F469673
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 617 | 381 | 562 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300048922|Ga0496119_0007747|Ga0496119_0007747_410_1084 |
| Length | 224 |
| Sequence | LKPVHPASAFRAGRLRLGYSGCSEASQKPEEEAMTVSIHPSVDNGVRPGRADFAGGTLSCKCAHDPVKVTIKGNVAHNHACGCTKCWKPAGANFSVVAVVPRDNLTVTAHSEKLRIVDPNATIQRYACKECGVHLFGRIENKAHPFYGLDFVHTELSSEDGWAAPEFAAFVSSIIESGFPPSRMGEVRSRLTELGLQPYDALSPPLMDAIATHVAKASGKLAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 4 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 5 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 6 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 7 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 8 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 9 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 10 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 11 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 12 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 13 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 14 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 15 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 16 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 17 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 18 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 19 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 20 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 21 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 22 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 23 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 24 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 25 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 26 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 27 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 28 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 29 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 30 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 31 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 32 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 33 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 34 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 35 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 36 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 37 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 38 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 39 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 40 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 41 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 42 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 43 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 44 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 45 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 46 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 47 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 48 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 49 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 50 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 51 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 52 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 53 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 58 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 60 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 90 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 92 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 93 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 94 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 96 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 97 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 105 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 106 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 107 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 108 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 109 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 114 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 120 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 121 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 191 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 192 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 193 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 194 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 208 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 216 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 221 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 224 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 225 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 294 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 297 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 298 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 299 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 303 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 304 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 305 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 306 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 307 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 308 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 309 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 310 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 311 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 336 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 337 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 343 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 344 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 345 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 347 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 348 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 349 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 350 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 351 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 352 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 353 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 355 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 357 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 358 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 359 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 360 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 361 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 362 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 363 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 364 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 365 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 366 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 367 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 368 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 373 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 374 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 375 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 376 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 377 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 378 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 379 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 380 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 381 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.29 |
| Metatranscriptomes | 1.95 |
| Isolates | 8.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.65 |
| Nodule | 6.97 |
| Rhizoplane | 6.48 |
| Rhizosphere | 73.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006759J45824_1023430 | 3300003163 | Bacteria | 671 |
| 2 | Ga0006770J48903_1023836 | 3300003305 | Bacteria | 613 |
| 3 | Ga0007417J51691_1017275 | 3300003544 | Bacteria | 744 |
| 4 | Ga0007410J51695_1025237 | 3300003574 | Bacteria | 941 |
| 5 | Ga0007409J51694_1017164 | 3300003575 | Bacteria | 1417 |
| 6 | Ga0007429J51699_1065422 | 3300003579 | Bacteria | 812 |
| 7 | Ga0032354_1055850 | 3300003693 | Bacteria | 714 |
| 8 | Ga0058861_10031194 | 3300004800 | Bacteria | 761 |
| 9 | Ga0070676_10101962 | 3300005328 | Bacteria | 1774 |
| 10 | Ga0070690_100005749 | 3300005330 | Bacteria | 6987 |
| 11 | Ga0070670_100322927 | 3300005331 | Bacteria | 1353 |
| 12 | Ga0070670_100650431 | 3300005331 | Bacteria | 946 |
| 13 | Ga0070677_10041315 | 3300005333 | Bacteria | 1820 |
| 14 | Ga0070677_10043910 | 3300005333 | Bacteria | 1777 |
| 15 | Ga0068869_100058999 | 3300005334 | Bacteria | 2808 |
| 16 | Ga0068869_100235870 | 3300005334 | Bacteria | 1455 |
| 17 | Ga0068869_100299598 | 3300005334 | Bacteria | 1298 |
| 18 | Ga0068869_100538193 | 3300005334 | Bacteria | 980 |
| 19 | Ga0070682_100021003 | 3300005337 | Bacteria | 3848 |
| 20 | Ga0070682_100894514 | 3300005337 | Bacteria | 729 |
| 21 | Ga0068868_100039029 | 3300005338 | Bacteria | 3687 |
| 22 | Ga0068868_100270052 | 3300005338 | Bacteria | 1437 |
| 23 | Ga0070689_100001150 | 3300005340 | Bacteria | 16713 |
| 24 | Ga0070689_100760515 | 3300005340 | Bacteria | 850 |
| 25 | Ga0070687_100033649 | 3300005343 | Bacteria | 2532 |
| 26 | Ga0070687_100142902 | 3300005343 | Bacteria | 1396 |
| 27 | Ga0070687_100617489 | 3300005343 | Bacteria | 747 |
| 28 | Ga0070668_100165386 | 3300005347 | Bacteria | 1797 |
| 29 | Ga0070669_100011396 | 3300005353 | Bacteria | 6312 |
| 30 | Ga0070669_100682012 | 3300005353 | Bacteria | 866 |
| 31 | Ga0070675_100066564 | 3300005354 | Bacteria | 2980 |
| 32 | Ga0070675_100094539 | 3300005354 | Bacteria | 2508 |
| 33 | Ga0070675_100135769 | 3300005354 | Bacteria | 2099 |
| 34 | Ga0070671_100285699 | 3300005355 | Bacteria | 1403 |
| 35 | Ga0070674_100011465 | 3300005356 | Bacteria | 5398 |
| 36 | Ga0070674_100106209 | 3300005356 | Bacteria | 2054 |
| 37 | Ga0070674_100516984 | 3300005356 | Bacteria | 997 |
| 38 | Ga0070673_100011520 | 3300005364 | Bacteria | 6038 |
| 39 | Ga0070673_100030355 | 3300005364 | Bacteria | 4043 |
| 40 | Ga0070659_100300975 | 3300005366 | Bacteria | 1337 |
| 41 | Ga0070659_100402544 | 3300005366 | Bacteria | 1156 |
| 42 | Ga0070709_10002670 | 3300005434 | Bacteria | 9635 |
| 43 | Ga0070714_100030639 | 3300005435 | Bacteria | 4480 |
| 44 | Ga0070713_100049060 | 3300005436 | Bacteria | 3481 |
| 45 | Ga0070710_10058601 | 3300005437 | Bacteria | 2185 |
| 46 | Ga0070701_10068760 | 3300005438 | Bacteria | 1888 |
| 47 | Ga0070701_10329259 | 3300005438 | Bacteria | 947 |
| 48 | Ga0070705_100003706 | 3300005440 | Bacteria | 7483 |
| 49 | Ga0070705_100179304 | 3300005440 | Bacteria | 1433 |
| 50 | Ga0070700_100036312 | 3300005441 | Bacteria | 2987 |
| 51 | Ga0070700_100197281 | 3300005441 | Bacteria | 1411 |
| 52 | Ga0070700_100339581 | 3300005441 | Bacteria | 1110 |
| 53 | Ga0070694_100004882 | 3300005444 | Bacteria | 8077 |
| 54 | Ga0070663_100073219 | 3300005455 | Bacteria | 2498 |
| 55 | Ga0070678_100029248 | 3300005456 | Bacteria | 3771 |
| 56 | Ga0070678_100126444 | 3300005456 | Bacteria | 2024 |
| 57 | Ga0070678_100417633 | 3300005456 | Bacteria | 1169 |
| 58 | Ga0070662_100059233 | 3300005457 | Bacteria | 2789 |
| 59 | Ga0070699_100064925 | 3300005518 | Bacteria | 3167 |
| 60 | Ga0070699_100388509 | 3300005518 | Bacteria | 1261 |
| 61 | Ga0070697_100217816 | 3300005536 | Unclassified | 1626 |
| 62 | Ga0068853_100055406 | 3300005539 | Bacteria | 3417 |
| 63 | Ga0070672_100013413 | 3300005543 | Bacteria | 5789 |
| 64 | Ga0070672_100072842 | 3300005543 | Bacteria | 2736 |
| 65 | Ga0070672_100207441 | 3300005543 | Bacteria | 1640 |
| 66 | Ga0070686_100162243 | 3300005544 | Bacteria | 1575 |
| 67 | Ga0070686_100303984 | 3300005544 | Bacteria | 1184 |
| 68 | Ga0070686_100394737 | 3300005544 | Bacteria | 1050 |
| 69 | Ga0070686_100547519 | 3300005544 | Bacteria | 905 |
| 70 | Ga0070695_100013674 | 3300005545 | Bacteria | 4878 |
| 71 | Ga0070693_100157995 | 3300005547 | Bacteria | 1441 |
| 72 | Ga0070693_100729260 | 3300005547 | Bacteria | 728 |
| 73 | Ga0070665_100152388 | 3300005548 | Bacteria | 2314 |
| 74 | Ga0070665_100274245 | 3300005548 | Bacteria | 1688 |
| 75 | Ga0070665_100624465 | 3300005548 | Bacteria | 1091 |
| 76 | Ga0070665_100628579 | 3300005548 | Bacteria | 1087 |
| 77 | Ga0070665_100651833 | 3300005548 | Bacteria | 1066 |
| 78 | Ga0070665_100690568 | 3300005548 | Bacteria | 1034 |
| 79 | Ga0070704_100088418 | 3300005549 | Bacteria | 2302 |
| 80 | Ga0068855_100083690 | 3300005563 | Bacteria | 3695 |
| 81 | Ga0068855_100149625 | 3300005563 | Bacteria | 2655 |
| 82 | Ga0070664_100137841 | 3300005564 | Bacteria | 2146 |
| 83 | Ga0070664_100877307 | 3300005564 | Bacteria | 841 |
| 84 | Ga0068857_100765851 | 3300005577 | Bacteria | 920 |
| 85 | Ga0068857_101068234 | 3300005577 | Bacteria | 779 |
| 86 | Ga0068854_100039540 | 3300005578 | Bacteria | 3324 |
| 87 | Ga0068856_100000050 | 3300005614 | Bacteria | 108220 |
| 88 | Ga0068856_100147817 | 3300005614 | Bacteria | 2357 |
| 89 | Ga0070702_100222647 | 3300005615 | Bacteria | 1262 |
| 90 | Ga0068852_100639319 | 3300005616 | Bacteria | 1071 |
| 91 | Ga0068859_100147415 | 3300005617 | Bacteria | 2429 |
| 92 | Ga0068864_100142183 | 3300005618 | Bacteria | 2166 |
| 93 | Ga0068864_100317351 | 3300005618 | Bacteria | 1463 |
| 94 | Ga0068864_100524187 | 3300005618 | Bacteria | 1143 |
| 95 | Ga0068861_100000527 | 3300005719 | Bacteria | 22405 |
| 96 | Ga0068861_100017283 | 3300005719 | Bacteria | 5117 |
| 97 | Ga0068861_100084824 | 3300005719 | Bacteria | 2487 |
| 98 | Ga0068861_100834839 | 3300005719 | Bacteria | 867 |
| 99 | Ga0068870_10012979 | 3300005840 | Bacteria | 3904 |
| 100 | Ga0068870_10393493 | 3300005840 | Bacteria | 900 |
| 101 | Ga0068863_100069157 | 3300005841 | Bacteria | 3339 |
| 102 | Ga0068863_100175955 | 3300005841 | Bacteria | 2054 |
| 103 | Ga0068863_100360842 | 3300005841 | Bacteria | 1416 |
| 104 | Ga0068858_100085742 | 3300005842 | Bacteria | 2930 |
| 105 | Ga0068858_100222297 | 3300005842 | Bacteria | 1789 |
| 106 | Ga0068862_100046446 | 3300005844 | Bacteria | 3705 |
| 107 | Ga0068862_100576257 | 3300005844 | Bacteria | 1077 |
| 108 | Ga0068862_100938236 | 3300005844 | Bacteria | 853 |
| 109 | Ga0081455_10001291 | 3300005937 | Bacteria | 31153 |
| 110 | Ga0081540_1004281 | 3300005983 | Bacteria | 10946 |
| 111 | Ga0075365_10293234 | 3300006038 | Bacteria | 1145 |
| 112 | Ga0075368_10147300 | 3300006042 | Bacteria | 983 |
| 113 | Ga0075363_100017074 | 3300006048 | Bacteria | 3593 |
| 114 | Ga0075364_10052860 | 3300006051 | Bacteria | 2655 |
| 115 | Ga0075364_10589089 | 3300006051 | Bacteria | 760 |
| 116 | Ga0070716_100308907 | 3300006173 | Bacteria | 1103 |
| 117 | Ga0075367_10071341 | 3300006178 | Bacteria | 2089 |
| 118 | Ga0075369_10062059 | 3300006186 | Bacteria | 1632 |
| 119 | Ga0097621_100004268 | 3300006237 | Bacteria | 9927 |
| 120 | Ga0075370_10048405 | 3300006353 | Bacteria | 2408 |
| 121 | Ga0068871_100054828 | 3300006358 | Bacteria | 3235 |
| 122 | Ga0068871_100273239 | 3300006358 | Bacteria | 1477 |
| 123 | Ga0068871_100418255 | 3300006358 | Bacteria | 1196 |
| 124 | Ga0075434_100011030 | 3300006871 | Bacteria | 8503 |
| 125 | Ga0075434_100014712 | 3300006871 | Bacteria | 7486 |
| 126 | Ga0075434_100097147 | 3300006871 | Bacteria | 2950 |
| 127 | Ga0068865_100018617 | 3300006881 | Bacteria | 4483 |
| 128 | Ga0068865_100112928 | 3300006881 | Bacteria | 2007 |
| 129 | Ga0068865_100577737 | 3300006881 | Bacteria | 947 |
| 130 | Ga0075436_100266614 | 3300006914 | Bacteria | 1222 |
| 131 | Ga0097620_100147400 | 3300006931 | Bacteria | 2429 |
| 132 | Ga0075435_100139090 | 3300007076 | Bacteria | 2036 |
| 133 | Ga0075435_100467920 | 3300007076 | Bacteria | 1088 |
| 134 | Ga0099794_10254534 | 3300007265 | Bacteria | 906 |
| 135 | Ga0111539_10221694 | 3300009094 | Bacteria | 2202 |
| 136 | Ga0105243_10797672 | 3300009148 | Bacteria | 930 |
| 137 | Ga0105241_10028543 | 3300009174 | Bacteria | 4159 |
| 138 | Ga0105242_10241016 | 3300009176 | Bacteria | 1626 |
| 139 | Ga0105248_10187587 | 3300009177 | Bacteria | 2330 |
| 140 | Ga0105248_10383029 | 3300009177 | Bacteria | 1584 |
| 141 | Ga0105248_11017033 | 3300009177 | Bacteria | 936 |
| 142 | Ga0105237_10388731 | 3300009545 | Bacteria | 1400 |
| 143 | Ga0105238_10078735 | 3300009551 | Bacteria | 3286 |
| 144 | Ga0105238_10586568 | 3300009551 | Bacteria | 1121 |
| 145 | Ga0105249_10628574 | 3300009553 | Bacteria | 1130 |
| 146 | Ga0105239_10032029 | 3300010375 | Bacteria | 5778 |
| 147 | Ga0105239_10041589 | 3300010375 | Bacteria | 5037 |
| 148 | Ga0105239_10056868 | 3300010375 | Bacteria | 4290 |
| 149 | Ga0105239_10439379 | 3300010375 | Bacteria | 1479 |
| 150 | Ga0105246_10087483 | 3300011119 | Bacteria | 2237 |
| 151 | Ga0105246_10199204 | 3300011119 | Bacteria | 1555 |
| 152 | Ga0157370_10355250 | 3300013104 | Bacteria | 1351 |
| 153 | Ga0157374_10013357 | 3300013296 | Bacteria | 7167 |
| 154 | Ga0157374_10101374 | 3300013296 | Bacteria | 2761 |
| 155 | Ga0157378_10096348 | 3300013297 | Bacteria | 2696 |
| 156 | Ga0163162_11277380 | 3300013306 | Bacteria | 834 |
| 157 | Ga0163162_11530602 | 3300013306 | Bacteria | 760 |
| 158 | Ga0157375_10663982 | 3300013308 | Bacteria | 1198 |
| 159 | Ga0163163_10191352 | 3300014325 | Bacteria | 2095 |
| 160 | Ga0163163_11282143 | 3300014325 | Bacteria | 795 |
| 161 | Ga0157380_10093387 | 3300014326 | Bacteria | 2488 |
| 162 | Ga0157380_10525822 | 3300014326 | Bacteria | 1155 |
| 163 | Ga0157380_10745759 | 3300014326 | Bacteria | 990 |
| 164 | Ga0157380_11408754 | 3300014326 | Bacteria | 748 |
| 165 | Ga0157380_11759819 | 3300014326 | Bacteria | 678 |
| 166 | Ga0157379_10431027 | 3300014968 | Bacteria | 1215 |
| 167 | Ga0157376_10182387 | 3300014969 | Bacteria | 1920 |
| 168 | Ga0163161_10317464 | 3300017792 | Bacteria | 1231 |
| 169 | Ga0206353_10333827 | 3300020082 | Bacteria | 823 |
| 170 | Ga0213871_10015537 | 3300021441 | Bacteria | 1822 |
| 171 | Ga0207656_10198824 | 3300025321 | Bacteria | 967 |
| 172 | Ga0207682_10006385 | 3300025893 | Bacteria | 4753 |
| 173 | Ga0207682_10066823 | 3300025893 | Bacteria | 1516 |
| 174 | Ga0207682_10081010 | 3300025893 | Bacteria | 1391 |
| 175 | Ga0207642_10314584 | 3300025899 | Bacteria | 912 |
| 176 | Ga0207699_10002666 | 3300025906 | Bacteria | 8432 |
| 177 | Ga0207645_10035317 | 3300025907 | Bacteria | 3210 |
| 178 | Ga0207643_10041620 | 3300025908 | Bacteria | 2589 |
| 179 | Ga0207643_10653097 | 3300025908 | Bacteria | 679 |
| 180 | Ga0207705_10616183 | 3300025909 | Bacteria | 844 |
| 181 | Ga0207654_10016729 | 3300025911 | Bacteria | 3822 |
| 182 | Ga0207662_10266191 | 3300025918 | Bacteria | 1130 |
| 183 | Ga0207662_10268340 | 3300025918 | Bacteria | 1125 |
| 184 | Ga0207662_10318493 | 3300025918 | Bacteria | 1038 |
| 185 | Ga0207649_10130870 | 3300025920 | Bacteria | 1704 |
| 186 | Ga0207649_10722262 | 3300025920 | Bacteria | 774 |
| 187 | Ga0207652_10530857 | 3300025921 | Bacteria | 1058 |
| 188 | Ga0207650_10420601 | 3300025925 | Bacteria | 1109 |
| 189 | Ga0207659_10031789 | 3300025926 | Bacteria | 3617 |
| 190 | Ga0207659_10180346 | 3300025926 | Bacteria | 1673 |
| 191 | Ga0207659_10310832 | 3300025926 | Bacteria | 1297 |
| 192 | Ga0207687_10456219 | 3300025927 | Bacteria | 1061 |
| 193 | Ga0207700_10067759 | 3300025928 | Bacteria | 2733 |
| 194 | Ga0207664_10173951 | 3300025929 | Bacteria | 1844 |
| 195 | Ga0207644_10063995 | 3300025931 | Bacteria | 2672 |
| 196 | Ga0207706_10158590 | 3300025933 | Bacteria | 1990 |
| 197 | Ga0207706_10227494 | 3300025933 | Bacteria | 1632 |
| 198 | Ga0207686_10119918 | 3300025934 | Bacteria | 1789 |
| 199 | Ga0207670_10003275 | 3300025936 | Bacteria | 8578 |
| 200 | Ga0207669_10053305 | 3300025937 | Bacteria | 2435 |
| 201 | Ga0207669_10437815 | 3300025937 | Bacteria | 1033 |
| 202 | Ga0207704_10214552 | 3300025938 | Bacteria | 1419 |
| 203 | Ga0207704_10417891 | 3300025938 | Bacteria | 1062 |
| 204 | Ga0207691_10010191 | 3300025940 | Bacteria | 9016 |
| 205 | Ga0207691_10014947 | 3300025940 | Bacteria | 7395 |
| 206 | Ga0207691_10555885 | 3300025940 | Bacteria | 973 |
| 207 | Ga0207711_10265787 | 3300025941 | Bacteria | 1578 |
| 208 | Ga0207689_10019230 | 3300025942 | Bacteria | 5757 |
| 209 | Ga0207689_10096166 | 3300025942 | Bacteria | 2433 |
| 210 | Ga0207689_10339297 | 3300025942 | Bacteria | 1248 |
| 211 | Ga0207661_10918948 | 3300025944 | Bacteria | 806 |
| 212 | Ga0207679_10294050 | 3300025945 | Bacteria | 1397 |
| 213 | Ga0207679_10640738 | 3300025945 | Bacteria | 960 |
| 214 | Ga0207667_10103780 | 3300025949 | Bacteria | 2932 |
| 215 | Ga0207667_10233982 | 3300025949 | Bacteria | 1881 |
| 216 | Ga0207651_10022430 | 3300025960 | Bacteria | 3860 |
| 217 | Ga0207651_10055919 | 3300025960 | Bacteria | 2713 |
| 218 | Ga0207651_10146487 | 3300025960 | Bacteria | 1832 |
| 219 | Ga0207651_10994862 | 3300025960 | Bacteria | 749 |
| 220 | Ga0207712_10644550 | 3300025961 | Bacteria | 920 |
| 221 | Ga0207668_10345691 | 3300025972 | Bacteria | 1242 |
| 222 | Ga0207668_10708753 | 3300025972 | Bacteria | 885 |
| 223 | Ga0207668_10876441 | 3300025972 | Bacteria | 798 |
| 224 | Ga0207658_10511348 | 3300025986 | Bacteria | 1071 |
| 225 | Ga0207703_10092301 | 3300026035 | Bacteria | 2548 |
| 226 | Ga0207639_10036977 | 3300026041 | Bacteria | 3623 |
| 227 | Ga0207678_10214526 | 3300026067 | Bacteria | 1647 |
| 228 | Ga0207678_10408098 | 3300026067 | Bacteria | 1177 |
| 229 | Ga0207708_10046326 | 3300026075 | Bacteria | 3311 |
| 230 | Ga0207708_10100374 | 3300026075 | Bacteria | 2240 |
| 231 | Ga0207708_10113715 | 3300026075 | Bacteria | 2103 |
| 232 | Ga0207708_10172039 | 3300026075 | Bacteria | 1716 |
| 233 | Ga0207708_10328989 | 3300026075 | Bacteria | 1249 |
| 234 | Ga0207702_10000192 | 3300026078 | Bacteria | 72539 |
| 235 | Ga0207702_10756573 | 3300026078 | Bacteria | 959 |
| 236 | Ga0207641_10131892 | 3300026088 | Bacteria | 2244 |
| 237 | Ga0207641_10132681 | 3300026088 | Bacteria | 2238 |
| 238 | Ga0207641_10264911 | 3300026088 | Bacteria | 1610 |
| 239 | Ga0207641_10965269 | 3300026088 | Bacteria | 848 |
| 240 | Ga0207648_10074116 | 3300026089 | Bacteria | 2966 |
| 241 | Ga0207648_10093102 | 3300026089 | Bacteria | 2636 |
| 242 | Ga0207676_10069809 | 3300026095 | Bacteria | 2815 |
| 243 | Ga0207676_10248613 | 3300026095 | Bacteria | 1599 |
| 244 | Ga0207676_10579574 | 3300026095 | Bacteria | 1075 |
| 245 | Ga0207676_10606789 | 3300026095 | Bacteria | 1052 |
| 246 | Ga0207674_10035147 | 3300026116 | Bacteria | 5231 |
| 247 | Ga0207674_10364702 | 3300026116 | Bacteria | 1396 |
| 248 | Ga0207675_100001153 | 3300026118 | Bacteria | 26238 |
| 249 | Ga0207675_100001636 | 3300026118 | Bacteria | 22459 |
| 250 | Ga0207675_100081273 | 3300026118 | Bacteria | 3038 |
| 251 | Ga0207675_100094886 | 3300026118 | Bacteria | 2806 |
| 252 | Ga0207675_100100260 | 3300026118 | Bacteria | 2728 |
| 253 | Ga0207675_101100700 | 3300026118 | Bacteria | 814 |
| 254 | Ga0207683_10006481 | 3300026121 | Bacteria | 10016 |
| 255 | Ga0207683_10043558 | 3300026121 | Bacteria | 3923 |
| 256 | Ga0207683_10098919 | 3300026121 | Bacteria | 2603 |
| 257 | Ga0207698_10360546 | 3300026142 | Bacteria | 1376 |
| 258 | Ga0207698_11669668 | 3300026142 | Bacteria | 652 |
| 259 | Ga0268266_10233873 | 3300028379 | Bacteria | 1693 |
| 260 | Ga0268266_10352325 | 3300028379 | Bacteria | 1383 |
| 261 | Ga0268266_10473967 | 3300028379 | Bacteria | 1192 |
| 262 | Ga0268266_10606456 | 3300028379 | Bacteria | 1052 |
| 263 | Ga0268266_10913186 | 3300028379 | Bacteria | 849 |
| 264 | Ga0268265_10020656 | 3300028380 | Bacteria | 4600 |
| 265 | Ga0268265_10196756 | 3300028380 | Bacteria | 1745 |
| 266 | Ga0268264_10431565 | 3300028381 | Bacteria | 1273 |
| 267 | Ga0268264_10543158 | 3300028381 | Bacteria | 1139 |
| 268 | Ga0268264_11088929 | 3300028381 | Bacteria | 807 |
| 269 | Ga0307517_10207464 | 3300028786 | Bacteria | 1213 |
| 270 | Ga0307515_10223256 | 3300028794 | Bacteria | 1696 |
| 271 | Ga0311001_1004563 | 3300029277 | Bacteria | 1019 |
| 272 | Ga0307511_10113779 | 3300030521 | Bacteria | 1709 |
| 273 | Ga0265332_10215282 | 3300031238 | Bacteria | 797 |
| 274 | Ga0265327_10001037 | 3300031251 | Bacteria | 39182 |
| 275 | Ga0307513_10039521 | 3300031456 | Bacteria | 5229 |
| 276 | Ga0307513_10075527 | 3300031456 | Bacteria | 3499 |
| 277 | Ga0307513_10338051 | 3300031456 | Bacteria | 1257 |
| 278 | Ga0307509_10086613 | 3300031507 | Bacteria | 3221 |
| 279 | Ga0307509_10116301 | 3300031507 | Bacteria | 2664 |
| 280 | Ga0307509_10130983 | 3300031507 | Bacteria | 2464 |
| 281 | Ga0307405_10087546 | 3300031731 | Bacteria | 2053 |
| 282 | Ga0307413_10005441 | 3300031824 | Bacteria | 5687 |
| 283 | Ga0307413_10218052 | 3300031824 | Bacteria | 1391 |
| 284 | Ga0307413_10293800 | 3300031824 | Bacteria | 1229 |
| 285 | Ga0307406_10008182 | 3300031901 | Bacteria | 5827 |
| 286 | Ga0307412_10157107 | 3300031911 | Bacteria | 1685 |
| 287 | Ga0307409_100678700 | 3300031995 | Bacteria | 1027 |
| 288 | Ga0307416_100109787 | 3300032002 | Bacteria | 2427 |
| 289 | Ga0307416_100181734 | 3300032002 | Bacteria | 1972 |
| 290 | Ga0307416_100559337 | 3300032002 | Bacteria | 1218 |
| 291 | Ga0307414_10531830 | 3300032004 | Bacteria | 1045 |
| 292 | Ga0307411_10018164 | 3300032005 | Bacteria | 4028 |
| 293 | Ga0307411_11234147 | 3300032005 | Bacteria | 679 |
| 294 | Ga0307415_100290464 | 3300032126 | Bacteria | 1349 |
| 295 | Ga0307510_10003003 | 3300033180 | Bacteria | 19416 |
| 296 | Ga0373936_0017350 | 3300035113 | Bacteria | 2771 |
| 297 | Ga0373935_0441763 | 3300035692 | Bacteria | 939 |
| 298 | Ga0395899_0280457 | 3300037312 | Bacteria | 1134 |
| 299 | Ga0395900_0325871 | 3300037418 | Bacteria | 1515 |
| 300 | Ga0395898_0243504 | 3300037466 | Bacteria | 1715 |
| 301 | Ga0395905_0029801 | 3300037471 | Bacteria | 5143 |
| 302 | Ga0395905_0130046 | 3300037471 | Bacteria | 2368 |
| 303 | Ga0395901_0065983 | 3300038443 | Bacteria | 3770 |
| 304 | Ga0436360_0615805 | 3300039438 | Bacteria | 10716 |
| 305 | Ga0451791_1831530 | 3300041451 | Bacteria | 1820 |
| 306 | Ga0451797_1132125 | 3300041453 | Bacteria | 991 |
| 307 | Ga0451798_0828765 | 3300041458 | Bacteria | 843 |
| 308 | Ga0451807_0568922 | 3300041486 | Bacteria | 611 |
| 309 | Ga0451807_2251806 | 3300041486 | Bacteria | 1636 |
| 310 | Ga0451837_0227098 | 3300041494 | Bacteria | 2116 |
| 311 | Ga0451843_1622578 | 3300041509 | Bacteria | 1487 |
| 312 | Ga0466963_0194352 | 3300044694 | Bacteria | 1418 |
| 313 | Ga0466960_0439956 | 3300044901 | Bacteria | 756 |
| 314 | Ga0466967_0369288 | 3300045976 | Bacteria | 1391 |
| 315 | Ga0495617_070387 | 3300046452 | Bacteria | 1150 |
| 316 | Ga0495617_114977 | 3300046452 | Bacteria | 869 |
| 317 | Ga0495592_0005300 | 3300046454 | Bacteria | 9506 |
| 318 | Ga0495603_0005505 | 3300046455 | Bacteria | 7553 |
| 319 | Ga0495590_0001203 | 3300046457 | Bacteria | 11308 |
| 320 | Ga0495590_0023603 | 3300046457 | Bacteria | 2170 |
| 321 | Ga0495629_0107491 | 3300046459 | Bacteria | 1946 |
| 322 | Ga0495629_0121386 | 3300046459 | Bacteria | 1821 |
| 323 | Ga0495638_0010135 | 3300046460 | Bacteria | 6563 |
| 324 | Ga0495638_0028677 | 3300046460 | Bacteria | 3592 |
| 325 | Ga0495638_0069253 | 3300046460 | Bacteria | 2162 |
| 326 | Ga0495638_0157903 | 3300046460 | Bacteria | 1310 |
| 327 | Ga0495638_0205834 | 3300046460 | Bacteria | 1108 |
| 328 | Ga0495651_0344659 | 3300046462 | Bacteria | 986 |
| 329 | Ga0495653_0021415 | 3300046463 | Bacteria | 5238 |
| 330 | Ga0495653_0400871 | 3300046463 | Bacteria | 872 |
| 331 | Ga0495653_0520025 | 3300046463 | Bacteria | 740 |
| 332 | Ga0495582_0143309 | 3300046473 | Bacteria | 1355 |
| 333 | Ga0495584_0071293 | 3300046491 | Bacteria | 1746 |
| 334 | Ga0495584_0133606 | 3300046491 | Bacteria | 1259 |
| 335 | Ga0495585_0043218 | 3300046492 | Bacteria | 2521 |
| 336 | Ga0495594_0018893 | 3300046499 | Bacteria | 3657 |
| 337 | Ga0495594_0052833 | 3300046499 | Bacteria | 2237 |
| 338 | Ga0495594_0086290 | 3300046499 | Bacteria | 1756 |
| 339 | Ga0495596_0015087 | 3300046500 | Bacteria | 3244 |
| 340 | Ga0495596_0142327 | 3300046500 | Bacteria | 931 |
| 341 | Ga0495607_0117011 | 3300046501 | Bacteria | 1405 |
| 342 | Ga0495583_0005576 | 3300046506 | Bacteria | 8494 |
| 343 | Ga0495583_0102792 | 3300046506 | Bacteria | 1218 |
| 344 | Ga0495606_0186421 | 3300046507 | Bacteria | 1192 |
| 345 | Ga0495616_0024626 | 3300046513 | Bacteria | 3226 |
| 346 | Ga0495616_0143055 | 3300046513 | Bacteria | 1087 |
| 347 | Ga0495620_0066811 | 3300046515 | Bacteria | 1481 |
| 348 | Ga0495628_0005560 | 3300046516 | Bacteria | 11034 |
| 349 | Ga0495631_0015029 | 3300046518 | Bacteria | 3720 |
| 350 | Ga0495631_0060815 | 3300046518 | Bacteria | 1638 |
| 351 | Ga0495632_0001958 | 3300046519 | Bacteria | 16420 |
| 352 | Ga0495632_0003345 | 3300046519 | Bacteria | 11420 |
| 353 | Ga0495632_0129966 | 3300046519 | Bacteria | 1172 |
| 354 | Ga0495643_0148528 | 3300046522 | Bacteria | 1162 |
| 355 | Ga0495644_0039836 | 3300046523 | Bacteria | 1771 |
| 356 | Ga0495644_0060302 | 3300046523 | Bacteria | 1426 |
| 357 | Ga0495648_0007875 | 3300046524 | Bacteria | 8467 |
| 358 | Ga0495648_0010475 | 3300046524 | Bacteria | 7058 |
| 359 | Ga0495648_0089586 | 3300046524 | Bacteria | 1726 |
| 360 | Ga0495648_0108236 | 3300046524 | Bacteria | 1518 |
| 361 | Ga0495648_0115684 | 3300046524 | Bacteria | 1450 |
| 362 | Ga0495663_0055752 | 3300046525 | Bacteria | 1233 |
| 363 | Ga0495642_0055221 | 3300046528 | Bacteria | 1639 |
| 364 | Ga0495642_0062421 | 3300046528 | Bacteria | 1547 |
| 365 | Ga0495642_0209445 | 3300046528 | Bacteria | 850 |
| 366 | Ga0495652_0058905 | 3300046529 | Bacteria | 3251 |
| 367 | Ga0495586_0010637 | 3300046535 | Bacteria | 4893 |
| 368 | Ga0495586_0057855 | 3300046535 | Bacteria | 2104 |
| 369 | Ga0495587_0306780 | 3300046536 | Bacteria | 887 |
| 370 | Ga0495598_0046836 | 3300046537 | Bacteria | 1286 |
| 371 | Ga0495609_0070934 | 3300046538 | Bacteria | 1531 |
| 372 | Ga0495609_0114646 | 3300046538 | Bacteria | 1161 |
| 373 | Ga0495621_0145442 | 3300046539 | Bacteria | 930 |
| 374 | Ga0495597_0001562 | 3300046542 | Bacteria | 16186 |
| 375 | Ga0495597_0248746 | 3300046542 | Bacteria | 699 |
| 376 | Ga0495645_0363989 | 3300046543 | Bacteria | 929 |
| 377 | Ga0495622_0052103 | 3300046557 | Bacteria | 1898 |
| 378 | Ga0495633_0166830 | 3300046558 | Bacteria | 1015 |
| 379 | Ga0495668_0002222 | 3300046616 | Bacteria | 16489 |
| 380 | Ga0495668_0025683 | 3300046616 | Bacteria | 3345 |
| 381 | Ga0495668_0043386 | 3300046616 | Bacteria | 2502 |
| 382 | Ga0495611_0041632 | 3300046648 | Bacteria | 2049 |
| 383 | Ga0495611_0062149 | 3300046648 | Bacteria | 1698 |
| 384 | Ga0495625_0009026 | 3300046660 | Bacteria | 8418 |
| 385 | Ga0495625_0086256 | 3300046660 | Bacteria | 2178 |
| 386 | Ga0495625_0338255 | 3300046660 | Bacteria | 954 |
| 387 | Ga0495625_0388298 | 3300046660 | Bacteria | 874 |
| 388 | Ga0495635_0013595 | 3300046663 | Bacteria | 5695 |
| 389 | Ga0495635_0328218 | 3300046663 | Bacteria | 1023 |
| 390 | Ga0495661_0004355 | 3300046665 | Bacteria | 10242 |
| 391 | Ga0495661_0029564 | 3300046665 | Bacteria | 3495 |
| 392 | Ga0495661_0082498 | 3300046665 | Bacteria | 1850 |
| 393 | Ga0495661_0084522 | 3300046665 | Bacteria | 1821 |
| 394 | Ga0495661_0134158 | 3300046665 | Bacteria | 1353 |
| 395 | Ga0495661_0170061 | 3300046665 | Bacteria | 1163 |
| 396 | Ga0495588_0009132 | 3300046674 | Bacteria | 4572 |
| 397 | Ga0495599_0075253 | 3300046678 | Bacteria | 2108 |
| 398 | Ga0495658_0450449 | 3300046683 | Bacteria | 822 |
| 399 | Ga0495669_0001187 | 3300046684 | Bacteria | 10831 |
| 400 | Ga0495671_0008818 | 3300046692 | Bacteria | 5663 |
| 401 | Ga0495671_0133109 | 3300046692 | Bacteria | 1212 |
| 402 | Ga0495649_0057787 | 3300046694 | Bacteria | 2091 |
| 403 | Ga0495649_0066863 | 3300046694 | Bacteria | 1928 |
| 404 | Ga0495649_0083155 | 3300046694 | Bacteria | 1710 |
| 405 | Ga0495660_0053919 | 3300046810 | Bacteria | 2180 |
| 406 | Ga0495604_0069951 | 3300047317 | Bacteria | 2659 |
| 407 | Ga0495636_0127131 | 3300047318 | Bacteria | 1132 |
| 408 | Ga0495672_0000198 | 3300047320 | Bacteria | 85895 |
| 409 | Ga0495672_0072576 | 3300047320 | Bacteria | 1944 |
| 410 | Ga0495672_0122360 | 3300047320 | Bacteria | 1381 |
| 411 | Ga0495680_0011678 | 3300047322 | Bacteria | 7758 |
| 412 | Ga0495683_0028068 | 3300047323 | Bacteria | 2877 |
| 413 | Ga0495683_0175401 | 3300047323 | Bacteria | 982 |
| 414 | Ga0495687_002705 | 3300047443 | Bacteria | 13754 |
| 415 | Ga0495687_009929 | 3300047443 | Bacteria | 5267 |
| 416 | Ga0495675_0024518 | 3300047444 | Bacteria | 3846 |
| 417 | Ga0495673_0031927 | 3300047469 | Bacteria | 2462 |
| 418 | Ga0495681_0015665 | 3300047470 | Bacteria | 4281 |
| 419 | Ga0495593_0002952 | 3300047673 | Bacteria | 10235 |
| 420 | Ga0495602_0096813 | 3300048088 | Bacteria | 2433 |
| 421 | Ga0495614_0005712 | 3300048089 | Bacteria | 5606 |
| 422 | Ga0495626_0036804 | 3300048091 | Bacteria | 2329 |
| 423 | Ga0495626_0056762 | 3300048091 | Bacteria | 1792 |
| 424 | Ga0495626_0241855 | 3300048091 | Bacteria | 726 |
| 425 | Ga0496100_0021811 | 3300048903 | Bacteria | 3864 |
| 426 | Ga0496100_0146503 | 3300048903 | Bacteria | 1680 |
| 427 | Ga0496101_0029250 | 3300048904 | Bacteria | 3853 |
| 428 | Ga0496101_0380670 | 3300048904 | Bacteria | 1110 |
| 429 | Ga0496102_0367327 | 3300048905 | Bacteria | 1354 |
| 430 | Ga0496103_0101306 | 3300048906 | Bacteria | 1823 |
| 431 | Ga0496103_0506660 | 3300048906 | Bacteria | 772 |
| 432 | Ga0496104_0001311 | 3300048907 | Bacteria | 21463 |
| 433 | Ga0496104_0162793 | 3300048907 | Bacteria | 2140 |
| 434 | Ga0496104_0705073 | 3300048907 | Bacteria | 917 |
| 435 | Ga0496105_0000231 | 3300048908 | Bacteria | 37741 |
| 436 | Ga0496106_0129368 | 3300048909 | Bacteria | 1979 |
| 437 | Ga0496107_0128129 | 3300048910 | Bacteria | 1872 |
| 438 | Ga0496107_0182717 | 3300048910 | Bacteria | 1557 |
| 439 | Ga0496107_0332730 | 3300048910 | Bacteria | 1130 |
| 440 | Ga0496107_0518406 | 3300048910 | Bacteria | 884 |
| 441 | Ga0496108_0177753 | 3300048911 | Bacteria | 1843 |
| 442 | Ga0496108_0193352 | 3300048911 | Bacteria | 1764 |
| 443 | Ga0496109_0024245 | 3300048912 | Bacteria | 5392 |
| 444 | Ga0496109_0056961 | 3300048912 | Bacteria | 3566 |
| 445 | Ga0496110_0033205 | 3300048913 | Bacteria | 4462 |
| 446 | Ga0496110_0078155 | 3300048913 | Bacteria | 2946 |
| 447 | Ga0496110_0094867 | 3300048913 | Bacteria | 2671 |
| 448 | Ga0496111_0032506 | 3300048914 | Bacteria | 3720 |
| 449 | Ga0496111_0269657 | 3300048914 | Bacteria | 1263 |
| 450 | Ga0496111_0281341 | 3300048914 | Bacteria | 1234 |
| 451 | Ga0496112_0026997 | 3300048915 | Bacteria | 5534 |
| 452 | Ga0496112_0236304 | 3300048915 | Bacteria | 1781 |
| 453 | Ga0496112_0666718 | 3300048915 | Bacteria | 969 |
| 454 | Ga0496113_0051563 | 3300048916 | Bacteria | 3071 |
| 455 | Ga0496113_0086445 | 3300048916 | Bacteria | 2410 |
| 456 | Ga0496114_0170041 | 3300048917 | Bacteria | 1899 |
| 457 | Ga0496115_0000077 | 3300048918 | Bacteria | 89885 |
| 458 | Ga0496115_0021945 | 3300048918 | Bacteria | 4937 |
| 459 | Ga0496115_0029788 | 3300048918 | Bacteria | 4290 |
| 460 | Ga0496116_0180337 | 3300048919 | Bacteria | 1132 |
| 461 | Ga0496117_0065160 | 3300048920 | Bacteria | 2479 |
| 462 | Ga0496118_0064618 | 3300048921 | Bacteria | 2684 |
| 463 | Ga0496119_0007747 | 3300048922 | Bacteria | 9590 |
| 464 | Ga0496122_0009572 | 3300048925 | Bacteria | 10167 |
| 465 | Ga0496123_0003835 | 3300048926 | Bacteria | 16396 |
| 466 | Ga0496124_0123556 | 3300048927 | Bacteria | 2065 |
| 467 | Ga0496124_0520289 | 3300048927 | Bacteria | 793 |
| 468 | Ga0496125_0008961 | 3300048928 | Bacteria | 10379 |
| 469 | Ga0496125_0113643 | 3300048928 | Bacteria | 1953 |
| 470 | Ga0496125_0201030 | 3300048928 | Bacteria | 1304 |
| 471 | Ga0496126_0000047 | 3300048929 | Bacteria | 322212 |
| 472 | Ga0496126_0246633 | 3300048929 | Bacteria | 1490 |
| 473 | Ga0495678_002103 | 3300049459 | Bacteria | 14125 |
| 474 | Ga0495678_002762 | 3300049459 | Bacteria | 11486 |
| 475 | Ga0495682_0003783 | 3300049460 | Bacteria | 6657 |
| 476 | Ga0495682_0047474 | 3300049460 | Bacteria | 1566 |
| 477 | Ga0495682_0050840 | 3300049460 | Bacteria | 1508 |
| 478 | Ga0501032_0040051 | 3300049569 | Bacteria | 3185 |
| 479 | Ga0501032_0101876 | 3300049569 | Bacteria | 1902 |
| 480 | Ga0501033_0000821 | 3300049570 | Bacteria | 28339 |
| 481 | Ga0501033_0140968 | 3300049570 | Bacteria | 1742 |
| 482 | Ga0501033_0780855 | 3300049570 | Bacteria | 647 |
| 483 | Ga0501034_0003942 | 3300049571 | Bacteria | 16678 |
| 484 | Ga0501034_0597849 | 3300049571 | Bacteria | 1009 |
| 485 | Ga0501034_0646675 | 3300049571 | Bacteria | 959 |
| 486 | Ga0501037_0012293 | 3300049573 | Bacteria | 6300 |
| 487 | Ga0501038_0017815 | 3300049574 | Bacteria | 6417 |
| 488 | Ga0501038_0241439 | 3300049574 | Bacteria | 1434 |
| 489 | Ga0501039_0001831 | 3300049575 | Bacteria | 15724 |
| 490 | Ga0501043_0032490 | 3300049579 | Bacteria | 4103 |
| 491 | Ga0501046_0004676 | 3300049580 | Bacteria | 12355 |
| 492 | Ga0501067_0198900 | 3300049583 | Bacteria | 1116 |
| 493 | Ga0501067_0457279 | 3300049583 | Bacteria | 713 |
| 494 | Ga0501068_0170991 | 3300049584 | Bacteria | 1371 |
| 495 | Ga0501070_0049983 | 3300049586 | Bacteria | 3471 |
| 496 | Ga0501071_0020230 | 3300049587 | Bacteria | 4624 |
| 497 | Ga0501072_0549087 | 3300049588 | Bacteria | 912 |
| 498 | Ga0501073_0010684 | 3300049589 | Bacteria | 6723 |
| 499 | Ga0501073_0022274 | 3300049589 | Bacteria | 4564 |
| 500 | Ga0501073_0355538 | 3300049589 | Bacteria | 1011 |
| 501 | Ga0501074_0181048 | 3300049590 | Bacteria | 1503 |
| 502 | Ga0501076_0119653 | 3300049592 | Bacteria | 2132 |
| 503 | Ga0501076_0379484 | 3300049592 | Bacteria | 1162 |
| 504 | Ga0501076_0474927 | 3300049592 | Bacteria | 1030 |
| 505 | Ga0501077_0081002 | 3300049593 | Bacteria | 2056 |
| 506 | Ga0501079_0035049 | 3300049741 | Bacteria | 3861 |
| 507 | Ga0501079_0048283 | 3300049741 | Bacteria | 3285 |
| 508 | Ga0501080_0004373 | 3300049742 | Bacteria | 12549 |
| 509 | Ga0501080_0078606 | 3300049742 | Bacteria | 3067 |
| 510 | Ga0501080_0289822 | 3300049742 | Bacteria | 1486 |
| 511 | Ga0501080_0463337 | 3300049742 | Bacteria | 1135 |
| 512 | Ga0501035_0053746 | 3300049822 | Bacteria | 3601 |
| 513 | Ga0501035_0329865 | 3300049822 | Bacteria | 1280 |
| 514 | nmdc:mga03683_211327_c1 | 3300050489 | Bacteria | 893 |
| 515 | nmdc:mga00v17_112371_c1 | 3300050491 | Bacteria | 1729 |
| 516 | nmdc:mga06z11_72338_c1 | 3300050494 | Bacteria | 1828 |
| 517 | nmdc:mga04h51_95348_c1 | 3300050495 | Bacteria | 1077 |
| 518 | nmdc:mga08y16_65452_c1 | 3300050511 | Bacteria | 3795 |
| 519 | nmdc:mga0n895_1048_c1 | 3300050512 | Bacteria | 20116 |
| 520 | nmdc:mga0n895_12069_c1 | 3300050512 | Bacteria | 7732 |
| 521 | nmdc:mga0n895_80031_c1 | 3300050512 | Bacteria | 3255 |
| 522 | nmdc:mga0rr50_124533_c1 | 3300050513 | Bacteria | 2056 |
| 523 | nmdc:mga0rr50_231_c1 | 3300050513 | Bacteria | 30232 |
| 524 | nmdc:mga08x19_12588_c1 | 3300050514 | Bacteria | 5101 |
| 525 | nmdc:mga08x19_298344_c1 | 3300050514 | Bacteria | 1119 |
| 526 | nmdc:mga0a205_1314_c1 | 3300050515 | Bacteria | 20915 |
| 527 | nmdc:mga0a205_14878_c1 | 3300050515 | Bacteria | 7261 |
| 528 | nmdc:mga0a205_616697_c1 | 3300050515 | Bacteria | 937 |
| 529 | nmdc:mga0sz30_73293_c1 | 3300050516 | Bacteria | 1476 |
| 530 | Ga0500635_0057466 | 3300053080 | Bacteria | 1349 |
| 531 | Ga0500578_0174604 | 3300053086 | Bacteria | 1327 |
| 532 | Ga0500644_0095452 | 3300053088 | Bacteria | 1121 |
| 533 | Ga0500644_0130828 | 3300053088 | Bacteria | 988 |
| 534 | Ga0500566_0000027 | 3300053094 | Bacteria | 76335 |
| 535 | Ga0500566_0356031 | 3300053094 | Bacteria | 669 |
| 536 | Ga0500640_000045 | 3300053095 | Bacteria | 18616 |
| 537 | Ga0500558_229787 | 3300053106 | Bacteria | 624 |
| 538 | Ga0500572_000514 | 3300053111 | Bacteria | 13208 |
| 539 | Ga0500572_001152 | 3300053111 | Bacteria | 7642 |
| 540 | Ga0500582_055327 | 3300053114 | Bacteria | 1315 |
| 541 | Ga0500595_003720 | 3300053119 | Bacteria | 7034 |
| 542 | Ga0500608_018872 | 3300053122 | Bacteria | 3153 |
| 543 | Ga0500618_036625 | 3300053125 | Bacteria | 1136 |
| 544 | Ga0500642_0096285 | 3300053130 | Bacteria | 1372 |
| 545 | Ga0500658_0017757 | 3300053134 | Bacteria | 2660 |
| 546 | Ga0500559_0002844 | 3300053136 | Bacteria | 8743 |
| 547 | Ga0500577_0031216 | 3300053142 | Bacteria | 1862 |
| 548 | Ga0500590_074254 | 3300053148 | Bacteria | 1684 |
| 549 | Ga0500603_002960 | 3300053150 | Bacteria | 3673 |
| 550 | Ga0500622_0110518 | 3300053156 | Bacteria | 1343 |
| 551 | Ga0500630_002280 | 3300053159 | Bacteria | 9271 |
| 552 | Ga0500634_0151880 | 3300053161 | Bacteria | 1081 |
| 553 | Ga0500639_000003 | 3300053163 | Bacteria | 230428 |
| 554 | Ga0500576_230620 | 3300053725 | Bacteria | 597 |
| 555 | Ga0500645_083578 | 3300053730 | Bacteria | 910 |
| 556 | Ga0500596_004250 | 3300053735 | Bacteria | 2646 |
| 557 | Ga0500587_020594 | 3300053739 | Bacteria | 860 |
| 558 | Ga0501084_0366044 | 3300054114 | Bacteria | 1218 |
| 559 | Ga0587078_011609 | 3300059646 | Bacteria | 1025 |
| 560 | Ga0587079_087795 | 3300059647 | Bacteria | 722 |
| 561 | Ga0501082_0103223 | 3300060353 | Bacteria | 2466 |
| 562 | Ga0501082_0221498 | 3300060353 | Bacteria | 1646 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041486 | Ga0451807_0568922 | Ga0451807_0568922_59_535 | 155 |
| 2 | iso_pu_bacteria | 2507262055 | 2507510743 | 182 |
| 3 | iso_pu_bacteria | 2508501042 | 2508697310 | 182 |
| 4 | iso_pu_bacteria | 2513237098 | 2513672097 | 182 |
| 5 | iso_pu_bacteria | 2517093001 | 2517105099 | 182 |
| 6 | iso_pu_bacteria | 2524023205 | 2524437133 | 182 |
| 7 | iso_pu_bacteria | 2524023210 | 2524463877 | 182 |
| 8 | iso_pu_bacteria | 2528768022 | 2528854285 | 182 |
| 9 | iso_pu_bacteria | 2728368998 | 2728753424 | 182 |
| 10 | iso_pu_bacteria | 2744054633 | 2745076346 | 182 |
| 11 | iso_pu_bacteria | 2824704595 | 2824707884 | 182 |
| 12 | iso_pu_bacteria | 2824753945 | 2824759024 | 182 |
| 13 | iso_pu_bacteria | 2824763712 | 2824763912 | 182 |
| 14 | iso_pu_bacteria | 2885374607 | 2885376682 | 182 |
| 15 | iso_pu_bacteria | 2885383462 | 2885387914 | 182 |
| 16 | iso_pu_bacteria | 2903768456 | 2903771306 | 182 |
| 17 | iso_pu_bacteria | 2904711408 | 2904720504 | 182 |
| 18 | iso_pu_bacteria | 2929615660 | 2929616839 | 182 |
| 19 | iso_pu_bacteria | 2929624759 | 2929625582 | 182 |
| 20 | iso_pu_bacteria | 2933577622 | 2933577879 | 182 |
| 21 | iso_pu_bacteria | 2935608549 | 2935616078 | 182 |
| 22 | iso_pu_bacteria | 2935648319 | 2935654903 | 182 |
| 23 | iso_pu_bacteria | 2935656913 | 2935663827 | 182 |
| 24 | iso_pu_bacteria | 2935819856 | 2935819974 | 182 |
| 25 | iso_pu_bacteria | 2935847175 | 2935850016 | 182 |
| 26 | iso_pu_bacteria | 2935908558 | 2935915167 | 182 |
| 27 | iso_pu_bacteria | 2935916978 | 2935923844 | 182 |
| 28 | iso_pu_bacteria | 2935926038 | 2935932664 | 182 |
| 29 | iso_pu_bacteria | 2935934488 | 2935941252 | 182 |
| 30 | iso_pu_bacteria | 2935942939 | 2935949334 | 182 |
| 31 | iso_pu_bacteria | 2935951376 | 2935958029 | 182 |
| 32 | iso_pu_bacteria | 2935967501 | 2935974329 | 182 |
| 33 | iso_pu_bacteria | 2935984226 | 2935991622 | 182 |
| 34 | iso_pu_bacteria | 2936011229 | 2936017983 | 182 |
| 35 | iso_pu_bacteria | 2936019824 | 2936026486 | 182 |
| 36 | iso_pu_bacteria | 2936028420 | 2936035107 | 182 |
| 37 | iso_pu_bacteria | 2936046547 | 2936053257 | 182 |
| 38 | iso_pu_bacteria | 2936055302 | 2936059240 | 182 |
| 39 | iso_pu_bacteria | 8016630954 | 8016633561 | 182 |
| 40 | iso_pu_bacteria | 8019648815 | 8019655849 | 182 |
| 41 | iso_pu_bacteria | 8019687851 | 8019693536 | 182 |
| 42 | iso_pu_bacteria | 8055742211 | 8055748485 | 182 |
| 43 | iso_pu_bacteria | 8056681323 | 8056682055 | 182 |
| 44 | iso_pu_bacteria | 8056689827 | 8056694520 | 182 |
| 45 | iso_pu_bacteria | 2721755755 | 2723846817 | 184 |
| 46 | iso_pu_bacteria | 2791355199 | 2793076429 | 184 |
| 47 | iso_pu_bacteria | 2874604998 | 2874611223 | 184 |
| 48 | iso_pu_bacteria | 2876808645 | 2876816666 | 184 |
| 49 | iso_pu_bacteria | 2879110137 | 2879114357 | 184 |
| 50 | iso_pu_bacteria | 2889033259 | 2889038393 | 184 |
| 51 | iso_pu_bacteria | 2922361189 | 2922362509 | 184 |
| 52 | iso_pu_bacteria | 2922386360 | 2922387670 | 184 |
| 53 | iso_pu_bacteria | 8006964411 | 8006969005 | 184 |
| 54 | iso_pu_bacteria | 8006984368 | 8006987556 | 184 |
| 55 | iso_pu_bacteria | 8006994254 | 8006995051 | 184 |
| 56 | iso_pu_bacteria | 8056673599 | 8056679611 | 184 |
| 57 | 3300005577 | Ga0068857_101068234 | Ga0068857_1010682341 | 185 |
| 58 | 3300046616 | Ga0495668_0002222 | Ga0495668_0002222_9572_10132 | 185 |
| 59 | 3300048929 | Ga0496126_0246633 | Ga0496126_0246633_16_576 | 185 |
| 60 | 3300053125 | Ga0500618_036625 | Ga0500618_036625_271_837 | 185 |
| 61 | 3300005614 | Ga0068856_100000050 | Ga0068856_10000005037 | 186 |
| 62 | 3300005983 | Ga0081540_1004281 | Ga0081540_10042814 | 186 |
| 63 | 3300006178 | Ga0075367_10071341 | Ga0075367_100713412 | 186 |
| 64 | 3300006871 | Ga0075434_100011030 | Ga0075434_1000110304 | 186 |
| 65 | 3300006914 | Ga0075436_100266614 | Ga0075436_1002666142 | 186 |
| 66 | 3300020082 | Ga0206353_10333827 | Ga0206353_103338272 | 186 |
| 67 | 3300026078 | Ga0207702_10000192 | Ga0207702_1000019236 | 186 |
| 68 | 3300035113 | Ga0373936_0017350 | Ga0373936_0017350_1178_1741 | 186 |
| 69 | 3300049569 | Ga0501032_0040051 | Ga0501032_0040051_644_1210 | 186 |
| 70 | 3300049570 | Ga0501033_0000821 | Ga0501033_0000821_20098_20664 | 186 |
| 71 | 3300049571 | Ga0501034_0003942 | Ga0501034_0003942_6518_7084 | 186 |
| 72 | 3300049573 | Ga0501037_0012293 | Ga0501037_0012293_5575_6141 | 186 |
| 73 | 3300049574 | Ga0501038_0017815 | Ga0501038_0017815_4615_5181 | 186 |
| 74 | 3300049574 | Ga0501038_0241439 | Ga0501038_0241439_555_1121 | 186 |
| 75 | 3300049575 | Ga0501039_0001831 | Ga0501039_0001831_14244_14810 | 186 |
| 76 | 3300049580 | Ga0501046_0004676 | Ga0501046_0004676_6990_7556 | 186 |
| 77 | 3300049583 | Ga0501067_0198900 | Ga0501067_0198900_320_886 | 186 |
| 78 | 3300049586 | Ga0501070_0049983 | Ga0501070_0049983_1976_2542 | 186 |
| 79 | 3300049589 | Ga0501073_0022274 | Ga0501073_0022274_1976_2542 | 186 |
| 80 | 3300049590 | Ga0501074_0181048 | Ga0501074_0181048_326_892 | 186 |
| 81 | 3300049592 | Ga0501076_0474927 | Ga0501076_0474927_420_986 | 186 |
| 82 | 3300049741 | Ga0501079_0048283 | Ga0501079_0048283_1452_2018 | 186 |
| 83 | 3300049742 | Ga0501080_0078606 | Ga0501080_0078606_1525_2091 | 186 |
| 84 | 3300049822 | Ga0501035_0053746 | Ga0501035_0053746_1981_2547 | 186 |
| 85 | 3300050512 | nmdc:mga0n895_12069_c1 | nmdc:mga0n895_12069_c1_6090_6653 | 186 |
| 86 | 3300050514 | nmdc:mga08x19_298344_c1 | nmdc:mga08x19_298344_c1_297_860 | 186 |
| 87 | 3300053080 | Ga0500635_0057466 | Ga0500635_0057466_563_1126 | 186 |
| 88 | 3300053094 | Ga0500566_0000027 | Ga0500566_0000027_19811_20374 | 186 |
| 89 | 3300053095 | Ga0500640_000045 | Ga0500640_000045_25_588 | 186 |
| 90 | 3300053111 | Ga0500572_001152 | Ga0500572_001152_2452_3015 | 186 |
| 91 | 3300053122 | Ga0500608_018872 | Ga0500608_018872_1037_1600 | 186 |
| 92 | 3300053136 | Ga0500559_0002844 | Ga0500559_0002844_98_661 | 186 |
| 93 | 3300053148 | Ga0500590_074254 | Ga0500590_074254_506_1069 | 186 |
| 94 | 3300053150 | Ga0500603_002960 | Ga0500603_002960_2209_2772 | 186 |
| 95 | 3300053159 | Ga0500630_002280 | Ga0500630_002280_612_1175 | 186 |
| 96 | 3300053163 | Ga0500639_000003 | Ga0500639_000003_86811_87374 | 186 |
| 97 | 3300053725 | Ga0500576_230620 | Ga0500576_230620_11_574 | 186 |
| 98 | 3300053735 | Ga0500596_004250 | Ga0500596_004250_354_917 | 186 |
| 99 | 3300060353 | Ga0501082_0221498 | Ga0501082_0221498_766_1332 | 186 |
| 100 | 3300005334 | Ga0068869_100538193 | Ga0068869_1005381932 | 187 |
| 101 | 3300005343 | Ga0070687_100617489 | Ga0070687_1006174891 | 187 |
| 102 | 3300005544 | Ga0070686_100303984 | Ga0070686_1003039842 | 187 |
| 103 | 3300005563 | Ga0068855_100149625 | Ga0068855_1001496253 | 187 |
| 104 | 3300005564 | Ga0070664_100137841 | Ga0070664_1001378413 | 187 |
| 105 | 3300005578 | Ga0068854_100039540 | Ga0068854_1000395403 | 187 |
| 106 | 3300005840 | Ga0068870_10393493 | Ga0068870_103934932 | 187 |
| 107 | 3300006237 | Ga0097621_100004268 | Ga0097621_1000042688 | 187 |
| 108 | 3300006358 | Ga0068871_100273239 | Ga0068871_1002732392 | 187 |
| 109 | 3300025908 | Ga0207643_10653097 | Ga0207643_106530972 | 187 |
| 110 | 3300025949 | Ga0207667_10103780 | Ga0207667_101037802 | 187 |
| 111 | 3300025972 | Ga0207668_10708753 | Ga0207668_107087532 | 187 |
| 112 | 3300026067 | Ga0207678_10408098 | Ga0207678_104080981 | 187 |
| 113 | 3300026095 | Ga0207676_10606789 | Ga0207676_106067892 | 187 |
| 114 | 3300028381 | Ga0268264_10431565 | Ga0268264_104315652 | 187 |
| 115 | 3300031507 | Ga0307509_10086613 | Ga0307509_100866133 | 187 |
| 116 | 3300037466 | Ga0395898_0243504 | Ga0395898_0243504_216_794 | 187 |
| 117 | 3300037471 | Ga0395905_0029801 | Ga0395905_0029801_4068_4646 | 187 |
| 118 | 3300038443 | Ga0395901_0065983 | Ga0395901_0065983_237_815 | 187 |
| 119 | 3300046460 | Ga0495638_0205834 | Ga0495638_0205834_315_893 | 187 |
| 120 | 3300046463 | Ga0495653_0021415 | Ga0495653_0021415_111_683 | 187 |
| 121 | 3300046491 | Ga0495584_0071293 | Ga0495584_0071293_198_770 | 187 |
| 122 | 3300046499 | Ga0495594_0018893 | Ga0495594_0018893_2121_2699 | 187 |
| 123 | 3300046499 | Ga0495594_0052833 | Ga0495594_0052833_1260_1838 | 187 |
| 124 | 3300046500 | Ga0495596_0015087 | Ga0495596_0015087_1237_1809 | 187 |
| 125 | 3300046500 | Ga0495596_0142327 | Ga0495596_0142327_167_745 | 187 |
| 126 | 3300046501 | Ga0495607_0117011 | Ga0495607_0117011_402_974 | 187 |
| 127 | 3300046506 | Ga0495583_0005576 | Ga0495583_0005576_3172_3744 | 187 |
| 128 | 3300046513 | Ga0495616_0143055 | Ga0495616_0143055_197_769 | 187 |
| 129 | 3300046518 | Ga0495631_0015029 | Ga0495631_0015029_175_753 | 187 |
| 130 | 3300046518 | Ga0495631_0060815 | Ga0495631_0060815_582_1154 | 187 |
| 131 | 3300046519 | Ga0495632_0001958 | Ga0495632_0001958_6181_6753 | 187 |
| 132 | 3300046519 | Ga0495632_0003345 | Ga0495632_0003345_9393_9965 | 187 |
| 133 | 3300046522 | Ga0495643_0148528 | Ga0495643_0148528_445_1023 | 187 |
| 134 | 3300046523 | Ga0495644_0039836 | Ga0495644_0039836_310_888 | 187 |
| 135 | 3300046523 | Ga0495644_0060302 | Ga0495644_0060302_364_936 | 187 |
| 136 | 3300046524 | Ga0495648_0007875 | Ga0495648_0007875_7862_8440 | 187 |
| 137 | 3300046524 | Ga0495648_0108236 | Ga0495648_0108236_243_815 | 187 |
| 138 | 3300046524 | Ga0495648_0115684 | Ga0495648_0115684_551_1123 | 187 |
| 139 | 3300046525 | Ga0495663_0055752 | Ga0495663_0055752_470_1048 | 187 |
| 140 | 3300046528 | Ga0495642_0055221 | Ga0495642_0055221_190_768 | 187 |
| 141 | 3300046528 | Ga0495642_0209445 | Ga0495642_0209445_142_720 | 187 |
| 142 | 3300046535 | Ga0495586_0010637 | Ga0495586_0010637_821_1399 | 187 |
| 143 | 3300046536 | Ga0495587_0306780 | Ga0495587_0306780_121_693 | 187 |
| 144 | 3300046538 | Ga0495609_0070934 | Ga0495609_0070934_777_1355 | 187 |
| 145 | 3300046542 | Ga0495597_0001562 | Ga0495597_0001562_6198_6770 | 187 |
| 146 | 3300046648 | Ga0495611_0062149 | Ga0495611_0062149_550_1128 | 187 |
| 147 | 3300046660 | Ga0495625_0086256 | Ga0495625_0086256_1276_1854 | 187 |
| 148 | 3300046660 | Ga0495625_0338255 | Ga0495625_0338255_153_731 | 187 |
| 149 | 3300046660 | Ga0495625_0388298 | Ga0495625_0388298_12_590 | 187 |
| 150 | 3300046663 | Ga0495635_0013595 | Ga0495635_0013595_2268_2846 | 187 |
| 151 | 3300046665 | Ga0495661_0004355 | Ga0495661_0004355_9353_9931 | 187 |
| 152 | 3300046665 | Ga0495661_0029564 | Ga0495661_0029564_1222_1800 | 187 |
| 153 | 3300046665 | Ga0495661_0082498 | Ga0495661_0082498_717_1289 | 187 |
| 154 | 3300046665 | Ga0495661_0084522 | Ga0495661_0084522_1079_1657 | 187 |
| 155 | 3300046665 | Ga0495661_0170061 | Ga0495661_0170061_258_836 | 187 |
| 156 | 3300046674 | Ga0495588_0009132 | Ga0495588_0009132_167_745 | 187 |
| 157 | 3300046684 | Ga0495669_0001187 | Ga0495669_0001187_9547_10125 | 187 |
| 158 | 3300046692 | Ga0495671_0008818 | Ga0495671_0008818_4915_5487 | 187 |
| 159 | 3300046694 | Ga0495649_0057787 | Ga0495649_0057787_1138_1710 | 187 |
| 160 | 3300046694 | Ga0495649_0066863 | Ga0495649_0066863_1148_1726 | 187 |
| 161 | 3300046694 | Ga0495649_0083155 | Ga0495649_0083155_915_1487 | 187 |
| 162 | 3300046810 | Ga0495660_0053919 | Ga0495660_0053919_1091_1663 | 187 |
| 163 | 3300047317 | Ga0495604_0069951 | Ga0495604_0069951_1118_1696 | 187 |
| 164 | 3300047318 | Ga0495636_0127131 | Ga0495636_0127131_395_973 | 187 |
| 165 | 3300047320 | Ga0495672_0122360 | Ga0495672_0122360_266_844 | 187 |
| 166 | 3300047322 | Ga0495680_0011678 | Ga0495680_0011678_970_1548 | 187 |
| 167 | 3300047323 | Ga0495683_0028068 | Ga0495683_0028068_224_796 | 187 |
| 168 | 3300047323 | Ga0495683_0175401 | Ga0495683_0175401_315_893 | 187 |
| 169 | 3300047443 | Ga0495687_002705 | Ga0495687_002705_3695_4273 | 187 |
| 170 | 3300047444 | Ga0495675_0024518 | Ga0495675_0024518_1275_1853 | 187 |
| 171 | 3300047470 | Ga0495681_0015665 | Ga0495681_0015665_921_1493 | 187 |
| 172 | 3300047673 | Ga0495593_0002952 | Ga0495593_0002952_9404_9982 | 187 |
| 173 | 3300048088 | Ga0495602_0096813 | Ga0495602_0096813_1300_1872 | 187 |
| 174 | 3300048089 | Ga0495614_0005712 | Ga0495614_0005712_4503_5081 | 187 |
| 175 | 3300048091 | Ga0495626_0036804 | Ga0495626_0036804_922_1500 | 187 |
| 176 | 3300048091 | Ga0495626_0056762 | Ga0495626_0056762_573_1145 | 187 |
| 177 | 3300048903 | Ga0496100_0021811 | Ga0496100_0021811_2951_3529 | 187 |
| 178 | 3300048904 | Ga0496101_0029250 | Ga0496101_0029250_2723_3301 | 187 |
| 179 | 3300048927 | Ga0496124_0123556 | Ga0496124_0123556_1278_1856 | 187 |
| 180 | 3300049459 | Ga0495678_002103 | Ga0495678_002103_4090_4662 | 187 |
| 181 | 3300049459 | Ga0495678_002762 | Ga0495678_002762_9464_10036 | 187 |
| 182 | 3300049460 | Ga0495682_0003783 | Ga0495682_0003783_3880_4452 | 187 |
| 183 | 3300049569 | Ga0501032_0101876 | Ga0501032_0101876_264_830 | 187 |
| 184 | 3300049570 | Ga0501033_0140968 | Ga0501033_0140968_692_1258 | 187 |
| 185 | 3300049571 | Ga0501034_0646675 | Ga0501034_0646675_383_949 | 187 |
| 186 | 3300049579 | Ga0501043_0032490 | Ga0501043_0032490_789_1355 | 187 |
| 187 | 3300049589 | Ga0501073_0355538 | Ga0501073_0355538_175_741 | 187 |
| 188 | 3300049742 | Ga0501080_0289822 | Ga0501080_0289822_64_630 | 187 |
| 189 | 3300049822 | Ga0501035_0329865 | Ga0501035_0329865_688_1254 | 187 |
| 190 | 3300054114 | Ga0501084_0366044 | Ga0501084_0366044_385_951 | 187 |
| 191 | 3300003163 | Ga0006759J45824_1023430 | Ga0006759J45824_10234301 | 188 |
| 192 | 3300003305 | Ga0006770J48903_1023836 | Ga0006770J48903_10238361 | 188 |
| 193 | 3300003544 | Ga0007417J51691_1017275 | Ga0007417J51691_10172752 | 188 |
| 194 | 3300003574 | Ga0007410J51695_1025237 | Ga0007410J51695_10252372 | 188 |
| 195 | 3300003575 | Ga0007409J51694_1017164 | Ga0007409J51694_10171642 | 188 |
| 196 | 3300003579 | Ga0007429J51699_1065422 | Ga0007429J51699_10654222 | 188 |
| 197 | 3300003693 | Ga0032354_1055850 | Ga0032354_10558501 | 188 |
| 198 | 3300004800 | Ga0058861_10031194 | Ga0058861_100311941 | 188 |
| 199 | 3300005328 | Ga0070676_10101962 | Ga0070676_101019622 | 188 |
| 200 | 3300005330 | Ga0070690_100005749 | Ga0070690_1000057497 | 188 |
| 201 | 3300005331 | Ga0070670_100322927 | Ga0070670_1003229272 | 188 |
| 202 | 3300005331 | Ga0070670_100650431 | Ga0070670_1006504312 | 188 |
| 203 | 3300005333 | Ga0070677_10041315 | Ga0070677_100413152 | 188 |
| 204 | 3300005333 | Ga0070677_10043910 | Ga0070677_100439102 | 188 |
| 205 | 3300005334 | Ga0068869_100058999 | Ga0068869_1000589991 | 188 |
| 206 | 3300005334 | Ga0068869_100235870 | Ga0068869_1002358701 | 188 |
| 207 | 3300005334 | Ga0068869_100299598 | Ga0068869_1002995982 | 188 |
| 208 | 3300005337 | Ga0070682_100021003 | Ga0070682_1000210035 | 188 |
| 209 | 3300005337 | Ga0070682_100894514 | Ga0070682_1008945141 | 188 |
| 210 | 3300005338 | Ga0068868_100039029 | Ga0068868_1000390292 | 188 |
| 211 | 3300005338 | Ga0068868_100270052 | Ga0068868_1002700522 | 188 |
| 212 | 3300005340 | Ga0070689_100001150 | Ga0070689_10000115012 | 188 |
| 213 | 3300005340 | Ga0070689_100760515 | Ga0070689_1007605151 | 188 |
| 214 | 3300005343 | Ga0070687_100033649 | Ga0070687_1000336494 | 188 |
| 215 | 3300005343 | Ga0070687_100142902 | Ga0070687_1001429022 | 188 |
| 216 | 3300005347 | Ga0070668_100165386 | Ga0070668_1001653862 | 188 |
| 217 | 3300005353 | Ga0070669_100011396 | Ga0070669_1000113962 | 188 |
| 218 | 3300005353 | Ga0070669_100682012 | Ga0070669_1006820122 | 188 |
| 219 | 3300005354 | Ga0070675_100066564 | Ga0070675_1000665642 | 188 |
| 220 | 3300005354 | Ga0070675_100094539 | Ga0070675_1000945394 | 188 |
| 221 | 3300005354 | Ga0070675_100135769 | Ga0070675_1001357693 | 188 |
| 222 | 3300005355 | Ga0070671_100285699 | Ga0070671_1002856992 | 188 |
| 223 | 3300005356 | Ga0070674_100011465 | Ga0070674_1000114653 | 188 |
| 224 | 3300005356 | Ga0070674_100106209 | Ga0070674_1001062092 | 188 |
| 225 | 3300005356 | Ga0070674_100516984 | Ga0070674_1005169842 | 188 |
| 226 | 3300005364 | Ga0070673_100011520 | Ga0070673_1000115202 | 188 |
| 227 | 3300005364 | Ga0070673_100030355 | Ga0070673_1000303553 | 188 |
| 228 | 3300005366 | Ga0070659_100300975 | Ga0070659_1003009751 | 188 |
| 229 | 3300005366 | Ga0070659_100402544 | Ga0070659_1004025442 | 188 |
| 230 | 3300005434 | Ga0070709_10002670 | Ga0070709_100026703 | 188 |
| 231 | 3300005435 | Ga0070714_100030639 | Ga0070714_1000306392 | 188 |
| 232 | 3300005436 | Ga0070713_100049060 | Ga0070713_1000490602 | 188 |
| 233 | 3300005437 | Ga0070710_10058601 | Ga0070710_100586013 | 188 |
| 234 | 3300005438 | Ga0070701_10068760 | Ga0070701_100687602 | 188 |
| 235 | 3300005438 | Ga0070701_10329259 | Ga0070701_103292592 | 188 |
| 236 | 3300005440 | Ga0070705_100003706 | Ga0070705_1000037068 | 188 |
| 237 | 3300005440 | Ga0070705_100179304 | Ga0070705_1001793041 | 188 |
| 238 | 3300005441 | Ga0070700_100036312 | Ga0070700_1000363124 | 188 |
| 239 | 3300005441 | Ga0070700_100197281 | Ga0070700_1001972812 | 188 |
| 240 | 3300005441 | Ga0070700_100339581 | Ga0070700_1003395812 | 188 |
| 241 | 3300005444 | Ga0070694_100004882 | Ga0070694_1000048825 | 188 |
| 242 | 3300005455 | Ga0070663_100073219 | Ga0070663_1000732192 | 188 |
| 243 | 3300005456 | Ga0070678_100029248 | Ga0070678_1000292484 | 188 |
| 244 | 3300005456 | Ga0070678_100126444 | Ga0070678_1001264442 | 188 |
| 245 | 3300005456 | Ga0070678_100417633 | Ga0070678_1004176332 | 188 |
| 246 | 3300005457 | Ga0070662_100059233 | Ga0070662_1000592332 | 188 |
| 247 | 3300005518 | Ga0070699_100064925 | Ga0070699_1000649252 | 188 |
| 248 | 3300005518 | Ga0070699_100388509 | Ga0070699_1003885092 | 188 |
| 249 | 3300005536 | Ga0070697_100217816 | Ga0070697_1002178164 | 188 |
| 250 | 3300005539 | Ga0068853_100055406 | Ga0068853_1000554062 | 188 |
| 251 | 3300005543 | Ga0070672_100013413 | Ga0070672_1000134132 | 188 |
| 252 | 3300005543 | Ga0070672_100072842 | Ga0070672_1000728421 | 188 |
| 253 | 3300005543 | Ga0070672_100207441 | Ga0070672_1002074412 | 188 |
| 254 | 3300005544 | Ga0070686_100162243 | Ga0070686_1001622432 | 188 |
| 255 | 3300005544 | Ga0070686_100394737 | Ga0070686_1003947372 | 188 |
| 256 | 3300005544 | Ga0070686_100547519 | Ga0070686_1005475192 | 188 |
| 257 | 3300005545 | Ga0070695_100013674 | Ga0070695_1000136743 | 188 |
| 258 | 3300005547 | Ga0070693_100157995 | Ga0070693_1001579952 | 188 |
| 259 | 3300005547 | Ga0070693_100729260 | Ga0070693_1007292601 | 188 |
| 260 | 3300005548 | Ga0070665_100152388 | Ga0070665_1001523883 | 188 |
| 261 | 3300005548 | Ga0070665_100274245 | Ga0070665_1002742452 | 188 |
| 262 | 3300005548 | Ga0070665_100624465 | Ga0070665_1006244652 | 188 |
| 263 | 3300005548 | Ga0070665_100628579 | Ga0070665_1006285792 | 188 |
| 264 | 3300005548 | Ga0070665_100651833 | Ga0070665_1006518332 | 188 |
| 265 | 3300005548 | Ga0070665_100690568 | Ga0070665_1006905682 | 188 |
| 266 | 3300005549 | Ga0070704_100088418 | Ga0070704_1000884182 | 188 |
| 267 | 3300005563 | Ga0068855_100083690 | Ga0068855_1000836904 | 188 |
| 268 | 3300005564 | Ga0070664_100877307 | Ga0070664_1008773072 | 188 |
| 269 | 3300005577 | Ga0068857_100765851 | Ga0068857_1007658512 | 188 |
| 270 | 3300005614 | Ga0068856_100147817 | Ga0068856_1001478172 | 188 |
| 271 | 3300005615 | Ga0070702_100222647 | Ga0070702_1002226471 | 188 |
| 272 | 3300005616 | Ga0068852_100639319 | Ga0068852_1006393192 | 188 |
| 273 | 3300005617 | Ga0068859_100147415 | Ga0068859_1001474153 | 188 |
| 274 | 3300005618 | Ga0068864_100142183 | Ga0068864_1001421832 | 188 |
| 275 | 3300005618 | Ga0068864_100317351 | Ga0068864_1003173512 | 188 |
| 276 | 3300005618 | Ga0068864_100524187 | Ga0068864_1005241872 | 188 |
| 277 | 3300005719 | Ga0068861_100000527 | Ga0068861_1000005272 | 188 |
| 278 | 3300005719 | Ga0068861_100017283 | Ga0068861_1000172834 | 188 |
| 279 | 3300005719 | Ga0068861_100084824 | Ga0068861_1000848242 | 188 |
| 280 | 3300005719 | Ga0068861_100834839 | Ga0068861_1008348392 | 188 |
| 281 | 3300005840 | Ga0068870_10012979 | Ga0068870_100129795 | 188 |
| 282 | 3300005841 | Ga0068863_100069157 | Ga0068863_1000691572 | 188 |
| 283 | 3300005841 | Ga0068863_100175955 | Ga0068863_1001759552 | 188 |
| 284 | 3300005841 | Ga0068863_100360842 | Ga0068863_1003608421 | 188 |
| 285 | 3300005842 | Ga0068858_100085742 | Ga0068858_1000857424 | 188 |
| 286 | 3300005842 | Ga0068858_100222297 | Ga0068858_1002222972 | 188 |
| 287 | 3300005844 | Ga0068862_100046446 | Ga0068862_1000464464 | 188 |
| 288 | 3300005844 | Ga0068862_100576257 | Ga0068862_1005762571 | 188 |
| 289 | 3300005844 | Ga0068862_100938236 | Ga0068862_1009382361 | 188 |
| 290 | 3300005937 | Ga0081455_10001291 | Ga0081455_100012916 | 188 |
| 291 | 3300006038 | Ga0075365_10293234 | Ga0075365_102932342 | 188 |
| 292 | 3300006042 | Ga0075368_10147300 | Ga0075368_101473001 | 188 |
| 293 | 3300006048 | Ga0075363_100017074 | Ga0075363_1000170742 | 188 |
| 294 | 3300006051 | Ga0075364_10052860 | Ga0075364_100528602 | 188 |
| 295 | 3300006051 | Ga0075364_10589089 | Ga0075364_105890891 | 188 |
| 296 | 3300006173 | Ga0070716_100308907 | Ga0070716_1003089072 | 188 |
| 297 | 3300006186 | Ga0075369_10062059 | Ga0075369_100620592 | 188 |
| 298 | 3300006353 | Ga0075370_10048405 | Ga0075370_100484052 | 188 |
| 299 | 3300006358 | Ga0068871_100054828 | Ga0068871_1000548282 | 188 |
| 300 | 3300006358 | Ga0068871_100418255 | Ga0068871_1004182551 | 188 |
| 301 | 3300006871 | Ga0075434_100014712 | Ga0075434_1000147126 | 188 |
| 302 | 3300006871 | Ga0075434_100097147 | Ga0075434_1000971472 | 188 |
| 303 | 3300006881 | Ga0068865_100018617 | Ga0068865_1000186172 | 188 |
| 304 | 3300006881 | Ga0068865_100112928 | Ga0068865_1001129283 | 188 |
| 305 | 3300006881 | Ga0068865_100577737 | Ga0068865_1005777372 | 188 |
| 306 | 3300006931 | Ga0097620_100147400 | Ga0097620_1001474003 | 188 |
| 307 | 3300007076 | Ga0075435_100139090 | Ga0075435_1001390903 | 188 |
| 308 | 3300007076 | Ga0075435_100467920 | Ga0075435_1004679202 | 188 |
| 309 | 3300007265 | Ga0099794_10254534 | Ga0099794_102545342 | 188 |
| 310 | 3300009094 | Ga0111539_10221694 | Ga0111539_102216942 | 188 |
| 311 | 3300009148 | Ga0105243_10797672 | Ga0105243_107976722 | 188 |
| 312 | 3300009174 | Ga0105241_10028543 | Ga0105241_100285432 | 188 |
| 313 | 3300009176 | Ga0105242_10241016 | Ga0105242_102410162 | 188 |
| 314 | 3300009177 | Ga0105248_10187587 | Ga0105248_101875872 | 188 |
| 315 | 3300009177 | Ga0105248_10383029 | Ga0105248_103830292 | 188 |
| 316 | 3300009177 | Ga0105248_11017033 | Ga0105248_110170332 | 188 |
| 317 | 3300009545 | Ga0105237_10388731 | Ga0105237_103887312 | 188 |
| 318 | 3300009551 | Ga0105238_10078735 | Ga0105238_100787352 | 188 |
| 319 | 3300009551 | Ga0105238_10586568 | Ga0105238_105865682 | 188 |
| 320 | 3300009553 | Ga0105249_10628574 | Ga0105249_106285741 | 188 |
| 321 | 3300010375 | Ga0105239_10032029 | Ga0105239_100320295 | 188 |
| 322 | 3300010375 | Ga0105239_10041589 | Ga0105239_100415894 | 188 |
| 323 | 3300010375 | Ga0105239_10056868 | Ga0105239_100568685 | 188 |
| 324 | 3300010375 | Ga0105239_10439379 | Ga0105239_104393792 | 188 |
| 325 | 3300011119 | Ga0105246_10087483 | Ga0105246_100874832 | 188 |
| 326 | 3300011119 | Ga0105246_10199204 | Ga0105246_101992042 | 188 |
| 327 | 3300013104 | Ga0157370_10355250 | Ga0157370_103552502 | 188 |
| 328 | 3300013296 | Ga0157374_10013357 | Ga0157374_100133577 | 188 |
| 329 | 3300013296 | Ga0157374_10101374 | Ga0157374_101013742 | 188 |
| 330 | 3300013297 | Ga0157378_10096348 | Ga0157378_100963482 | 188 |
| 331 | 3300013306 | Ga0163162_11277380 | Ga0163162_112773802 | 188 |
| 332 | 3300013306 | Ga0163162_11530602 | Ga0163162_115306022 | 188 |
| 333 | 3300013308 | Ga0157375_10663982 | Ga0157375_106639822 | 188 |
| 334 | 3300014325 | Ga0163163_10191352 | Ga0163163_101913522 | 188 |
| 335 | 3300014325 | Ga0163163_11282143 | Ga0163163_112821431 | 188 |
| 336 | 3300014326 | Ga0157380_10093387 | Ga0157380_100933872 | 188 |
| 337 | 3300014326 | Ga0157380_10525822 | Ga0157380_105258222 | 188 |
| 338 | 3300014326 | Ga0157380_10745759 | Ga0157380_107457592 | 188 |
| 339 | 3300014326 | Ga0157380_11408754 | Ga0157380_114087541 | 188 |
| 340 | 3300014326 | Ga0157380_11759819 | Ga0157380_117598191 | 188 |
| 341 | 3300014968 | Ga0157379_10431027 | Ga0157379_104310272 | 188 |
| 342 | 3300014969 | Ga0157376_10182387 | Ga0157376_101823872 | 188 |
| 343 | 3300017792 | Ga0163161_10317464 | Ga0163161_103174642 | 188 |
| 344 | 3300021441 | Ga0213871_10015537 | Ga0213871_100155372 | 188 |
| 345 | 3300025321 | Ga0207656_10198824 | Ga0207656_101988241 | 188 |
| 346 | 3300025893 | Ga0207682_10006385 | Ga0207682_100063856 | 188 |
| 347 | 3300025893 | Ga0207682_10066823 | Ga0207682_100668232 | 188 |
| 348 | 3300025893 | Ga0207682_10081010 | Ga0207682_100810102 | 188 |
| 349 | 3300025899 | Ga0207642_10314584 | Ga0207642_103145842 | 188 |
| 350 | 3300025906 | Ga0207699_10002666 | Ga0207699_100026662 | 188 |
| 351 | 3300025907 | Ga0207645_10035317 | Ga0207645_100353172 | 188 |
| 352 | 3300025908 | Ga0207643_10041620 | Ga0207643_100416204 | 188 |
| 353 | 3300025909 | Ga0207705_10616183 | Ga0207705_106161832 | 188 |
| 354 | 3300025911 | Ga0207654_10016729 | Ga0207654_100167291 | 188 |
| 355 | 3300025918 | Ga0207662_10266191 | Ga0207662_102661912 | 188 |
| 356 | 3300025918 | Ga0207662_10268340 | Ga0207662_102683401 | 188 |
| 357 | 3300025918 | Ga0207662_10318493 | Ga0207662_103184932 | 188 |
| 358 | 3300025920 | Ga0207649_10130870 | Ga0207649_101308701 | 188 |
| 359 | 3300025920 | Ga0207649_10722262 | Ga0207649_107222622 | 188 |
| 360 | 3300025921 | Ga0207652_10530857 | Ga0207652_105308571 | 188 |
| 361 | 3300025925 | Ga0207650_10420601 | Ga0207650_104206011 | 188 |
| 362 | 3300025926 | Ga0207659_10031789 | Ga0207659_100317894 | 188 |
| 363 | 3300025926 | Ga0207659_10180346 | Ga0207659_101803462 | 188 |
| 364 | 3300025926 | Ga0207659_10310832 | Ga0207659_103108322 | 188 |
| 365 | 3300025927 | Ga0207687_10456219 | Ga0207687_104562191 | 188 |
| 366 | 3300025928 | Ga0207700_10067759 | Ga0207700_100677593 | 188 |
| 367 | 3300025929 | Ga0207664_10173951 | Ga0207664_101739512 | 188 |
| 368 | 3300025931 | Ga0207644_10063995 | Ga0207644_100639952 | 188 |
| 369 | 3300025933 | Ga0207706_10158590 | Ga0207706_101585902 | 188 |
| 370 | 3300025933 | Ga0207706_10227494 | Ga0207706_102274942 | 188 |
| 371 | 3300025934 | Ga0207686_10119918 | Ga0207686_101199181 | 188 |
| 372 | 3300025936 | Ga0207670_10003275 | Ga0207670_100032756 | 188 |
| 373 | 3300025937 | Ga0207669_10053305 | Ga0207669_100533054 | 188 |
| 374 | 3300025937 | Ga0207669_10437815 | Ga0207669_104378152 | 188 |
| 375 | 3300025938 | Ga0207704_10214552 | Ga0207704_102145521 | 188 |
| 376 | 3300025938 | Ga0207704_10417891 | Ga0207704_104178912 | 188 |
| 377 | 3300025940 | Ga0207691_10010191 | Ga0207691_100101915 | 188 |
| 378 | 3300025940 | Ga0207691_10014947 | Ga0207691_100149472 | 188 |
| 379 | 3300025940 | Ga0207691_10555885 | Ga0207691_105558852 | 188 |
| 380 | 3300025941 | Ga0207711_10265787 | Ga0207711_102657872 | 188 |
| 381 | 3300025942 | Ga0207689_10019230 | Ga0207689_100192307 | 188 |
| 382 | 3300025942 | Ga0207689_10096166 | Ga0207689_100961662 | 188 |
| 383 | 3300025942 | Ga0207689_10339297 | Ga0207689_103392971 | 188 |
| 384 | 3300025944 | Ga0207661_10918948 | Ga0207661_109189482 | 188 |
| 385 | 3300025945 | Ga0207679_10294050 | Ga0207679_102940502 | 188 |
| 386 | 3300025945 | Ga0207679_10640738 | Ga0207679_106407382 | 188 |
| 387 | 3300025949 | Ga0207667_10233982 | Ga0207667_102339822 | 188 |
| 388 | 3300025960 | Ga0207651_10022430 | Ga0207651_100224305 | 188 |
| 389 | 3300025960 | Ga0207651_10055919 | Ga0207651_100559192 | 188 |
| 390 | 3300025960 | Ga0207651_10146487 | Ga0207651_101464872 | 188 |
| 391 | 3300025960 | Ga0207651_10994862 | Ga0207651_109948622 | 188 |
| 392 | 3300025961 | Ga0207712_10644550 | Ga0207712_106445502 | 188 |
| 393 | 3300025972 | Ga0207668_10345691 | Ga0207668_103456912 | 188 |
| 394 | 3300025972 | Ga0207668_10876441 | Ga0207668_108764411 | 188 |
| 395 | 3300025986 | Ga0207658_10511348 | Ga0207658_105113481 | 188 |
| 396 | 3300026035 | Ga0207703_10092301 | Ga0207703_100923013 | 188 |
| 397 | 3300026041 | Ga0207639_10036977 | Ga0207639_100369773 | 188 |
| 398 | 3300026067 | Ga0207678_10214526 | Ga0207678_102145262 | 188 |
| 399 | 3300026075 | Ga0207708_10046326 | Ga0207708_100463262 | 188 |
| 400 | 3300026075 | Ga0207708_10100374 | Ga0207708_101003742 | 188 |
| 401 | 3300026075 | Ga0207708_10113715 | Ga0207708_101137151 | 188 |
| 402 | 3300026075 | Ga0207708_10172039 | Ga0207708_101720392 | 188 |
| 403 | 3300026075 | Ga0207708_10328989 | Ga0207708_103289892 | 188 |
| 404 | 3300026078 | Ga0207702_10756573 | Ga0207702_107565731 | 188 |
| 405 | 3300026088 | Ga0207641_10131892 | Ga0207641_101318922 | 188 |
| 406 | 3300026088 | Ga0207641_10132681 | Ga0207641_101326813 | 188 |
| 407 | 3300026088 | Ga0207641_10264911 | Ga0207641_102649113 | 188 |
| 408 | 3300026088 | Ga0207641_10965269 | Ga0207641_109652692 | 188 |
| 409 | 3300026089 | Ga0207648_10074116 | Ga0207648_100741164 | 188 |
| 410 | 3300026089 | Ga0207648_10093102 | Ga0207648_100931022 | 188 |
| 411 | 3300026095 | Ga0207676_10069809 | Ga0207676_100698094 | 188 |
| 412 | 3300026095 | Ga0207676_10248613 | Ga0207676_102486132 | 188 |
| 413 | 3300026095 | Ga0207676_10579574 | Ga0207676_105795742 | 188 |
| 414 | 3300026116 | Ga0207674_10035147 | Ga0207674_100351474 | 188 |
| 415 | 3300026116 | Ga0207674_10364702 | Ga0207674_103647022 | 188 |
| 416 | 3300026118 | Ga0207675_100001153 | Ga0207675_10000115324 | 188 |
| 417 | 3300026118 | Ga0207675_100001636 | Ga0207675_10000163621 | 188 |
| 418 | 3300026118 | Ga0207675_100081273 | Ga0207675_1000812733 | 188 |
| 419 | 3300026118 | Ga0207675_100094886 | Ga0207675_1000948864 | 188 |
| 420 | 3300026118 | Ga0207675_100100260 | Ga0207675_1001002604 | 188 |
| 421 | 3300026118 | Ga0207675_101100700 | Ga0207675_1011007002 | 188 |
| 422 | 3300026121 | Ga0207683_10006481 | Ga0207683_1000648110 | 188 |
| 423 | 3300026121 | Ga0207683_10043558 | Ga0207683_100435582 | 188 |
| 424 | 3300026121 | Ga0207683_10098919 | Ga0207683_100989192 | 188 |
| 425 | 3300026142 | Ga0207698_10360546 | Ga0207698_103605462 | 188 |
| 426 | 3300026142 | Ga0207698_11669668 | Ga0207698_116696681 | 188 |
| 427 | 3300028379 | Ga0268266_10233873 | Ga0268266_102338732 | 188 |
| 428 | 3300028379 | Ga0268266_10352325 | Ga0268266_103523251 | 188 |
| 429 | 3300028379 | Ga0268266_10473967 | Ga0268266_104739672 | 188 |
| 430 | 3300028379 | Ga0268266_10606456 | Ga0268266_106064562 | 188 |
| 431 | 3300028379 | Ga0268266_10913186 | Ga0268266_109131862 | 188 |
| 432 | 3300028380 | Ga0268265_10020656 | Ga0268265_100206564 | 188 |
| 433 | 3300028380 | Ga0268265_10196756 | Ga0268265_101967563 | 188 |
| 434 | 3300028381 | Ga0268264_10543158 | Ga0268264_105431582 | 188 |
| 435 | 3300028381 | Ga0268264_11088929 | Ga0268264_110889292 | 188 |
| 436 | 3300028786 | Ga0307517_10207464 | Ga0307517_102074642 | 188 |
| 437 | 3300028794 | Ga0307515_10223256 | Ga0307515_102232562 | 188 |
| 438 | 3300029277 | Ga0311001_1004563 | Ga0311001_10045632 | 188 |
| 439 | 3300030521 | Ga0307511_10113779 | Ga0307511_101137792 | 188 |
| 440 | 3300031238 | Ga0265332_10215282 | Ga0265332_102152821 | 188 |
| 441 | 3300031251 | Ga0265327_10001037 | Ga0265327_1000103727 | 188 |
| 442 | 3300031456 | Ga0307513_10039521 | Ga0307513_100395214 | 188 |
| 443 | 3300031456 | Ga0307513_10075527 | Ga0307513_100755272 | 188 |
| 444 | 3300031456 | Ga0307513_10338051 | Ga0307513_103380512 | 188 |
| 445 | 3300031507 | Ga0307509_10116301 | Ga0307509_101163012 | 188 |
| 446 | 3300031507 | Ga0307509_10130983 | Ga0307509_101309833 | 188 |
| 447 | 3300031731 | Ga0307405_10087546 | Ga0307405_100875462 | 188 |
| 448 | 3300031824 | Ga0307413_10005441 | Ga0307413_100054412 | 188 |
| 449 | 3300031824 | Ga0307413_10218052 | Ga0307413_102180522 | 188 |
| 450 | 3300031824 | Ga0307413_10293800 | Ga0307413_102938002 | 188 |
| 451 | 3300031901 | Ga0307406_10008182 | Ga0307406_100081825 | 188 |
| 452 | 3300031911 | Ga0307412_10157107 | Ga0307412_101571071 | 188 |
| 453 | 3300031995 | Ga0307409_100678700 | Ga0307409_1006787002 | 188 |
| 454 | 3300032002 | Ga0307416_100109787 | Ga0307416_1001097873 | 188 |
| 455 | 3300032002 | Ga0307416_100181734 | Ga0307416_1001817342 | 188 |
| 456 | 3300032002 | Ga0307416_100559337 | Ga0307416_1005593372 | 188 |
| 457 | 3300032004 | Ga0307414_10531830 | Ga0307414_105318301 | 188 |
| 458 | 3300032005 | Ga0307411_10018164 | Ga0307411_100181642 | 188 |
| 459 | 3300032005 | Ga0307411_11234147 | Ga0307411_112341471 | 188 |
| 460 | 3300032126 | Ga0307415_100290464 | Ga0307415_1002904642 | 188 |
| 461 | 3300033180 | Ga0307510_10003003 | Ga0307510_1000300316 | 188 |
| 462 | 3300035692 | Ga0373935_0441763 | Ga0373935_0441763_112_687 | 188 |
| 463 | 3300037312 | Ga0395899_0280457 | Ga0395899_0280457_351_938 | 188 |
| 464 | 3300037418 | Ga0395900_0325871 | Ga0395900_0325871_316_903 | 188 |
| 465 | 3300037471 | Ga0395905_0130046 | Ga0395905_0130046_1216_1803 | 188 |
| 466 | 3300039438 | Ga0436360_0615805 | Ga0436360_0615805_2683_3261 | 188 |
| 467 | 3300041451 | Ga0451791_1831530 | Ga0451791_1831530_176_751 | 188 |
| 468 | 3300041453 | Ga0451797_1132125 | Ga0451797_1132125_199_774 | 188 |
| 469 | 3300041458 | Ga0451798_0828765 | Ga0451798_0828765_114_689 | 188 |
| 470 | 3300041486 | Ga0451807_2251806 | Ga0451807_2251806_481_1056 | 188 |
| 471 | 3300041494 | Ga0451837_0227098 | Ga0451837_0227098_869_1444 | 188 |
| 472 | 3300041509 | Ga0451843_1622578 | Ga0451843_1622578_696_1271 | 188 |
| 473 | 3300044694 | Ga0466963_0194352 | Ga0466963_0194352_127_696 | 188 |
| 474 | 3300044901 | Ga0466960_0439956 | Ga0466960_0439956_26_601 | 188 |
| 475 | 3300045976 | Ga0466967_0369288 | Ga0466967_0369288_105_674 | 188 |
| 476 | 3300046452 | Ga0495617_070387 | Ga0495617_070387_223_789 | 188 |
| 477 | 3300046452 | Ga0495617_114977 | Ga0495617_114977_121_687 | 188 |
| 478 | 3300046454 | Ga0495592_0005300 | Ga0495592_0005300_6586_7161 | 188 |
| 479 | 3300046455 | Ga0495603_0005505 | Ga0495603_0005505_2855_3421 | 188 |
| 480 | 3300046457 | Ga0495590_0001203 | Ga0495590_0001203_147_722 | 188 |
| 481 | 3300046457 | Ga0495590_0023603 | Ga0495590_0023603_338_904 | 188 |
| 482 | 3300046459 | Ga0495629_0107491 | Ga0495629_0107491_1215_1781 | 188 |
| 483 | 3300046459 | Ga0495629_0121386 | Ga0495629_0121386_1219_1797 | 188 |
| 484 | 3300046460 | Ga0495638_0010135 | Ga0495638_0010135_5201_5782 | 188 |
| 485 | 3300046460 | Ga0495638_0028677 | Ga0495638_0028677_1868_2443 | 188 |
| 486 | 3300046460 | Ga0495638_0069253 | Ga0495638_0069253_1259_1825 | 188 |
| 487 | 3300046460 | Ga0495638_0157903 | Ga0495638_0157903_233_799 | 188 |
| 488 | 3300046462 | Ga0495651_0344659 | Ga0495651_0344659_244_819 | 188 |
| 489 | 3300046463 | Ga0495653_0400871 | Ga0495653_0400871_25_600 | 188 |
| 490 | 3300046463 | Ga0495653_0520025 | Ga0495653_0520025_109_684 | 188 |
| 491 | 3300046473 | Ga0495582_0143309 | Ga0495582_0143309_741_1307 | 188 |
| 492 | 3300046491 | Ga0495584_0133606 | Ga0495584_0133606_286_861 | 188 |
| 493 | 3300046492 | Ga0495585_0043218 | Ga0495585_0043218_270_836 | 188 |
| 494 | 3300046499 | Ga0495594_0086290 | Ga0495594_0086290_719_1285 | 188 |
| 495 | 3300046506 | Ga0495583_0102792 | Ga0495583_0102792_323_889 | 188 |
| 496 | 3300046507 | Ga0495606_0186421 | Ga0495606_0186421_151_717 | 188 |
| 497 | 3300046513 | Ga0495616_0024626 | Ga0495616_0024626_1193_1768 | 188 |
| 498 | 3300046515 | Ga0495620_0066811 | Ga0495620_0066811_671_1252 | 188 |
| 499 | 3300046516 | Ga0495628_0005560 | Ga0495628_0005560_6438_7013 | 188 |
| 500 | 3300046519 | Ga0495632_0129966 | Ga0495632_0129966_363_929 | 188 |
| 501 | 3300046524 | Ga0495648_0010475 | Ga0495648_0010475_1293_1862 | 188 |
| 502 | 3300046524 | Ga0495648_0089586 | Ga0495648_0089586_294_860 | 188 |
| 503 | 3300046528 | Ga0495642_0062421 | Ga0495642_0062421_408_998 | 188 |
| 504 | 3300046529 | Ga0495652_0058905 | Ga0495652_0058905_2549_3124 | 188 |
| 505 | 3300046535 | Ga0495586_0057855 | Ga0495586_0057855_1427_2002 | 188 |
| 506 | 3300046537 | Ga0495598_0046836 | Ga0495598_0046836_628_1194 | 188 |
| 507 | 3300046538 | Ga0495609_0114646 | Ga0495609_0114646_74_640 | 188 |
| 508 | 3300046539 | Ga0495621_0145442 | Ga0495621_0145442_256_837 | 188 |
| 509 | 3300046542 | Ga0495597_0248746 | Ga0495597_0248746_60_626 | 188 |
| 510 | 3300046543 | Ga0495645_0363989 | Ga0495645_0363989_144_719 | 188 |
| 511 | 3300046557 | Ga0495622_0052103 | Ga0495622_0052103_497_1063 | 188 |
| 512 | 3300046558 | Ga0495633_0166830 | Ga0495633_0166830_183_749 | 188 |
| 513 | 3300046616 | Ga0495668_0025683 | Ga0495668_0025683_343_909 | 188 |
| 514 | 3300046616 | Ga0495668_0043386 | Ga0495668_0043386_1214_1789 | 188 |
| 515 | 3300046648 | Ga0495611_0041632 | Ga0495611_0041632_1095_1661 | 188 |
| 516 | 3300046660 | Ga0495625_0009026 | Ga0495625_0009026_153_734 | 188 |
| 517 | 3300046663 | Ga0495635_0328218 | Ga0495635_0328218_216_782 | 188 |
| 518 | 3300046665 | Ga0495661_0134158 | Ga0495661_0134158_274_864 | 188 |
| 519 | 3300046678 | Ga0495599_0075253 | Ga0495599_0075253_1402_1977 | 188 |
| 520 | 3300046683 | Ga0495658_0450449 | Ga0495658_0450449_168_734 | 188 |
| 521 | 3300046692 | Ga0495671_0133109 | Ga0495671_0133109_436_1002 | 188 |
| 522 | 3300047320 | Ga0495672_0000198 | Ga0495672_0000198_73538_74131 | 188 |
| 523 | 3300047320 | Ga0495672_0072576 | Ga0495672_0072576_1020_1595 | 188 |
| 524 | 3300047443 | Ga0495687_009929 | Ga0495687_009929_2514_3092 | 188 |
| 525 | 3300047469 | Ga0495673_0031927 | Ga0495673_0031927_892_1458 | 188 |
| 526 | 3300048091 | Ga0495626_0241855 | Ga0495626_0241855_62_628 | 188 |
| 527 | 3300048903 | Ga0496100_0146503 | Ga0496100_0146503_318_896 | 188 |
| 528 | 3300048904 | Ga0496101_0380670 | Ga0496101_0380670_257_835 | 188 |
| 529 | 3300048905 | Ga0496102_0367327 | Ga0496102_0367327_75_644 | 188 |
| 530 | 3300048906 | Ga0496103_0101306 | Ga0496103_0101306_1113_1688 | 188 |
| 531 | 3300048906 | Ga0496103_0506660 | Ga0496103_0506660_171_749 | 188 |
| 532 | 3300048907 | Ga0496104_0001311 | Ga0496104_0001311_4329_4904 | 188 |
| 533 | 3300048907 | Ga0496104_0162793 | Ga0496104_0162793_1216_1794 | 188 |
| 534 | 3300048907 | Ga0496104_0705073 | Ga0496104_0705073_77_646 | 188 |
| 535 | 3300048908 | Ga0496105_0000231 | Ga0496105_0000231_15421_15996 | 188 |
| 536 | 3300048909 | Ga0496106_0129368 | Ga0496106_0129368_1316_1885 | 188 |
| 537 | 3300048910 | Ga0496107_0128129 | Ga0496107_0128129_938_1510 | 188 |
| 538 | 3300048910 | Ga0496107_0182717 | Ga0496107_0182717_311_880 | 188 |
| 539 | 3300048910 | Ga0496107_0332730 | Ga0496107_0332730_71_649 | 188 |
| 540 | 3300048910 | Ga0496107_0518406 | Ga0496107_0518406_163_732 | 188 |
| 541 | 3300048911 | Ga0496108_0177753 | Ga0496108_0177753_196_765 | 188 |
| 542 | 3300048911 | Ga0496108_0193352 | Ga0496108_0193352_1092_1667 | 188 |
| 543 | 3300048912 | Ga0496109_0024245 | Ga0496109_0024245_1950_2528 | 188 |
| 544 | 3300048912 | Ga0496109_0056961 | Ga0496109_0056961_840_1409 | 188 |
| 545 | 3300048913 | Ga0496110_0033205 | Ga0496110_0033205_3068_3643 | 188 |
| 546 | 3300048913 | Ga0496110_0078155 | Ga0496110_0078155_2088_2666 | 188 |
| 547 | 3300048913 | Ga0496110_0094867 | Ga0496110_0094867_1183_1761 | 188 |
| 548 | 3300048914 | Ga0496111_0032506 | Ga0496111_0032506_2794_3372 | 188 |
| 549 | 3300048914 | Ga0496111_0269657 | Ga0496111_0269657_411_980 | 188 |
| 550 | 3300048914 | Ga0496111_0281341 | Ga0496111_0281341_621_1196 | 188 |
| 551 | 3300048915 | Ga0496112_0026997 | Ga0496112_0026997_1416_1991 | 188 |
| 552 | 3300048915 | Ga0496112_0236304 | Ga0496112_0236304_573_1142 | 188 |
| 553 | 3300048915 | Ga0496112_0666718 | Ga0496112_0666718_273_869 | 188 |
| 554 | 3300048916 | Ga0496113_0051563 | Ga0496113_0051563_1889_2485 | 188 |
| 555 | 3300048916 | Ga0496113_0086445 | Ga0496113_0086445_811_1380 | 188 |
| 556 | 3300048917 | Ga0496114_0170041 | Ga0496114_0170041_329_907 | 188 |
| 557 | 3300048918 | Ga0496115_0000077 | Ga0496115_0000077_2763_3338 | 188 |
| 558 | 3300048918 | Ga0496115_0021945 | Ga0496115_0021945_64_639 | 188 |
| 559 | 3300048918 | Ga0496115_0029788 | Ga0496115_0029788_2933_3505 | 188 |
| 560 | 3300048919 | Ga0496116_0180337 | Ga0496116_0180337_216_782 | 188 |
| 561 | 3300048920 | Ga0496117_0065160 | Ga0496117_0065160_355_930 | 188 |
| 562 | 3300048921 | Ga0496118_0064618 | Ga0496118_0064618_1312_1887 | 188 |
| 563 | 3300048922 | Ga0496119_0007747 | Ga0496119_0007747_410_1084 | 188 |
| 564 | 3300048925 | Ga0496122_0009572 | Ga0496122_0009572_356_952 | 188 |
| 565 | 3300048926 | Ga0496123_0003835 | Ga0496123_0003835_6312_6908 | 188 |
| 566 | 3300048927 | Ga0496124_0520289 | Ga0496124_0520289_181_747 | 188 |
| 567 | 3300048928 | Ga0496125_0008961 | Ga0496125_0008961_9581_10177 | 188 |
| 568 | 3300048928 | Ga0496125_0113643 | Ga0496125_0113643_298_873 | 188 |
| 569 | 3300048928 | Ga0496125_0201030 | Ga0496125_0201030_679_1248 | 188 |
| 570 | 3300048929 | Ga0496126_0000047 | Ga0496126_0000047_291244_291819 | 188 |
| 571 | 3300049460 | Ga0495682_0047474 | Ga0495682_0047474_235_801 | 188 |
| 572 | 3300049460 | Ga0495682_0050840 | Ga0495682_0050840_880_1446 | 188 |
| 573 | 3300049570 | Ga0501033_0780855 | Ga0501033_0780855_32_607 | 188 |
| 574 | 3300049571 | Ga0501034_0597849 | Ga0501034_0597849_168_764 | 188 |
| 575 | 3300049583 | Ga0501067_0457279 | Ga0501067_0457279_102_677 | 188 |
| 576 | 3300049584 | Ga0501068_0170991 | Ga0501068_0170991_180_755 | 188 |
| 577 | 3300049587 | Ga0501071_0020230 | Ga0501071_0020230_3497_4072 | 188 |
| 578 | 3300049588 | Ga0501072_0549087 | Ga0501072_0549087_133_708 | 188 |
| 579 | 3300049589 | Ga0501073_0010684 | Ga0501073_0010684_5557_6132 | 188 |
| 580 | 3300049592 | Ga0501076_0119653 | Ga0501076_0119653_208_783 | 188 |
| 581 | 3300049592 | Ga0501076_0379484 | Ga0501076_0379484_71_646 | 188 |
| 582 | 3300049593 | Ga0501077_0081002 | Ga0501077_0081002_251_826 | 188 |
| 583 | 3300049741 | Ga0501079_0035049 | Ga0501079_0035049_808_1383 | 188 |
| 584 | 3300049742 | Ga0501080_0004373 | Ga0501080_0004373_2899_3474 | 188 |
| 585 | 3300049742 | Ga0501080_0463337 | Ga0501080_0463337_313_888 | 188 |
| 586 | 3300050489 | nmdc:mga03683_211327_c1 | nmdc:mga03683_211327_c1_46_615 | 188 |
| 587 | 3300050491 | nmdc:mga00v17_112371_c1 | nmdc:mga00v17_112371_c1_558_1127 | 188 |
| 588 | 3300050494 | nmdc:mga06z11_72338_c1 | nmdc:mga06z11_72338_c1_1174_1743 | 188 |
| 589 | 3300050495 | nmdc:mga04h51_95348_c1 | nmdc:mga04h51_95348_c1_355_924 | 188 |
| 590 | 3300050511 | nmdc:mga08y16_65452_c1 | nmdc:mga08y16_65452_c1_2707_3330 | 188 |
| 591 | 3300050512 | nmdc:mga0n895_1048_c1 | nmdc:mga0n895_1048_c1_8130_8753 | 188 |
| 592 | 3300050512 | nmdc:mga0n895_80031_c1 | nmdc:mga0n895_80031_c1_1746_2321 | 188 |
| 593 | 3300050513 | nmdc:mga0rr50_124533_c1 | nmdc:mga0rr50_124533_c1_62_637 | 188 |
| 594 | 3300050513 | nmdc:mga0rr50_231_c1 | nmdc:mga0rr50_231_c1_1327_1950 | 188 |
| 595 | 3300050514 | nmdc:mga08x19_12588_c1 | nmdc:mga08x19_12588_c1_2430_3053 | 188 |
| 596 | 3300050515 | nmdc:mga0a205_1314_c1 | nmdc:mga0a205_1314_c1_20080_20703 | 188 |
| 597 | 3300050515 | nmdc:mga0a205_14878_c1 | nmdc:mga0a205_14878_c1_950_1525 | 188 |
| 598 | 3300050515 | nmdc:mga0a205_616697_c1 | nmdc:mga0a205_616697_c1_48_623 | 188 |
| 599 | 3300050516 | nmdc:mga0sz30_73293_c1 | nmdc:mga0sz30_73293_c1_523_1092 | 188 |
| 600 | 3300053086 | Ga0500578_0174604 | Ga0500578_0174604_362_928 | 188 |
| 601 | 3300053088 | Ga0500644_0095452 | Ga0500644_0095452_107_673 | 188 |
| 602 | 3300053088 | Ga0500644_0130828 | Ga0500644_0130828_27_599 | 188 |
| 603 | 3300053094 | Ga0500566_0356031 | Ga0500566_0356031_68_640 | 188 |
| 604 | 3300053106 | Ga0500558_229787 | Ga0500558_229787_34_603 | 188 |
| 605 | 3300053111 | Ga0500572_000514 | Ga0500572_000514_10847_11419 | 188 |
| 606 | 3300053114 | Ga0500582_055327 | Ga0500582_055327_593_1159 | 188 |
| 607 | 3300053119 | Ga0500595_003720 | Ga0500595_003720_2787_3356 | 188 |
| 608 | 3300053130 | Ga0500642_0096285 | Ga0500642_0096285_527_1093 | 188 |
| 609 | 3300053134 | Ga0500658_0017757 | Ga0500658_0017757_1701_2267 | 188 |
| 610 | 3300053142 | Ga0500577_0031216 | Ga0500577_0031216_649_1215 | 188 |
| 611 | 3300053156 | Ga0500622_0110518 | Ga0500622_0110518_217_783 | 188 |
| 612 | 3300053161 | Ga0500634_0151880 | Ga0500634_0151880_67_633 | 188 |
| 613 | 3300053730 | Ga0500645_083578 | Ga0500645_083578_120_686 | 188 |
| 614 | 3300053739 | Ga0500587_020594 | Ga0500587_020594_216_785 | 188 |
| 615 | 3300059646 | Ga0587078_011609 | Ga0587078_011609_90_659 | 188 |
| 616 | 3300059647 | Ga0587079_087795 | Ga0587079_087795_55_639 | 188 |
| 617 | 3300060353 | Ga0501082_0103223 | Ga0501082_0103223_681_1256 | 188 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xa8-assembly1.cif.gz_A | crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) | 0.983 | 3 | 188 |
| 1xa8-assembly1.cif.gz_A | crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) | 0.9675 | 3 | 188 |
| 8ajq-assembly3.cif.gz_E | crystal structure of pa2722 from pseudomonas aeruginosa pao1 | 0.7626 | 22 | 168 |
| 3fac-assembly8.cif.gz_H | crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. | 0.7236 | 24 | 165 |
| 3fac-assembly8.cif.gz_H | crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. | 0.7059 | 24 | 165 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xa8D00 | Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) | 0.985 | 3 | 188 | 3.90.1590.10 |
| 1xa8D00 | Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) | 0.9694 | 3 | 188 | 3.90.1590.10 |
| af_O14034_2_133_3.90.1590.10 | Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) | 0.8099 | 22 | 140 | 3.90.1590.10 |
| 3facD00 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; | 0.6972 | 24 | 166 | 2.170.150.70 |
| af_O14034_2_133_3.90.1590.10 | Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) | 0.685 | 22 | 140 | 3.90.1590.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-D4ZD20-F1-model_v4 | Glutathione-dependent formaldehyde-activating enzyme (EC 4.4.1.22) (S-(hydroxymethyl)glutathione synthase) | 1.001 | 25 | 184 |
GO:0008270
GO:0046294 GO:0051907 |
| AF-A0A3S3D3N2-F1-model_v4 | deleted | 0.9995 | 19 | 100 |
|
| AF-A0A556BAF4-F1-model_v4 | Glutathione-dependent formaldehyde-activating protein | 0.9992 | 38 | 130 |
GO:0016846
GO:0046872 |
| AF-A0A512E1Q9-F1-model_v4 | Glutathione-dependent formaldehyde-activating enzyme (EC 4.4.1.22) (S-(hydroxymethyl)glutathione synthase) | 0.9988 | 3 | 186 |
GO:0008270
GO:0046294 GO:0051907 |
| AF-A0A4Q0QI08-F1-model_v4 | Glutathione-dependent formaldehyde-activating protein | 0.9988 | 79 | 186 |
GO:0016846
GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar