ga0496125_0322165 3300048928 Bacteria 936
321 Ga0496126_0005446 3300048929 Bacteria 14517
322 Ga0496126_0046455 3300048929 Bacteria 3982
323 Ga0496126_0140803 3300048929 Bacteria 2076
324 Ga0496126_0202444 3300048929 Bacteria 1676
325 Ga0495682_0033501 3300049460 Bacteria 1896
326 Ga0495682_0281359 3300049460 Bacteria 587
327 Ga0501080_1626815 3300049742 Bacteria 546
328 Ga0501083_0466774 3300049744 Bacteria 822
329 Ga0501044_0338999 3300049823 Bacteria 1425
330 Ga0501044_1116276 3300049823 Bacteria 657
331 nmdc:mga00v17_536817_c1 3300050491 Bacteria 757
332 nmdc:mga0yw44_118065_c1 3300050492 Bacteria 1706
333 nmdc:mga0yw44_30901_c1 3300050492 Bacteria 3110
334 nmdc:mga0yw44_78416_c1 3300050492 Bacteria 2066
335 nmdc:mga04h51_61918_c1 3300050495 Bacteria 1285
336 nmdc:mga05p37_33493_c1 3300050507 Bacteria 6292
337 nmdc:mga0sz30_238184_c1 3300050516 Bacteria 810
338 nmdc:mga0sz30_32260_c1 3300050516 Bacteria 1184
339 Ga0495601_0402077 3300053077 Bacteria 888
340 Ga0500610_0224720 3300053079 Bacteria 886
341 Ga0495595_0202272 3300053084 Bacteria 989
342 Ga0495619_0215431 3300053085 Bacteria 1330
343 Ga0500578_0261547 3300053086 Bacteria 1039
344 Ga0500583_0349935 3300053092 Bacteria 716
345 Ga0500651_0177361 3300053093 Bacteria 1267
346 Ga0500651_0383353 3300053093 Bacteria 792
347 Ga0500566_0014312 3300053094 Bacteria 4665
348 Ga0500650_0208592 3300053098 Bacteria 888
349 Ga0500554_007713 3300053102 Bacteria 2490
350 Ga0500556_0053622 3300053104 Bacteria 1466
351 Ga0500569_037573 3300053109 Bacteria 1400
352 Ga0500595_000123 3300053119 Bacteria 51077
353 Ga0500595_002608 3300053119 Bacteria 8795
354 Ga0500595_029766 3300053119 Bacteria 1849
355 Ga0500607_036285 3300053121 Bacteria 2692
356 Ga0500608_175544 3300053122 Bacteria 913
357 Ga0500614_201423 3300053123 Bacteria 613
358 Ga0500626_098445 3300053128 Bacteria 1277
359 Ga0500658_0036598 3300053134 Bacteria 1948
360 Ga0500559_0203613 3300053136 Bacteria 933
361 Ga0500564_175778 3300053138 Bacteria 896
362 Ga0500568_0081522 3300053139 Bacteria 1228
363 Ga0500568_0387362 3300053139 Bacteria 506
364 Ga0500577_0395918 3300053142 Bacteria 604
365 Ga0500590_030403 3300053148 Bacteria 2802
366 Ga0500590_182638 3300053148 Bacteria 909
367 Ga0500590_246614 3300053148 Bacteria 714
368 Ga0500604_0117229 3300053151 Bacteria 888
369 Ga0500627_0130274 3300053158 Bacteria 1136
370 Ga0500627_0405291 3300053158 Bacteria 580
371 Ga0500633_0024256 3300053160 Bacteria 1882
372 Ga0500638_000491 3300053162 Bacteria 9725
373 Ga0500639_183120 3300053163 Bacteria 923
374 Ga0500636_0004932 3300053177 Bacteria 7580
375 Ga0500636_0368597 3300053177 Bacteria 678
376 Ga0500637_0002568 3300053178 Bacteria 8112
377 Ga0500609_004903 3300053731 Bacteria 1835
378 Ga0500599_006735 3300053736 Bacteria 1467
379 Ga0500601_001506 3300053737 Bacteria 2550
380 Ga0500661_000418 3300055283 Bacteria 7818
381 Ga0500661_047636 3300055283 Bacteria 763
382 2503198816 2503198000 Bacteria 6884444
383 2507504533 2507262055 Bacteria 8048963
384 2508545956 2508501009 Bacteria 7784016
385 2508694809 2508501042 Bacteria 8719808
386 2509144470 2508501127 Bacteria 7037543
387 2509393753 2509276022 Bacteria 6200534
388 2511399521 2511231028 Bacteria 8046582
389 2513613881 2513237090 Bacteria 7096802
390 2513638392 2513237094 Bacteria 8789602
391 2513657590 2513237096 Bacteria 8722461
392 2513703816 2513237102 Bacteria 7703324
393 2513861634 2513237137 Bacteria 9558895
394 2513916843 2513237145 Bacteria 8979722
395 2517889753 2517572143 Bacteria 9484767
396 2528849537 2528768022 Bacteria 10457665
397 2597810772 2597489875 Bacteria 7010078
398 2599938915 2599185301 Bacteria 6161860
399 2643774556 2643221551 Bacteria 3750538
400 2643793001 2643221555 Bacteria 3749717
401 2643985880 2643221595 Bacteria 6565519
402 2644154372 2643221627 Bacteria 6761570
403 2671119605 2667528175 Bacteria 7532676
404 2728748399 2728368998 Bacteria 8720350
405 2793063631 2791355196 Bacteria 7323613
406 2793070265 2791355197 Bacteria 8420563
407 2824607243 2824600985 Bacteria 8488197
408 2824616223 2824609381 Bacteria 8672835
409 2824619483 2824617872 Bacteria 8814715
410 2824627938 2824626560 Bacteria 8813858
411 2824659118 2824653114 Bacteria 8493680
412 2824732428 2824723954 Bacteria 8758240
413 2839994840 2839993093 Bacteria 5512535
414 2841736495 2841734538 Bacteria 6784580
415 2844010900 2844009547 Bacteria 6728125
416 2847673545 2847670302 Bacteria 6165597
417 2847690055 2847686936 Bacteria 6278406
418 2856318986 2856314179 Bacteria 6477897
419 2856348660 2856342000 Bacteria 7176905
420 2857514901 2857509624 Bacteria 7472071
421 2869172381 2869169390 Bacteria 6659796
422 2869237754 2869234852 Bacteria 6654993
423 2869247521 2869242130 Bacteria 6609239
424 2869258751 2869256925 Bacteria 6981691
425 2871439373 2871435913 Bacteria 6880295
426 2871448807 2871444079 Bacteria 6423508
427 2871483317 2871481445 Bacteria 6700002
428 2871498773 2871495908 Bacteria 6935695
429 2874103166 2874102143 Bacteria 6342645
430 2874111478 2874109183 Bacteria 6517025
431 2874116637 2874116593 Bacteria 6674494
432 2874126246 2874123672 Bacteria 7238285
433 2874620094 2874612657 Bacteria 8252029
434 2876385826 2876377896 Bacteria 6565995
435 2876389986 2876386047 Bacteria 6698674
436 2876396918 2876392853 Bacteria 6660880
437 2876424706 2876420981 Bacteria 6687741
438 2878039330 2878035449 Bacteria 6555736
439 2878731131 2878730984 Bacteria 6380721
440 2878762991 2878760144 Bacteria 6823465
441 2878769961 2878767105 Bacteria 6898628
442 2878791923 2878788777 Bacteria 6567085
443 2881148325 2881147464 Bacteria 7779814
444 2881165109 2881161766 Bacteria 7127907
445 2881670309 2881665667 Bacteria 8175609
446 2882635277 2882632389 Bacteria 8154593
447 2885306985 2885305155 Bacteria 7348390
448 2885314011 2885312484 Bacteria 6415165
449 2885328505 2885326080 Bacteria 7134805
450 2885340493 2885334103 Bacteria 7216818
451 2885379238 2885374607 Bacteria 8927485
452 2888344485 2888343758 Bacteria 6611049
453 2888427103 2888419890 Bacteria 7857137
454 2891637498 2891633521 Bacteria 4602265
455 2903519533 2903513507 Bacteria 6344008
456 2903543575 2903540706 Bacteria 7062119
457 2903751201 2903748898 Bacteria 9972761
458 2904663672 2904659560 Bacteria 6685615
459 2904695515 2904690495 Bacteria 9412302
460 2906334085 2906328253 Bacteria 6585166
461 2906359768 2906354277 Bacteria 6991324
462 2906402204 2906401398 Bacteria 6693206
463 2906419057 2906414383 Bacteria 6580790
464 2906428698 2906427513 Bacteria 6375796
465 2906614728
466 2906637472 2906635258 Bacteria 8601019
467 2906647903 2906643746 Bacteria 8722424
468 2906661226 2906660503 Bacteria 8595048
469 2908746440 2908739725 Bacteria 8628932
470 2908764185 2908756301 Bacteria 8864324
471 2922133255 2922130491 Bacteria 7173936
472 2922162534 2922158528 Bacteria 6573167
473 2922192512 2922185730 Bacteria 7113964
474 2922426596
475 2924712767 2924710171 Bacteria 6752351
476 2924731830 2924726620 Bacteria 6271473
477 2924740293 2924733363 Bacteria 7574837
478 2924742809 2924741084 Bacteria 6661321
479 2924758994 2924754689 Bacteria 6774424
480 2929622773 2929615660 Bacteria 9193770
481 2929632123 2929624759 Bacteria 9339455
482 2932789921 2932784394 Bacteria 9704911
483 2932796119 2932794094 Bacteria 7915132
484 2932807695 2932801729 Bacteria 7987968
485 2932829223 2932828146 Bacteria 9745859
486 2933584595 2933577622 Bacteria 9116884
487 2935613063 2935608549 Bacteria 8203142
488 2935617698 2935616580 Bacteria 9032984
489 2935632932 2935630451 Bacteria 8169952
490 2935643743 2935638405 Bacteria 10015038
491 2935654001 2935648319 Bacteria 8801166
492 2935662897 2935656913 Bacteria 8965014
493 2935670947 2935665750 Bacteria 9571747
494 2935681590 2935675223 Bacteria 9928132
495 2935692566 2935684952 Bacteria 9590419
496 2935699179 2935694250 Bacteria 9291695
497 2935709993 2935703347 Bacteria 10242284
498 2935721184 2935713505 Bacteria 9608509
499 2935730822 2935722832 Bacteria 9608746
500 2935739874 2935732158 Bacteria 9706831
501 2935748912 2935741537 Bacteria 9707219
502 2935758782 2935750917 Bacteria 9590372
503 2935774915 2935769743 Bacteria 7878163
504 2935792167 2935785616 Bacteria 7962367
505 2935798664 2935793552 Bacteria 8012592
506 2935806812 2935801545 Bacteria 9301974
507 2935817976 2935810662 Bacteria 9401221
508 2935825085 2935819856 Bacteria 8261050
509 2935834428 2935827899 Bacteria 10038562
510 2935843847 2935837841 Bacteria 9454360
511 2935852304 2935847175 Bacteria 8228321
512 2935856803 2935855204 Bacteria 9035059
513 2935868330 2935864058 Bacteria 9784707
514 2935879640 2935873716 Bacteria 9632195
515 2935887401 2935883170 Bacteria 7964738
516 2935910738 2935908558 Bacteria 8568796
517 2935921918 2935916978 Bacteria 9113783
518 2935929943 2935926038 Bacteria 8601059
519 2935937611 2935934488 Bacteria 8602579
520 2935947990 2935942939 Bacteria 8599779
521 2935956811 2935951376 Bacteria 8602333
522 2935970932 2935967501 Bacteria 8603075
523 2935984438 2935984226 Bacteria 8302647
524 2935997146 2935992306 Bacteria 9802711
525 2936009893 2936002035 Bacteria 9362176
526 2936016906 2936011229 Bacteria 8801034
527 2936025686 2936019824 Bacteria 8804134
528 2936034528 2936028420 Bacteria 8965941
529 2936044626 2936037263 Bacteria 9446081
530 2936052438 2936046547 Bacteria 8903709
531 2936055518 2936055302 Bacteria 8785755
532 2937838929 2937836603 Bacteria 6811263
533 2937863261 2937861824 Bacteria 6660327
534 2937898298 2937891427 Bacteria 6357007
535 2937987802 2937980651 Bacteria 6517427
536 2937997421 2937994558 Bacteria 7036190
537 2938017513 2938014810 Bacteria 6700592
538 2940564628 2940556831 Bacteria 9590747
539 2941509766 2941507105 Bacteria 8166816
540 2941517595 2941515067 Bacteria 8166720
541 2941526452 2941523033 Bacteria 8169134
542 2941545095 2941538514 Bacteria 9402094
543 2958034706 2958034702 Bacteria 6989922
544 2958075326 2958071322 Bacteria 6815895
545 2958114134 2958108152 Bacteria 6681128
546 2958120229 2958115193 Bacteria 6923548
547 2958167895 2958165035 Bacteria 6906348
548 2958174006 2958172287 Bacteria 6716688
549 2961119188 2961114664 Bacteria 6680456
550 2961166363 2961163497 Bacteria 6901077
551 2961187643 2961183825 Bacteria 6688536
552 2965021182 2965018300 Bacteria 6883036
553 2965064234 2965062239 Bacteria 7412989
554 2965104618 2965102966 Bacteria 6800987
555 2965126657 2965119406 Bacteria 6956431
556 2968093336 2968091066 Bacteria 6052692
557 2968100854 2968097103 Bacteria 6107094
558 2968114811 2968110612 Bacteria 6814636
559 2968134078 2968128360 Bacteria 6270294
560 2968146143 2968138860 Bacteria 6605449
561 2968174764 2968171901 Bacteria 6894245
562 2970526204 2970524798 Bacteria 6840927
563 2970539954 2970532167 Bacteria 6553173
564 2970547069 2970540015 Bacteria 6977556
565 2970557846 2970554993 Bacteria 6814252
566 2970624004 2970619444 Bacteria 6986144
567 2970632071 2970627176 Bacteria 6680862
568 2977854436 2977851361 Bacteria 6694324
569 2977862218 2977858184 Bacteria 6215359
570 2977869265 2977864932 Bacteria 7534097
571 2977900304 2977898635 Bacteria 6675551
572 2977909709 2977907340 Bacteria 6577984
573 2977977745 2977971508 Bacteria 7472917
574 2979717308 2979710463 Bacteria 6785254
575 2979744930 2979742915 Bacteria 7301278
576 2979766624 2979764755 Bacteria 6610066
577 2979774529 2979772303 Bacteria 6618277
578 2979782312 2979779861 Bacteria 6219781
579 2987662371 2987659509 Bacteria 6966464
580 2996342751 2996341866 Bacteria 6643098
581 2996391627 2996386984 Bacteria 6978667
582 3004191422 3004188549 Bacteria 6952365
583 3004237251 3004232784 Bacteria 6662140
584 3004252986 3004248173 Bacteria 6563236
585 3004272074 3004268573 Bacteria 7043476
586 3005475942 3005474847 Bacteria 9259049
587 3005490331 3005483717 Bacteria 7877331
588 3005595792 3005594810 Bacteria 8716512
589 3005711760 3005710791 Bacteria 7622528
590 8004313651 8004312739 Bacteria 7444653
591 8004396728 8004395343 Bacteria 6620908
592 8004448634 8004445564 Bacteria 6322258
593 8004638131 8004633249 Bacteria 6723080
594 8004706616 8004703790 Bacteria 8006957
595 8004734780 8004727605 Bacteria 6643904
596 8016518985 8016511872 Bacteria 9921665
597 8016525432 8016522445 Bacteria 8156687
598 8016543310 8016539877 Bacteria 8155419
599 8016549988 8016548790 Bacteria 8155074
600 8016581363 8016575299 Bacteria 8154085
601 8016596390 8016595262 Bacteria 8149947
602 8016607259 8016603502 Bacteria 8731218
603 8016630431 8016622563 Bacteria 7999408
604 8016636687 8016630954 Bacteria 9217207
605 8017057707 8017057580 Bacteria 10023680
606 8019538687 8019530166 Bacteria 8155624
607 8019541255 8019538911 Bacteria 7872763
608 8019549375 8019547302 Bacteria 7996444
609 8019561401 8019555841 Bacteria 9642137
610 8019571480 8019565922 Bacteria 9639779
611 8019578105 8019576017 Bacteria 10049540
612 8019596137 8019586578 Bacteria 10212056
613 8019605554 8019597564 Bacteria 10041141
614 8019612983 8019608314 Bacteria 10042931
615 8019653418 8019648815 Bacteria 10014479
616 8019695508 8019687851 Bacteria 8712826
617 8055618023 8055617313 Bacteria 7548464
618 8055750657 8055742211 Bacteria 9226248
619 8056692156 8056689827 Bacteria 6712655
620 Ga0207707_11448875
621 rootH1_10144661
622 Ga0065165_1001041
623 Ga0070658_10018017
624 Ga0070658_10030640
625 Ga0070683_101895353
626 Ga0070680_100030013
627 Ga0070660_100725799
628 Ga0070661_100344242
629 Ga0070668_100524139
630 Ga0070668_100790348
631 Ga0070669_100193984
632 Ga0070659_100066374
633 Ga0070713_100028092
634 Ga0070710_10225648
635 Ga0070711_100022015
636 Ga0070711_100610526
637 Ga0070700_100334122
638 Ga0070663_100268102
639 Ga0070678_101829298
640 Ga0070662_100002547
641 Ga0070662_101782438
642 Ga0070706_100711795
643 Ga0070707_100218310
644 Ga0070698_100129432
645 Ga0070679_100289005
646 Ga0070679_100309591
647 Ga0068853_100927780
648 Ga0070672_100544989
649 Ga0070696_101628753
650 Ga0070693_100046844
651 Ga0070665_100010585
652 Ga0068854_100579855
653 Ga0068854_100699552
654 Ga0068856_100000281
655 Ga0068856_100043126
656 Ga0068856_100127672
657 Ga0068856_100359534
658 Ga0070702_100217016
659 Ga0070702_101174329
660 Ga0068852_100009648
661 Ga0068852_100516311
662 Ga0068852_101790262
663 Ga0068866_10583988
664 Ga0068861_100061173
665 Ga0068851_10382500
666 Ga0068858_102041804
667 Ga0068860_100392493
668 Ga0075365_10108590
669 Ga0075368_10287726
670 Ga0075363_100862948
671 Ga0075364_10068596
672 Ga0070715_10321052
673 Ga0075367_10339246
674 Ga0075369_10092654
675 Ga0075369_10156044
676 Ga0099795_10248209
677 Ga0105250_10129057
678 Ga0105240_11015923
679 Ga0105240_11027244
680 Ga0105245_11562343
681 Ga0105247_10094141
682 Ga0105242_10878852
683 Ga0105248_11360074
684 Ga0105237_10465949
685 Ga0105237_10801766
686 Ga0105238_10621725
687 Ga0105249_10973386
688 Ga0105239_10544161
689 Ga0105239_11739654
690 Ga0105239_11862571
691 Ga0105246_10118605
692 Ga0105246_11630589
693 Ga0157369_10351267
694 Ga0157378_10478524
695 Ga0157378_10925272
696 Ga0163162_10413281
697 Ga0163162_10909703
698 Ga0157375_10054545
699 Ga0157380_11539317
700 Ga0182008_10443527
701 Ga0163161_10163037
702 Ga0163161_10855366
703 Ga0214542_1000007
704 Ga0214545_1000006
705 Ga0214543_1000009
706 Ga0209233_1003124
707 Ga0209758_1007632
708 Ga0209758_1071198
709 Ga0207426_1003913
710 Ga0207692_10515573
711 Ga0207710_10175596
712 Ga0207647_10051789
713 Ga0207685_10194463
714 Ga0207685_10760825
715 Ga0207699_10672601
716 Ga0207645_10482062
717 Ga0207705_10010125
718 Ga0207684_10500980
719 Ga0207671_10234039
720 Ga0207663_10398794
721 Ga0207660_10342319
722 Ga0207657_10188400
723 Ga0207652_10049060
724 Ga0207652_10670768
725 Ga0207646_10189271
726 Ga0207687_10653919
727 Ga0207700_10040261
728 Ga0207690_10229466
729 Ga0207706_10003036
730 Ga0207686_10483305
731 Ga0207669_10634033
732 Ga0207704_10870726
733 Ga0207689_10257342
734 Ga0207667_10018100
735 Ga0207651_10188861
736 Ga0207668_10599295
737 Ga0207640_10131249
738 Ga0207640_10327203
739 Ga0207640_11779318
740 Ga0207658_10404233
741 Ga0207639_11231308
742 Ga0207678_10131526
743 Ga0207708_10084828
744 Ga0207702_10000065
745 Ga0207702_10112970
746 Ga0207702_10160990
747 Ga0207641_10683595
748 Ga0207648_10609213
749 Ga0207675_100119935
750 Ga0207683_10136989
751 Ga0207698_10074506
752 Ga0207698_10310517
753 Ga0207698_11114787
754 Ga0207698_11367129
755 Ga0209389_1000052
756 Ga0209589_1000058
757 Ga0209489_100020
758 Ga0209813_10055042
759 Ga0268266_10029543
760 Ga0268265_11260783
761 Ga0268264_10198129
762 Ga0268264_12283902
763 Ga0265337_1025255
764 Ga0265319_1002354
765 Ga0265334_10015036
766 Ga0265334_10046618
767 Ga0265318_10120780
768 Ga0265323_10001870
769 Ga0265322_10007018
770 Ga0265336_10001340
771 Ga0307517_10204060
772 Ga0265338_10000076
773 Ga0265324_10002273
774 Ga0265330_10048697
775 Ga0265332_10048473
776 Ga0265325_10017665
777 Ga0265340_10005273
778 Ga0265339_10071745
779 Ga0265316_10108319
780 Ga0307508_10359829
781 Ga0265342_10257189
782 Ga0307516_10185589
783 Ga0307405_10419166
784 Ga0307410_10669362
785 Ga0307416_100610070
786 Ga0307414_10658048
787 Ga0307411_10481832
788 Ga0307507_10452981
789 Ga0307510_10039344
790 Ga0307510_10148844
791 Ga0315911_1000005
792 Ga0373936_0090253
793 Ga0373927_0899848
794 Ga0373925_0593835
795 Ga0395900_0000046
796 Ga0395898_0001187
797 Ga0395901_0887619
798 Ga0439465_0085794
799 Ga0439465_0118490
800 Ga0451793_0763619
801 Ga0451795_0476368
802 Ga0451798_1053011
803 Ga0451802_0533653
804 Ga0451835_0356216
805 Ga0451839_1381008
806 Ga0451841_0772187
807 Ga0451853_0919130
808 Ga0466972_0198613
809 Ga0466965_0436886
810 Ga0466965_0614337
811 Ga0466964_0348979
812 Ga0466968_0011255
813 Ga0466968_0199685
814 Ga0466968_0479574
815 Ga0466960_0013365
816 Ga0466960_0101133
817 Ga0466967_1132160
818 Ga0495592_0029518
819 Ga0495603_0018594
820 Ga0495603_0334712
821 Ga0495590_0056276
822 Ga0495629_0002484
823 Ga0495651_0002329
824 Ga0495651_0022777
825 Ga0495653_0138333
826 Ga0495605_0198337
827 Ga0495639_0385941
828 Ga0495664_0004128
829 Ga0495585_0272860
830 Ga0495596_0064901
831 Ga0495583_0078076
832 Ga0495583_0250874
833 Ga0495606_0038767
834 Ga0495606_0204179
835 Ga0495606_0247000
836 Ga0495608_0013065
837 Ga0495608_0121159
838 Ga0495618_0199953
839 Ga0495618_0213843
840 Ga0495620_0079939
841 Ga0495628_0049122
842 Ga0495628_0263080
843 Ga0495628_1030715
844 Ga0495630_0553959
845 Ga0495631_0134791
846 Ga0495632_0035985
847 Ga0495643_0202485
848 Ga0495648_0019953
849 Ga0495648_0317404
850 Ga0495652_0007461
851 Ga0495652_0037900
852 Ga0495654_0070604
853 Ga0495654_0243512
854 Ga0495640_0036810
855 Ga0495609_0062492
856 Ga0495645_0029193
857 Ga0495622_0010994
858 Ga0495667_0021573
859 Ga0495656_0332294
860 Ga0495668_0018575
861 Ga0495668_0066938
862 Ga0495668_0133211
863 Ga0495634_0083425
864 Ga0495611_0306964
865 Ga0495625_0038953
866 Ga0495625_0373367
867 Ga0495635_0002223
868 Ga0495661_0493163
869 Ga0495588_0252140
870 Ga0495588_0553685
871 Ga0495657_0029590
872 Ga0495657_0065000
873 Ga0495599_0010505
874 Ga0495646_0057215
875 Ga0495646_0103964
876 Ga0495669_0212636
877 Ga0495613_0067221
878 Ga0495624_0016038
879 Ga0495671_0305073
880 Ga0495671_0635613
881 Ga0495649_0136438
882 Ga0495649_0315992
883 Ga0495600_0035834
884 Ga0495600_0369036
885 Ga0495581_0523106
886 Ga0495604_0001149
887 Ga0495604_0173225
888 Ga0495604_0505738
889 Ga0495674_0068841
890 Ga0495672_0351375
891 Ga0495672_0518943
892 Ga0495680_0010460
893 Ga0495683_0086221
894 Ga0495675_0152420
895 Ga0495673_0251288
896 Ga0495684_0048150
897 Ga0495684_0363681
898 Ga0495602_0062378
899 Ga0495602_0098051
900 Ga0495614_0071195
901 Ga0495626_0088810
902 Ga0496100_0295074
903 Ga0496100_0870202
904 Ga0496101_0211630
905 Ga0496102_0163659
906 Ga0496103_0466884
907 Ga0496104_0001707
908 Ga0496104_0136279
909 Ga0496105_0020677
910 Ga0496105_0648015
911 Ga0496106_0943338
912 Ga0496106_1491925
913 Ga0496107_0124697
914 Ga0496107_0743881
915 Ga0496108_0766159
916 Ga0496109_0915428
917 Ga0496112_0543045
918 Ga0496114_0353914
919 Ga0496114_0609562
920 Ga0496115_0380537
921 Ga0496115_0475505
922 Ga0496117_0204540
923 Ga0496117_0229296
924 Ga0496119_0012398
925 Ga0496119_0168800
926 Ga0496120_0019824
927 Ga0496121_0079251
928 Ga0496121_0251173
929 Ga0496121_0270539
930 Ga0496121_0620403
931 Ga0496122_0232774
932 Ga0496122_0322922
933 Ga0496122_0470224
934 Ga0496123_0110803
935 Ga0496123_0465703
936 Ga0496124_0022228
937 Ga0496124_0167984
938 Ga0496124_0205264
939 Ga0496125_0322165
940 Ga0496126_0005446
941 Ga0496126_0046455
942 Ga0496126_0140803
943 Ga0496126_0202444
944 Ga0495682_0033501
945 Ga0495682_0281359
946 Ga0501080_1626815
947 Ga0501083_0466774
948 Ga0501044_0338999
949 Ga0501044_1116276
950 nmdc:mga00v17_536817_c1
951 nmdc:mga0yw44_118065_c1
952 nmdc:mga0yw44_30901_c1
953 nmdc:mga0yw44_78416_c1
954 nmdc:mga04h51_61918_c1
955 nmdc:mga05p37_33493_c1
956 nmdc:mga0sz30_238184_c1
957 nmdc:mga0sz30_32260_c1
958 Ga0495601_0402077
959 Ga0500610_0224720
960 Ga0495595_0202272
961 Ga0495619_0215431
962 Ga0500578_0261547
963 Ga0500583_0349935
964 Ga0500651_0177361
965 Ga0500651_0383353
966 Ga0500566_0014312
967 Ga0500650_0208592
968 Ga0500554_007713
969 Ga0500556_0053622
970 Ga0500569_037573
971 Ga0500595_000123
972 Ga0500595_002608
973 Ga0500595_029766
974 Ga0500607_036285
975 Ga0500608_175544
976 Ga0500614_201423
977 Ga0500626_098445
978 Ga0500658_0036598
979 Ga0500559_0203613
980 Ga0500564_175778
981 Ga0500568_0081522
982 Ga0500568_0387362
983 Ga0500577_0395918
984 Ga0500590_030403
985 Ga0500590_182638
986 Ga0500590_246614
987 Ga0500604_0117229
988 Ga0500627_0130274
989 Ga0500627_0405291
990 Ga0500633_0024256
991 Ga0500638_000491
992 Ga0500639_183120
993 Ga0500636_0004932
994 Ga0500636_0368597
995 Ga0500637_0002568
996 Ga0500609_004903
997 Ga0500599_006735
998 Ga0500601_001506
999 Ga0500661_000418
1000 Ga0500661_047636
1001 2503198816
1002 2507504533
1003 2508545956
1004 2508694809
1005 2509144470
1006 2509393753
1007 2511399521
1008 2513613881
1009 2513638392
1010 2513657590
1011 2513703816
1012 2513861634
1013 2513916843
1014 2517889753
1015 2528849537
1016 2597810772
1017 2599938915
1018 2643774556
1019 2643793001
1020 2643985880
1021 2644154372
1022 2671119605
1023 2728748399
1024 2793063631
1025 2793070265
1026 2824607243
1027 2824616223
1028 2824619483
1029 2824627938
1030 2824659118
1031 2824732428
1032 2839994840
1033 2841736495
1034 2844010900
1035 2847673545
1036 2847690055
1037 2856318986
1038 2856348660
1039 2857514901
1040 2869172381
1041 2869237754
1042 2869247521
1043 2869258751
1044 2871439373
1045 2871448807
1046 2871483317
1047 2871498773
1048 2874103166
1049 2874111478
1050 2874116637
1051 2874126246
1052 2874620094
1053 2876385826
1054 2876389986
1055 2876396918
1056 2876424706
1057 2878039330
1058 2878731131
1059 2878762991
1060 2878769961
1061 2878791923
1062 2881148325
1063 2881165109
1064 2881670309
1065 2882635277
1066 2885306985
1067 2885314011
1068 2885328505
1069 2885340493
1070 2885379238
1071 2888344485
1072 2888427103
1073 2891637498
1074 2903519533
1075 2903543575
1076 2903751201
1077 2904663672
1078 2904695515
1079 2906334085
1080 2906359768
1081 2906402204
1082 2906419057
1083 2906428698
1084 2906614728
1085 2906637472
1086 2906647903
1087 2906661226
1088 2908746440
1089 2908764185
1090 2922133255
1091 2922162534
1092 2922192512
1093 2922426596
1094 2924712767
1095 2924731830
1096 2924740293
1097 2924742809
1098 2924758994
1099 2929622773
1100 2929632123
1101 2932789921
1102 2932796119
1103 2932807695
1104 2932829223
1105 2933584595
1106 2935613063
1107 2935617698
1108 2935632932
1109 2935643743
1110 2935654001
1111 2935662897
1112 2935670947
1113 2935681590
1114 2935692566
1115 2935699179
1116 2935709993
1117 2935721184
1118 2935730822
1119 2935739874
1120 2935748912
1121 2935758782
1122 2935774915
1123 2935792167
1124 2935798664
1125 2935806812
1126 2935817976
1127 2935825085
1128 2935834428
1129 2935843847
1130 2935852304
1131 2935856803
1132 2935868330
1133 2935879640
1134 2935887401
1135 2935910738
1136 2935921918
1137 2935929943
1138 2935937611
1139 2935947990
1140 2935956811
1141 2935970932
1142 2935984438
1143 2935997146
1144 2936009893
1145 2936016906
1146 2936025686
1147 2936034528
1148 2936044626
1149 2936052438
1150 2936055518
1151 2937838929
1152 2937863261
1153 2937898298
1154 2937987802
1155 2937997421
1156 2938017513
1157 2940564628
1158 2941509766
1159 2941517595
1160 2941526452
1161 2941545095
1162 2958034706
1163 2958075326
1164 2958114134
1165 2958120229
1166 2958167895
1167 2958174006
1168 2961119188
1169 2961166363
1170 2961187643
1171 2965021182
1172 2965064234
1173 2965104618
1174 2965126657
1175 2968093336
1176 2968100854
1177 2968114811
1178 2968134078
1179 2968146143
1180 2968174764
1181 2970526204
1182 2970539954
1183 2970547069
1184 2970557846
1185 2970624004
1186 2970632071
1187 2977854436
1188 2977862218
1189 2977869265
1190 2977900304
1191 2977909709
1192 2977977745
1193 2979717308
1194 2979744930
1195 2979766624
1196 2979774529
1197 2979782312
1198 2987662371
1199 2996342751
1200 2996391627
1201 3004191422
1202 3004237251
1203 3004252986
1204 3004272074
1205 3005475942
1206 3005490331
1207 3005595792
1208 3005711760
1209 8004313651
1210 8004396728
1211 8004448634
1212 8004638131
1213 8004706616
1214 8004734780
1215 8016518985
1216 8016525432
1217 8016543310
1218 8016549988
1219 8016581363
1220 8016596390
1221 8016607259
1222 8016630431
1223 8016636687
1224 8017057707
1225 8019538687
1226 8019541255
1227 8019549375
1228 8019561401
1229 8019571480
1230 8019578105
1231 8019596137
1232 8019605554
1233 8019612983
1234 8019653418
1235 8019695508
1236 8055618023
1237 8055750657
1238 8056692156

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08905

DUF1850

Domain of unknown function (DUF1850)

38

124

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ztu-assembly1.cif.gz_C structural basis for processivity and antiviral drug toxicity in human mitochondrial dna replicase 0.768 17 53
2wc9-assembly1.cif.gz_A crystal structure of the g2p (large terminase) nuclease domain from the bacteriophage spp1 with bound mn 0.7409 16 53
1zxn-assembly1.cif.gz_A human dna topoisomerase iia atpase/adp 0.719 17 52
5oea-assembly3.cif.gz_C structure of large terminase from the thermophilic bacteriophage d6e in complex with atp-gamma-s (crystal form 3) 0.7048 21 52
5oee-assembly2.cif.gz_B structure of large terminase from the thermophilic bacteriophage d6e (crystal form 3) 0.703 21 52
ID Description Score Start End Superfamily
af_Q54DW0_157_314_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8595 30 53 3.40.630.30
af_A0A0R0HZ72_353_428_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7905 17 48 3.30.420.10
af_A0A1D6IST8_151_302_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7838 22 48 3.30.420.10
af_Q0DSM5_52_184_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7767 17 40 3.10.450.50
af_P76594_717_886_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7503 28 55 3.40.630.30
ID Description Score Start End GO Terms
AF-I5C1R8-F1-model_v4 DUF1850 domain-containing protein 0.9585 1 118
AF-A0A531KM28-F1-model_v4 DUF1850 domain-containing protein 0.9528 1 109
AF-A0A1Q4BGS9-F1-model_v4 DUF1850 domain-containing protein 0.9471 2 119
AF-A0A8A7U2U7-F1-model_v4 deleted 0.9468 1 119
AF-A0A531KM28-F1-model_v4 DUF1850 domain-containing protein 0.9444 1 109

Map