F469673

General Info

Members Datasets Scaffolds Average Seq Length
617 381 562 190

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0007747|Ga0496119_0007747_410_1084
Length 224
Sequence LKPVHPASAFRAGRLRLGYSGCSEASQKPEEEAMTVSIHPSVDNGVRPGRADFAGGTLSCKCAHDPVKVTIKGNVAHNHACGCTKCWKPAGANFSVVAVVPRDNLTVTAHSEKLRIVDPNATIQRYACKECGVHLFGRIENKAHPFYGLDFVHTELSSEDGWAAPEFAAFVSSIIESGFPPSRMGEVRSRLTELGLQPYDALSPPLMDAIATHVAKASGKLAAA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
5 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
6 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
7 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
8 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
9 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
10 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
11 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
12 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
13 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
14 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
15 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
16 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
17 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
18 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
19 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
20 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
21 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
22 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
23 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
24 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
25 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
26 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
27 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
28 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
29 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
30 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
31 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
32 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
33 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
34 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
35 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
36 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
37 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
38 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
39 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
40 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
41 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
42 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
43 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
44 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
45 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
46 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
47 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
48 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
49 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
50 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
51 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
54 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
61 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
73 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
74 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
75 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
76 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
77 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
78 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
81 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
85 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
86 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
106 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
107 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
108 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
109 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
120 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
193 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
194 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
217 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
218 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
219 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
220 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
221 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
234 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
235 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
238 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
239 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
240 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
241 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
242 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
245 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
246 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
247 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
248 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
249 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
250 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
251 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
255 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
256 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
257 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
260 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
268 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
269 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
270 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
271 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
272 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
275 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
276 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
277 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
278 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
279 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
280 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
281 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
285 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
303 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
304 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
305 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
306 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
307 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
308 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
309 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
312 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
313 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
322 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
327 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
328 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
329 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
330 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
331 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
336 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
337 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
338 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
339 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
340 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
341 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
342 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
343 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
344 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
345 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
346 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
347 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
348 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
349 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
350 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
351 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
352 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
353 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
354 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
355 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
356 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
357 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
358 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
359 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
360 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
361 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
362 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
363 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
364 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
365 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
366 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
367 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
368 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
369 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
372 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
373 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
374 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
375 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
376 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
377 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
378 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
379 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
380 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
381 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.29
Metatranscriptomes 1.95
Isolates 8.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.65
Nodule 6.97
Rhizoplane 6.48
Rhizosphere 73.91
Stem 0
Stem Tuber 0
Unclassified 6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006759J45824_1023430 3300003163 Bacteria 671
2 Ga0006770J48903_1023836 3300003305 Bacteria 613
3 Ga0007417J51691_1017275 3300003544 Bacteria 744
4 Ga0007410J51695_1025237 3300003574 Bacteria 941
5 Ga0007409J51694_1017164 3300003575 Bacteria 1417
6 Ga0007429J51699_1065422 3300003579 Bacteria 812
7 Ga0032354_1055850 3300003693 Bacteria 714
8 Ga0058861_10031194 3300004800 Bacteria 761
9 Ga0070676_10101962 3300005328 Bacteria 1774
10 Ga0070690_100005749 3300005330 Bacteria 6987
11 Ga0070670_100322927 3300005331 Bacteria 1353
12 Ga0070670_100650431 3300005331 Bacteria 946
13 Ga0070677_10041315 3300005333 Bacteria 1820
14 Ga0070677_10043910 3300005333 Bacteria 1777
15 Ga0068869_100058999 3300005334 Bacteria 2808
16 Ga0068869_100235870 3300005334 Bacteria 1455
17 Ga0068869_100299598 3300005334 Bacteria 1298
18 Ga0068869_100538193 3300005334 Bacteria 980
19 Ga0070682_100021003 3300005337 Bacteria 3848
20 Ga0070682_100894514 3300005337 Bacteria 729
21 Ga0068868_100039029 3300005338 Bacteria 3687
22 Ga0068868_100270052 3300005338 Bacteria 1437
23 Ga0070689_100001150 3300005340 Bacteria 16713
24 Ga0070689_100760515 3300005340 Bacteria 850
25 Ga0070687_100033649 3300005343 Bacteria 2532
26 Ga0070687_100142902 3300005343 Bacteria 1396
27 Ga0070687_100617489 3300005343 Bacteria 747
28 Ga0070668_100165386 3300005347 Bacteria 1797
29 Ga0070669_100011396 3300005353 Bacteria 6312
30 Ga0070669_100682012 3300005353 Bacteria 866
31 Ga0070675_100066564 3300005354 Bacteria 2980
32 Ga0070675_100094539 3300005354 Bacteria 2508
33 Ga0070675_100135769 3300005354 Bacteria 2099
34 Ga0070671_100285699 3300005355 Bacteria 1403
35 Ga0070674_100011465 3300005356 Bacteria 5398
36 Ga0070674_100106209 3300005356 Bacteria 2054
37 Ga0070674_100516984 3300005356 Bacteria 997
38 Ga0070673_100011520 3300005364 Bacteria 6038
39 Ga0070673_100030355 3300005364 Bacteria 4043
40 Ga0070659_100300975 3300005366 Bacteria 1337
41 Ga0070659_100402544 3300005366 Bacteria 1156
42 Ga0070709_10002670 3300005434 Bacteria 9635
43 Ga0070714_100030639 3300005435 Bacteria 4480
44 Ga0070713_100049060 3300005436 Bacteria 3481
45 Ga0070710_10058601 3300005437 Bacteria 2185
46 Ga0070701_10068760 3300005438 Bacteria 1888
47 Ga0070701_10329259 3300005438 Bacteria 947
48 Ga0070705_100003706 3300005440 Bacteria 7483
49 Ga0070705_100179304 3300005440 Bacteria 1433
50 Ga0070700_100036312 3300005441 Bacteria 2987
51 Ga0070700_100197281 3300005441 Bacteria 1411
52 Ga0070700_100339581 3300005441 Bacteria 1110
53 Ga0070694_100004882 3300005444 Bacteria 8077
54 Ga0070663_100073219 3300005455 Bacteria 2498
55 Ga0070678_100029248 3300005456 Bacteria 3771
56 Ga0070678_100126444 3300005456 Bacteria 2024
57 Ga0070678_100417633 3300005456 Bacteria 1169
58 Ga0070662_100059233 3300005457 Bacteria 2789
59 Ga0070699_100064925 3300005518 Bacteria 3167
60 Ga0070699_100388509 3300005518 Bacteria 1261
61 Ga0070697_100217816 3300005536 Unclassified 1626
62 Ga0068853_100055406 3300005539 Bacteria 3417
63 Ga0070672_100013413 3300005543 Bacteria 5789
64 Ga0070672_100072842 3300005543 Bacteria 2736
65 Ga0070672_100207441 3300005543 Bacteria 1640
66 Ga0070686_100162243 3300005544 Bacteria 1575
67 Ga0070686_100303984 3300005544 Bacteria 1184
68 Ga0070686_100394737 3300005544 Bacteria 1050
69 Ga0070686_100547519 3300005544 Bacteria 905
70 Ga0070695_100013674 3300005545 Bacteria 4878
71 Ga0070693_100157995 3300005547 Bacteria 1441
72 Ga0070693_100729260 3300005547 Bacteria 728
73 Ga0070665_100152388 3300005548 Bacteria 2314
74 Ga0070665_100274245 3300005548 Bacteria 1688
75 Ga0070665_100624465 3300005548 Bacteria 1091
76 Ga0070665_100628579 3300005548 Bacteria 1087
77 Ga0070665_100651833 3300005548 Bacteria 1066
78 Ga0070665_100690568 3300005548 Bacteria 1034
79 Ga0070704_100088418 3300005549 Bacteria 2302
80 Ga0068855_100083690 3300005563 Bacteria 3695
81 Ga0068855_100149625 3300005563 Bacteria 2655
82 Ga0070664_100137841 3300005564 Bacteria 2146
83 Ga0070664_100877307 3300005564 Bacteria 841
84 Ga0068857_100765851 3300005577 Bacteria 920
85 Ga0068857_101068234 3300005577 Bacteria 779
86 Ga0068854_100039540 3300005578 Bacteria 3324
87 Ga0068856_100000050 3300005614 Bacteria 108220
88 Ga0068856_100147817 3300005614 Bacteria 2357
89 Ga0070702_100222647 3300005615 Bacteria 1262
90 Ga0068852_100639319 3300005616 Bacteria 1071
91 Ga0068859_100147415 3300005617 Bacteria 2429
92 Ga0068864_100142183 3300005618 Bacteria 2166
93 Ga0068864_100317351 3300005618 Bacteria 1463
94 Ga0068864_100524187 3300005618 Bacteria 1143
95 Ga0068861_100000527 3300005719 Bacteria 22405
96 Ga0068861_100017283 3300005719 Bacteria 5117
97 Ga0068861_100084824 3300005719 Bacteria 2487
98 Ga0068861_100834839 3300005719 Bacteria 867
99 Ga0068870_10012979 3300005840 Bacteria 3904
100 Ga0068870_10393493 3300005840 Bacteria 900
101 Ga0068863_100069157 3300005841 Bacteria 3339
102 Ga0068863_100175955 3300005841 Bacteria 2054
103 Ga0068863_100360842 3300005841 Bacteria 1416
104 Ga0068858_100085742 3300005842 Bacteria 2930
105 Ga0068858_100222297 3300005842 Bacteria 1789
106 Ga0068862_100046446 3300005844 Bacteria 3705
107 Ga0068862_100576257 3300005844 Bacteria 1077
108 Ga0068862_100938236 3300005844 Bacteria 853
109 Ga0081455_10001291 3300005937 Bacteria 31153
110 Ga0081540_1004281 3300005983 Bacteria 10946
111 Ga0075365_10293234 3300006038 Bacteria 1145
112 Ga0075368_10147300 3300006042 Bacteria 983
113 Ga0075363_100017074 3300006048 Bacteria 3593
114 Ga0075364_10052860 3300006051 Bacteria 2655
115 Ga0075364_10589089 3300006051 Bacteria 760
116 Ga0070716_100308907 3300006173 Bacteria 1103
117 Ga0075367_10071341 3300006178 Bacteria 2089
118 Ga0075369_10062059 3300006186 Bacteria 1632
119 Ga0097621_100004268 3300006237 Bacteria 9927
120 Ga0075370_10048405 3300006353 Bacteria 2408
121 Ga0068871_100054828 3300006358 Bacteria 3235
122 Ga0068871_100273239 3300006358 Bacteria 1477
123 Ga0068871_100418255 3300006358 Bacteria 1196
124 Ga0075434_100011030 3300006871 Bacteria 8503
125 Ga0075434_100014712 3300006871 Bacteria 7486
126 Ga0075434_100097147 3300006871 Bacteria 2950
127 Ga0068865_100018617 3300006881 Bacteria 4483
128 Ga0068865_100112928 3300006881 Bacteria 2007
129 Ga0068865_100577737 3300006881 Bacteria 947
130 Ga0075436_100266614 3300006914 Bacteria 1222
131 Ga0097620_100147400 3300006931 Bacteria 2429
132 Ga0075435_100139090 3300007076 Bacteria 2036
133 Ga0075435_100467920 3300007076 Bacteria 1088
134 Ga0099794_10254534 3300007265 Bacteria 906
135 Ga0111539_10221694 3300009094 Bacteria 2202
136 Ga0105243_10797672 3300009148 Bacteria 930
137 Ga0105241_10028543 3300009174 Bacteria 4159
138 Ga0105242_10241016 3300009176 Bacteria 1626
139 Ga0105248_10187587 3300009177 Bacteria 2330
140 Ga0105248_10383029 3300009177 Bacteria 1584
141 Ga0105248_11017033 3300009177 Bacteria 936
142 Ga0105237_10388731 3300009545 Bacteria 1400
143 Ga0105238_10078735 3300009551 Bacteria 3286
144 Ga0105238_10586568 3300009551 Bacteria 1121
145 Ga0105249_10628574 3300009553 Bacteria 1130
146 Ga0105239_10032029 3300010375 Bacteria 5778
147 Ga0105239_10041589 3300010375 Bacteria 5037
148 Ga0105239_10056868 3300010375 Bacteria 4290
149 Ga0105239_10439379 3300010375 Bacteria 1479
150 Ga0105246_10087483 3300011119 Bacteria 2237
151 Ga0105246_10199204 3300011119 Bacteria 1555
152 Ga0157370_10355250 3300013104 Bacteria 1351
153 Ga0157374_10013357 3300013296 Bacteria 7167
154 Ga0157374_10101374 3300013296 Bacteria 2761
155 Ga0157378_10096348 3300013297 Bacteria 2696
156 Ga0163162_11277380 3300013306 Bacteria 834
157 Ga0163162_11530602 3300013306 Bacteria 760
158 Ga0157375_10663982 3300013308 Bacteria 1198
159 Ga0163163_10191352 3300014325 Bacteria 2095
160 Ga0163163_11282143 3300014325 Bacteria 795
161 Ga0157380_10093387 3300014326 Bacteria 2488
162 Ga0157380_10525822 3300014326 Bacteria 1155
163 Ga0157380_10745759 3300014326 Bacteria 990
164 Ga0157380_11408754 3300014326 Bacteria 748
165 Ga0157380_11759819 3300014326 Bacteria 678
166 Ga0157379_10431027 3300014968 Bacteria 1215
167 Ga0157376_10182387 3300014969 Bacteria 1920
168 Ga0163161_10317464 3300017792 Bacteria 1231
169 Ga0206353_10333827 3300020082 Bacteria 823
170 Ga0213871_10015537 3300021441 Bacteria 1822
171 Ga0207656_10198824 3300025321 Bacteria 967
172 Ga0207682_10006385 3300025893 Bacteria 4753
173 Ga0207682_10066823 3300025893 Bacteria 1516
174 Ga0207682_10081010 3300025893 Bacteria 1391
175 Ga0207642_10314584 3300025899 Bacteria 912
176 Ga0207699_10002666 3300025906 Bacteria 8432
177 Ga0207645_10035317 3300025907 Bacteria 3210
178 Ga0207643_10041620 3300025908 Bacteria 2589
179 Ga0207643_10653097 3300025908 Bacteria 679
180 Ga0207705_10616183 3300025909 Bacteria 844
181 Ga0207654_10016729 3300025911 Bacteria 3822
182 Ga0207662_10266191 3300025918 Bacteria 1130
183 Ga0207662_10268340 3300025918 Bacteria 1125
184 Ga0207662_10318493 3300025918 Bacteria 1038
185 Ga0207649_10130870 3300025920 Bacteria 1704
186 Ga0207649_10722262 3300025920 Bacteria 774
187 Ga0207652_10530857 3300025921 Bacteria 1058
188 Ga0207650_10420601 3300025925 Bacteria 1109
189 Ga0207659_10031789 3300025926 Bacteria 3617
190 Ga0207659_10180346 3300025926 Bacteria 1673
191 Ga0207659_10310832 3300025926 Bacteria 1297
192 Ga0207687_10456219 3300025927 Bacteria 1061
193 Ga0207700_10067759 3300025928 Bacteria 2733
194 Ga0207664_10173951 3300025929 Bacteria 1844
195 Ga0207644_10063995 3300025931 Bacteria 2672
196 Ga0207706_10158590 3300025933 Bacteria 1990
197 Ga0207706_10227494 3300025933 Bacteria 1632
198 Ga0207686_10119918 3300025934 Bacteria 1789
199 Ga0207670_10003275 3300025936 Bacteria 8578
200 Ga0207669_10053305 3300025937 Bacteria 2435
201 Ga0207669_10437815 3300025937 Bacteria 1033
202 Ga0207704_10214552 3300025938 Bacteria 1419
203 Ga0207704_10417891 3300025938 Bacteria 1062
204 Ga0207691_10010191 3300025940 Bacteria 9016
205 Ga0207691_10014947 3300025940 Bacteria 7395
206 Ga0207691_10555885 3300025940 Bacteria 973
207 Ga0207711_10265787 3300025941 Bacteria 1578
208 Ga0207689_10019230 3300025942 Bacteria 5757
209 Ga0207689_10096166 3300025942 Bacteria 2433
210 Ga0207689_10339297 3300025942 Bacteria 1248
211 Ga0207661_10918948 3300025944 Bacteria 806
212 Ga0207679_10294050 3300025945 Bacteria 1397
213 Ga0207679_10640738 3300025945 Bacteria 960
214 Ga0207667_10103780 3300025949 Bacteria 2932
215 Ga0207667_10233982 3300025949 Bacteria 1881
216 Ga0207651_10022430 3300025960 Bacteria 3860
217 Ga0207651_10055919 3300025960 Bacteria 2713
218 Ga0207651_10146487 3300025960 Bacteria 1832
219 Ga0207651_10994862 3300025960 Bacteria 749
220 Ga0207712_10644550 3300025961 Bacteria 920
221 Ga0207668_10345691 3300025972 Bacteria 1242
222 Ga0207668_10708753 3300025972 Bacteria 885
223 Ga0207668_10876441 3300025972 Bacteria 798
224 Ga0207658_10511348 3300025986 Bacteria 1071
225 Ga0207703_10092301 3300026035 Bacteria 2548
226 Ga0207639_10036977 3300026041 Bacteria 3623
227 Ga0207678_10214526 3300026067 Bacteria 1647
228 Ga0207678_10408098 3300026067 Bacteria 1177
229 Ga0207708_10046326 3300026075 Bacteria 3311
230 Ga0207708_10100374 3300026075 Bacteria 2240
231 Ga0207708_10113715 3300026075 Bacteria 2103
232 Ga0207708_10172039 3300026075 Bacteria 1716
233 Ga0207708_10328989 3300026075 Bacteria 1249
234 Ga0207702_10000192 3300026078 Bacteria 72539
235 Ga0207702_10756573 3300026078 Bacteria 959
236 Ga0207641_10131892 3300026088 Bacteria 2244
237 Ga0207641_10132681 3300026088 Bacteria 2238
238 Ga0207641_10264911 3300026088 Bacteria 1610
239 Ga0207641_10965269 3300026088 Bacteria 848
240 Ga0207648_10074116 3300026089 Bacteria 2966
241 Ga0207648_10093102 3300026089 Bacteria 2636
242 Ga0207676_10069809 3300026095 Bacteria 2815
243 Ga0207676_10248613 3300026095 Bacteria 1599
244 Ga0207676_10579574 3300026095 Bacteria 1075
245 Ga0207676_10606789 3300026095 Bacteria 1052
246 Ga0207674_10035147 3300026116 Bacteria 5231
247 Ga0207674_10364702 3300026116 Bacteria 1396
248 Ga0207675_100001153 3300026118 Bacteria 26238
249 Ga0207675_100001636 3300026118 Bacteria 22459
250 Ga0207675_100081273 3300026118 Bacteria 3038
251 Ga0207675_100094886 3300026118 Bacteria 2806
252 Ga0207675_100100260 3300026118 Bacteria 2728
253 Ga0207675_101100700 3300026118 Bacteria 814
254 Ga0207683_10006481 3300026121 Bacteria 10016
255 Ga0207683_10043558 3300026121 Bacteria 3923
256 Ga0207683_10098919 3300026121 Bacteria 2603
257 Ga0207698_10360546 3300026142 Bacteria 1376
258 Ga0207698_11669668 3300026142 Bacteria 652
259 Ga0268266_10233873 3300028379 Bacteria 1693
260 Ga0268266_10352325 3300028379 Bacteria 1383
261 Ga0268266_10473967 3300028379 Bacteria 1192
262 Ga0268266_10606456 3300028379 Bacteria 1052
263 Ga0268266_10913186 3300028379 Bacteria 849
264 Ga0268265_10020656 3300028380 Bacteria 4600
265 Ga0268265_10196756 3300028380 Bacteria 1745
266 Ga0268264_10431565 3300028381 Bacteria 1273
267 Ga0268264_10543158 3300028381 Bacteria 1139
268 Ga0268264_11088929 3300028381 Bacteria 807
269 Ga0307517_10207464 3300028786 Bacteria 1213
270 Ga0307515_10223256 3300028794 Bacteria 1696
271 Ga0311001_1004563 3300029277 Bacteria 1019
272 Ga0307511_10113779 3300030521 Bacteria 1709
273 Ga0265332_10215282 3300031238 Bacteria 797
274 Ga0265327_10001037 3300031251 Bacteria 39182
275 Ga0307513_10039521 3300031456 Bacteria 5229
276 Ga0307513_10075527 3300031456 Bacteria 3499
277 Ga0307513_10338051 3300031456 Bacteria 1257
278 Ga0307509_10086613 3300031507 Bacteria 3221
279 Ga0307509_10116301 3300031507 Bacteria 2664
280 Ga0307509_10130983 3300031507 Bacteria 2464
281 Ga0307405_10087546 3300031731 Bacteria 2053
282 Ga0307413_10005441 3300031824 Bacteria 5687
283 Ga0307413_10218052 3300031824 Bacteria 1391
284 Ga0307413_10293800 3300031824 Bacteria 1229
285 Ga0307406_10008182 3300031901 Bacteria 5827
286 Ga0307412_10157107 3300031911 Bacteria 1685
287 Ga0307409_100678700 3300031995 Bacteria 1027
288 Ga0307416_100109787 3300032002 Bacteria 2427
289 Ga0307416_100181734 3300032002 Bacteria 1972
290 Ga0307416_100559337 3300032002 Bacteria 1218
291 Ga0307414_10531830 3300032004 Bacteria 1045
292 Ga0307411_10018164 3300032005 Bacteria 4028
293 Ga0307411_11234147 3300032005 Bacteria 679
294 Ga0307415_100290464 3300032126 Bacteria 1349
295 Ga0307510_10003003 3300033180 Bacteria 19416
296 Ga0373936_0017350 3300035113 Bacteria 2771
297 Ga0373935_0441763 3300035692 Bacteria 939
298 Ga0395899_0280457 3300037312 Bacteria 1134
299 Ga0395900_0325871 3300037418 Bacteria 1515
300 Ga0395898_0243504 3300037466 Bacteria 1715
301 Ga0395905_0029801 3300037471 Bacteria 5143
302 Ga0395905_0130046 3300037471 Bacteria 2368
303 Ga0395901_0065983 3300038443 Bacteria 3770
304 Ga0436360_0615805 3300039438 Bacteria 10716
305 Ga0451791_1831530 3300041451 Bacteria 1820
306 Ga0451797_1132125 3300041453 Bacteria 991
307 Ga0451798_0828765 3300041458 Bacteria 843
308 Ga0451807_0568922 3300041486 Bacteria 611
309 Ga0451807_2251806 3300041486 Bacteria 1636
310 Ga0451837_0227098 3300041494 Bacteria 2116
311 Ga0451843_1622578 3300041509 Bacteria 1487
312 Ga0466963_0194352 3300044694 Bacteria 1418
313 Ga0466960_0439956 3300044901 Bacteria 756
314 Ga0466967_0369288 3300045976 Bacteria 1391
315 Ga0495617_070387 3300046452 Bacteria 1150
316 Ga0495617_114977 3300046452 Bacteria 869
317 Ga0495592_0005300 3300046454 Bacteria 9506
318 Ga0495603_0005505 3300046455 Bacteria 7553
319 Ga0495590_0001203 3300046457 Bacteria 11308
320 Ga0495590_0023603 3300046457 Bacteria 2170
321 Ga0495629_0107491 3300046459 Bacteria 1946
322 Ga0495629_0121386 3300046459 Bacteria 1821
323 Ga0495638_0010135 3300046460 Bacteria 6563
324 Ga0495638_0028677 3300046460 Bacteria 3592
325 Ga0495638_0069253 3300046460 Bacteria 2162
326 Ga0495638_0157903 3300046460 Bacteria 1310
327 Ga0495638_0205834 3300046460 Bacteria 1108
328 Ga0495651_0344659 3300046462 Bacteria 986
329 Ga0495653_0021415 3300046463 Bacteria 5238
330 Ga0495653_0400871 3300046463 Bacteria 872
331 Ga0495653_0520025 3300046463 Bacteria 740
332 Ga0495582_0143309 3300046473 Bacteria 1355
333 Ga0495584_0071293 3300046491 Bacteria 1746
334 Ga0495584_0133606 3300046491 Bacteria 1259
335 Ga0495585_0043218 3300046492 Bacteria 2521
336 Ga0495594_0018893 3300046499 Bacteria 3657
337 Ga0495594_0052833 3300046499 Bacteria 2237
338 Ga0495594_0086290 3300046499 Bacteria 1756
339 Ga0495596_0015087 3300046500 Bacteria 3244
340 Ga0495596_0142327 3300046500 Bacteria 931
341 Ga0495607_0117011 3300046501 Bacteria 1405
342 Ga0495583_0005576 3300046506 Bacteria 8494
343 Ga0495583_0102792 3300046506 Bacteria 1218
344 Ga0495606_0186421 3300046507 Bacteria 1192
345 Ga0495616_0024626 3300046513 Bacteria 3226
346 Ga0495616_0143055 3300046513 Bacteria 1087
347 Ga0495620_0066811 3300046515 Bacteria 1481
348 Ga0495628_0005560 3300046516 Bacteria 11034
349 Ga0495631_0015029 3300046518 Bacteria 3720
350 Ga0495631_0060815 3300046518 Bacteria 1638
351 Ga0495632_0001958 3300046519 Bacteria 16420
352 Ga0495632_0003345 3300046519 Bacteria 11420
353 Ga0495632_0129966 3300046519 Bacteria 1172
354 Ga0495643_0148528 3300046522 Bacteria 1162
355 Ga0495644_0039836 3300046523 Bacteria 1771
356 Ga0495644_0060302 3300046523 Bacteria 1426
357 Ga0495648_0007875 3300046524 Bacteria 8467
358 Ga0495648_0010475 3300046524 Bacteria 7058
359 Ga0495648_0089586 3300046524 Bacteria 1726
360 Ga0495648_0108236 3300046524 Bacteria 1518
361 Ga0495648_0115684 3300046524 Bacteria 1450
362 Ga0495663_0055752 3300046525 Bacteria 1233
363 Ga0495642_0055221 3300046528 Bacteria 1639
364 Ga0495642_0062421 3300046528 Bacteria 1547
365 Ga0495642_0209445 3300046528 Bacteria 850
366 Ga0495652_0058905 3300046529 Bacteria 3251
367 Ga0495586_0010637 3300046535 Bacteria 4893
368 Ga0495586_0057855 3300046535 Bacteria 2104
369 Ga0495587_0306780 3300046536 Bacteria 887
370 Ga0495598_0046836 3300046537 Bacteria 1286
371 Ga0495609_0070934 3300046538 Bacteria 1531
372 Ga0495609_0114646 3300046538 Bacteria 1161
373 Ga0495621_0145442 3300046539 Bacteria 930
374 Ga0495597_0001562 3300046542 Bacteria 16186
375 Ga0495597_0248746 3300046542 Bacteria 699
376 Ga0495645_0363989 3300046543 Bacteria 929
377 Ga0495622_0052103 3300046557 Bacteria 1898
378 Ga0495633_0166830 3300046558 Bacteria 1015
379 Ga0495668_0002222 3300046616 Bacteria 16489
380 Ga0495668_0025683 3300046616 Bacteria 3345
381 Ga0495668_0043386 3300046616 Bacteria 2502
382 Ga0495611_0041632 3300046648 Bacteria 2049
383 Ga0495611_0062149 3300046648 Bacteria 1698
384 Ga0495625_0009026 3300046660 Bacteria 8418
385 Ga0495625_0086256 3300046660 Bacteria 2178
386 Ga0495625_0338255 3300046660 Bacteria 954
387 Ga0495625_0388298 3300046660 Bacteria 874
388 Ga0495635_0013595 3300046663 Bacteria 5695
389 Ga0495635_0328218 3300046663 Bacteria 1023
390 Ga0495661_0004355 3300046665 Bacteria 10242
391 Ga0495661_0029564 3300046665 Bacteria 3495
392 Ga0495661_0082498 3300046665 Bacteria 1850
393 Ga0495661_0084522 3300046665 Bacteria 1821
394 Ga0495661_0134158 3300046665 Bacteria 1353
395 Ga0495661_0170061 3300046665 Bacteria 1163
396 Ga0495588_0009132 3300046674 Bacteria 4572
397 Ga0495599_0075253 3300046678 Bacteria 2108
398 Ga0495658_0450449 3300046683 Bacteria 822
399 Ga0495669_0001187 3300046684 Bacteria 10831
400 Ga0495671_0008818 3300046692 Bacteria 5663
401 Ga0495671_0133109 3300046692 Bacteria 1212
402 Ga0495649_0057787 3300046694 Bacteria 2091
403 Ga0495649_0066863 3300046694 Bacteria 1928
404 Ga0495649_0083155 3300046694 Bacteria 1710
405 Ga0495660_0053919 3300046810 Bacteria 2180
406 Ga0495604_0069951 3300047317 Bacteria 2659
407 Ga0495636_0127131 3300047318 Bacteria 1132
408 Ga0495672_0000198 3300047320 Bacteria 85895
409 Ga0495672_0072576 3300047320 Bacteria 1944
410 Ga0495672_0122360 3300047320 Bacteria 1381
411 Ga0495680_0011678 3300047322 Bacteria 7758
412 Ga0495683_0028068 3300047323 Bacteria 2877
413 Ga0495683_0175401 3300047323 Bacteria 982
414 Ga0495687_002705 3300047443 Bacteria 13754
415 Ga0495687_009929 3300047443 Bacteria 5267
416 Ga0495675_0024518 3300047444 Bacteria 3846
417 Ga0495673_0031927 3300047469 Bacteria 2462
418 Ga0495681_0015665 3300047470 Bacteria 4281
419 Ga0495593_0002952 3300047673 Bacteria 10235
420 Ga0495602_0096813 3300048088 Bacteria 2433
421 Ga0495614_0005712 3300048089 Bacteria 5606
422 Ga0495626_0036804 3300048091 Bacteria 2329
423 Ga0495626_0056762 3300048091 Bacteria 1792
424 Ga0495626_0241855 3300048091 Bacteria 726
425 Ga0496100_0021811 3300048903 Bacteria 3864
426 Ga0496100_0146503 3300048903 Bacteria 1680
427 Ga0496101_0029250 3300048904 Bacteria 3853
428 Ga0496101_0380670 3300048904 Bacteria 1110
429 Ga0496102_0367327 3300048905 Bacteria 1354
430 Ga0496103_0101306 3300048906 Bacteria 1823
431 Ga0496103_0506660 3300048906 Bacteria 772
432 Ga0496104_0001311 3300048907 Bacteria 21463
433 Ga0496104_0162793 3300048907 Bacteria 2140
434 Ga0496104_0705073 3300048907 Bacteria 917
435 Ga0496105_0000231 3300048908 Bacteria 37741
436 Ga0496106_0129368 3300048909 Bacteria 1979
437 Ga0496107_0128129 3300048910 Bacteria 1872
438 Ga0496107_0182717 3300048910 Bacteria 1557
439 Ga0496107_0332730 3300048910 Bacteria 1130
440 Ga0496107_0518406 3300048910 Bacteria 884
441 Ga0496108_0177753 3300048911 Bacteria 1843
442 Ga0496108_0193352 3300048911 Bacteria 1764
443 Ga0496109_0024245 3300048912 Bacteria 5392
444 Ga0496109_0056961 3300048912 Bacteria 3566
445 Ga0496110_0033205 3300048913 Bacteria 4462
446 Ga0496110_0078155 3300048913 Bacteria 2946
447 Ga0496110_0094867 3300048913 Bacteria 2671
448 Ga0496111_0032506 3300048914 Bacteria 3720
449 Ga0496111_0269657 3300048914 Bacteria 1263
450 Ga0496111_0281341 3300048914 Bacteria 1234
451 Ga0496112_0026997 3300048915 Bacteria 5534
452 Ga0496112_0236304 3300048915 Bacteria 1781
453 Ga0496112_0666718 3300048915 Bacteria 969
454 Ga0496113_0051563 3300048916 Bacteria 3071
455 Ga0496113_0086445 3300048916 Bacteria 2410
456 Ga0496114_0170041 3300048917 Bacteria 1899
457 Ga0496115_0000077 3300048918 Bacteria 89885
458 Ga0496115_0021945 3300048918 Bacteria 4937
459 Ga0496115_0029788 3300048918 Bacteria 4290
460 Ga0496116_0180337 3300048919 Bacteria 1132
461 Ga0496117_0065160 3300048920 Bacteria 2479
462 Ga0496118_0064618 3300048921 Bacteria 2684
463 Ga0496119_0007747 3300048922 Bacteria 9590
464 Ga0496122_0009572 3300048925 Bacteria 10167
465 Ga0496123_0003835 3300048926 Bacteria 16396
466 Ga0496124_0123556 3300048927 Bacteria 2065
467 Ga0496124_0520289 3300048927 Bacteria 793
468 Ga0496125_0008961 3300048928 Bacteria 10379
469 Ga0496125_0113643 3300048928 Bacteria 1953
470 Ga0496125_0201030 3300048928 Bacteria 1304
471 Ga0496126_0000047 3300048929 Bacteria 322212
472 Ga0496126_0246633 3300048929 Bacteria 1490
473 Ga0495678_002103 3300049459 Bacteria 14125
474 Ga0495678_002762 3300049459 Bacteria 11486
475 Ga0495682_0003783 3300049460 Bacteria 6657
476 Ga0495682_0047474 3300049460 Bacteria 1566
477 Ga0495682_0050840 3300049460 Bacteria 1508
478 Ga0501032_0040051 3300049569 Bacteria 3185
479 Ga0501032_0101876 3300049569 Bacteria 1902
480 Ga0501033_0000821 3300049570 Bacteria 28339
481 Ga0501033_0140968 3300049570 Bacteria 1742
482 Ga0501033_0780855 3300049570 Bacteria 647
483 Ga0501034_0003942 3300049571 Bacteria 16678
484 Ga0501034_0597849 3300049571 Bacteria 1009
485 Ga0501034_0646675 3300049571 Bacteria 959
486 Ga0501037_0012293 3300049573 Bacteria 6300
487 Ga0501038_0017815 3300049574 Bacteria 6417
488 Ga0501038_0241439 3300049574 Bacteria 1434
489 Ga0501039_0001831 3300049575 Bacteria 15724
490 Ga0501043_0032490 3300049579 Bacteria 4103
491 Ga0501046_0004676 3300049580 Bacteria 12355
492 Ga0501067_0198900 3300049583 Bacteria 1116
493 Ga0501067_0457279 3300049583 Bacteria 713
494 Ga0501068_0170991 3300049584 Bacteria 1371
495 Ga0501070_0049983 3300049586 Bacteria 3471
496 Ga0501071_0020230 3300049587 Bacteria 4624
497 Ga0501072_0549087 3300049588 Bacteria 912
498 Ga0501073_0010684 3300049589 Bacteria 6723
499 Ga0501073_0022274 3300049589 Bacteria 4564
500 Ga0501073_0355538 3300049589 Bacteria 1011
501 Ga0501074_0181048 3300049590 Bacteria 1503
502 Ga0501076_0119653 3300049592 Bacteria 2132
503 Ga0501076_0379484 3300049592 Bacteria 1162
504 Ga0501076_0474927 3300049592 Bacteria 1030
505 Ga0501077_0081002 3300049593 Bacteria 2056
506 Ga0501079_0035049 3300049741 Bacteria 3861
507 Ga0501079_0048283 3300049741 Bacteria 3285
508 Ga0501080_0004373 3300049742 Bacteria 12549
509 Ga0501080_0078606 3300049742 Bacteria 3067
510 Ga0501080_0289822 3300049742 Bacteria 1486
511 Ga0501080_0463337 3300049742 Bacteria 1135
512 Ga0501035_0053746 3300049822 Bacteria 3601
513 Ga0501035_0329865 3300049822 Bacteria 1280
514 nmdc:mga03683_211327_c1 3300050489 Bacteria 893
515 nmdc:mga00v17_112371_c1 3300050491 Bacteria 1729
516 nmdc:mga06z11_72338_c1 3300050494 Bacteria 1828
517 nmdc:mga04h51_95348_c1 3300050495 Bacteria 1077
518 nmdc:mga08y16_65452_c1 3300050511 Bacteria 3795
519 nmdc:mga0n895_1048_c1 3300050512 Bacteria 20116
520 nmdc:mga0n895_12069_c1 3300050512 Bacteria 7732
521 nmdc:mga0n895_80031_c1 3300050512 Bacteria 3255
522 nmdc:mga0rr50_124533_c1 3300050513 Bacteria 2056
523 nmdc:mga0rr50_231_c1 3300050513 Bacteria 30232
524 nmdc:mga08x19_12588_c1 3300050514 Bacteria 5101
525 nmdc:mga08x19_298344_c1 3300050514 Bacteria 1119
526 nmdc:mga0a205_1314_c1 3300050515 Bacteria 20915
527 nmdc:mga0a205_14878_c1 3300050515 Bacteria 7261
528 nmdc:mga0a205_616697_c1 3300050515 Bacteria 937
529 nmdc:mga0sz30_73293_c1 3300050516 Bacteria 1476
530 Ga0500635_0057466 3300053080 Bacteria 1349
531 Ga0500578_0174604 3300053086 Bacteria 1327
532 Ga0500644_0095452 3300053088 Bacteria 1121
533 Ga0500644_0130828 3300053088 Bacteria 988
534 Ga0500566_0000027 3300053094 Bacteria 76335
535 Ga0500566_0356031 3300053094 Bacteria 669
536 Ga0500640_000045 3300053095 Bacteria 18616
537 Ga0500558_229787 3300053106 Bacteria 624
538 Ga0500572_000514 3300053111 Bacteria 13208
539 Ga0500572_001152 3300053111 Bacteria 7642
540 Ga0500582_055327 3300053114 Bacteria 1315
541 Ga0500595_003720 3300053119 Bacteria 7034
542 Ga0500608_018872 3300053122 Bacteria 3153
543 Ga0500618_036625 3300053125 Bacteria 1136
544 Ga0500642_0096285 3300053130 Bacteria 1372
545 Ga0500658_0017757 3300053134 Bacteria 2660
546 Ga0500559_0002844 3300053136 Bacteria 8743
547 Ga0500577_0031216 3300053142 Bacteria 1862
548 Ga0500590_074254 3300053148 Bacteria 1684
549 Ga0500603_002960 3300053150 Bacteria 3673
550 Ga0500622_0110518 3300053156 Bacteria 1343
551 Ga0500630_002280 3300053159 Bacteria 9271
552 Ga0500634_0151880 3300053161 Bacteria 1081
553 Ga0500639_000003 3300053163 Bacteria 230428
554 Ga0500576_230620 3300053725 Bacteria 597
555 Ga0500645_083578 3300053730 Bacteria 910
556 Ga0500596_004250 3300053735 Bacteria 2646
557 Ga0500587_020594 3300053739 Bacteria 860
558 Ga0501084_0366044 3300054114 Bacteria 1218
559 Ga0587078_011609 3300059646 Bacteria 1025
560 Ga0587079_087795 3300059647 Bacteria 722
561 Ga0501082_0103223 3300060353 Bacteria 2466
562 Ga0501082_0221498 3300060353 Bacteria 1646

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_0568922 Ga0451807_0568922_59_535 155
2 iso_pu_bacteria 2507262055 2507510743 182
3 iso_pu_bacteria 2508501042 2508697310 182
4 iso_pu_bacteria 2513237098 2513672097 182
5 iso_pu_bacteria 2517093001 2517105099 182
6 iso_pu_bacteria 2524023205 2524437133 182
7 iso_pu_bacteria 2524023210 2524463877 182
8 iso_pu_bacteria 2528768022 2528854285 182
9 iso_pu_bacteria 2728368998 2728753424 182
10 iso_pu_bacteria 2744054633 2745076346 182
11 iso_pu_bacteria 2824704595 2824707884 182
12 iso_pu_bacteria 2824753945 2824759024 182
13 iso_pu_bacteria 2824763712 2824763912 182
14 iso_pu_bacteria 2885374607 2885376682 182
15 iso_pu_bacteria 2885383462 2885387914 182
16 iso_pu_bacteria 2903768456 2903771306 182
17 iso_pu_bacteria 2904711408 2904720504 182
18 iso_pu_bacteria 2929615660 2929616839 182
19 iso_pu_bacteria 2929624759 2929625582 182
20 iso_pu_bacteria 2933577622 2933577879 182
21 iso_pu_bacteria 2935608549 2935616078 182
22 iso_pu_bacteria 2935648319 2935654903 182
23 iso_pu_bacteria 2935656913 2935663827 182
24 iso_pu_bacteria 2935819856 2935819974 182
25 iso_pu_bacteria 2935847175 2935850016 182
26 iso_pu_bacteria 2935908558 2935915167 182
27 iso_pu_bacteria 2935916978 2935923844 182
28 iso_pu_bacteria 2935926038 2935932664 182
29 iso_pu_bacteria 2935934488 2935941252 182
30 iso_pu_bacteria 2935942939 2935949334 182
31 iso_pu_bacteria 2935951376 2935958029 182
32 iso_pu_bacteria 2935967501 2935974329 182
33 iso_pu_bacteria 2935984226 2935991622 182
34 iso_pu_bacteria 2936011229 2936017983 182
35 iso_pu_bacteria 2936019824 2936026486 182
36 iso_pu_bacteria 2936028420 2936035107 182
37 iso_pu_bacteria 2936046547 2936053257 182
38 iso_pu_bacteria 2936055302 2936059240 182
39 iso_pu_bacteria 8016630954 8016633561 182
40 iso_pu_bacteria 8019648815 8019655849 182
41 iso_pu_bacteria 8019687851 8019693536 182
42 iso_pu_bacteria 8055742211 8055748485 182
43 iso_pu_bacteria 8056681323 8056682055 182
44 iso_pu_bacteria 8056689827 8056694520 182
45 iso_pu_bacteria 2721755755 2723846817 184
46 iso_pu_bacteria 2791355199 2793076429 184
47 iso_pu_bacteria 2874604998 2874611223 184
48 iso_pu_bacteria 2876808645 2876816666 184
49 iso_pu_bacteria 2879110137 2879114357 184
50 iso_pu_bacteria 2889033259 2889038393 184
51 iso_pu_bacteria 2922361189 2922362509 184
52 iso_pu_bacteria 2922386360 2922387670 184
53 iso_pu_bacteria 8006964411 8006969005 184
54 iso_pu_bacteria 8006984368 8006987556 184
55 iso_pu_bacteria 8006994254 8006995051 184
56 iso_pu_bacteria 8056673599 8056679611 184
57 3300005577 Ga0068857_101068234 Ga0068857_1010682341 185
58 3300046616 Ga0495668_0002222 Ga0495668_0002222_9572_10132 185
59 3300048929 Ga0496126_0246633 Ga0496126_0246633_16_576 185
60 3300053125 Ga0500618_036625 Ga0500618_036625_271_837 185
61 3300005614 Ga0068856_100000050 Ga0068856_10000005037 186
62 3300005983 Ga0081540_1004281 Ga0081540_10042814 186
63 3300006178 Ga0075367_10071341 Ga0075367_100713412 186
64 3300006871 Ga0075434_100011030 Ga0075434_1000110304 186
65 3300006914 Ga0075436_100266614 Ga0075436_1002666142 186
66 3300020082 Ga0206353_10333827 Ga0206353_103338272 186
67 3300026078 Ga0207702_10000192 Ga0207702_1000019236 186
68 3300035113 Ga0373936_0017350 Ga0373936_0017350_1178_1741 186
69 3300049569 Ga0501032_0040051 Ga0501032_0040051_644_1210 186
70 3300049570 Ga0501033_0000821 Ga0501033_0000821_20098_20664 186
71 3300049571 Ga0501034_0003942 Ga0501034_0003942_6518_7084 186
72 3300049573 Ga0501037_0012293 Ga0501037_0012293_5575_6141 186
73 3300049574 Ga0501038_0017815 Ga0501038_0017815_4615_5181 186
74 3300049574 Ga0501038_0241439 Ga0501038_0241439_555_1121 186
75 3300049575 Ga0501039_0001831 Ga0501039_0001831_14244_14810 186
76 3300049580 Ga0501046_0004676 Ga0501046_0004676_6990_7556 186
77 3300049583 Ga0501067_0198900 Ga0501067_0198900_320_886 186
78 3300049586 Ga0501070_0049983 Ga0501070_0049983_1976_2542 186
79 3300049589 Ga0501073_0022274 Ga0501073_0022274_1976_2542 186
80 3300049590 Ga0501074_0181048 Ga0501074_0181048_326_892 186
81 3300049592 Ga0501076_0474927 Ga0501076_0474927_420_986 186
82 3300049741 Ga0501079_0048283 Ga0501079_0048283_1452_2018 186
83 3300049742 Ga0501080_0078606 Ga0501080_0078606_1525_2091 186
84 3300049822 Ga0501035_0053746 Ga0501035_0053746_1981_2547 186
85 3300050512 nmdc:mga0n895_12069_c1 nmdc:mga0n895_12069_c1_6090_6653 186
86 3300050514 nmdc:mga08x19_298344_c1 nmdc:mga08x19_298344_c1_297_860 186
87 3300053080 Ga0500635_0057466 Ga0500635_0057466_563_1126 186
88 3300053094 Ga0500566_0000027 Ga0500566_0000027_19811_20374 186
89 3300053095 Ga0500640_000045 Ga0500640_000045_25_588 186
90 3300053111 Ga0500572_001152 Ga0500572_001152_2452_3015 186
91 3300053122 Ga0500608_018872 Ga0500608_018872_1037_1600 186
92 3300053136 Ga0500559_0002844 Ga0500559_0002844_98_661 186
93 3300053148 Ga0500590_074254 Ga0500590_074254_506_1069 186
94 3300053150 Ga0500603_002960 Ga0500603_002960_2209_2772 186
95 3300053159 Ga0500630_002280 Ga0500630_002280_612_1175 186
96 3300053163 Ga0500639_000003 Ga0500639_000003_86811_87374 186
97 3300053725 Ga0500576_230620 Ga0500576_230620_11_574 186
98 3300053735 Ga0500596_004250 Ga0500596_004250_354_917 186
99 3300060353 Ga0501082_0221498 Ga0501082_0221498_766_1332 186
100 3300005334 Ga0068869_100538193 Ga0068869_1005381932 187
101 3300005343 Ga0070687_100617489 Ga0070687_1006174891 187
102 3300005544 Ga0070686_100303984 Ga0070686_1003039842 187
103 3300005563 Ga0068855_100149625 Ga0068855_1001496253 187
104 3300005564 Ga0070664_100137841 Ga0070664_1001378413 187
105 3300005578 Ga0068854_100039540 Ga0068854_1000395403 187
106 3300005840 Ga0068870_10393493 Ga0068870_103934932 187
107 3300006237 Ga0097621_100004268 Ga0097621_1000042688 187
108 3300006358 Ga0068871_100273239 Ga0068871_1002732392 187
109 3300025908 Ga0207643_10653097 Ga0207643_106530972 187
110 3300025949 Ga0207667_10103780 Ga0207667_101037802 187
111 3300025972 Ga0207668_10708753 Ga0207668_107087532 187
112 3300026067 Ga0207678_10408098 Ga0207678_104080981 187
113 3300026095 Ga0207676_10606789 Ga0207676_106067892 187
114 3300028381 Ga0268264_10431565 Ga0268264_104315652 187
115 3300031507 Ga0307509_10086613 Ga0307509_100866133 187
116 3300037466 Ga0395898_0243504 Ga0395898_0243504_216_794 187
117 3300037471 Ga0395905_0029801 Ga0395905_0029801_4068_4646 187
118 3300038443 Ga0395901_0065983 Ga0395901_0065983_237_815 187
119 3300046460 Ga0495638_0205834 Ga0495638_0205834_315_893 187
120 3300046463 Ga0495653_0021415 Ga0495653_0021415_111_683 187
121 3300046491 Ga0495584_0071293 Ga0495584_0071293_198_770 187
122 3300046499 Ga0495594_0018893 Ga0495594_0018893_2121_2699 187
123 3300046499 Ga0495594_0052833 Ga0495594_0052833_1260_1838 187
124 3300046500 Ga0495596_0015087 Ga0495596_0015087_1237_1809 187
125 3300046500 Ga0495596_0142327 Ga0495596_0142327_167_745 187
126 3300046501 Ga0495607_0117011 Ga0495607_0117011_402_974 187
127 3300046506 Ga0495583_0005576 Ga0495583_0005576_3172_3744 187
128 3300046513 Ga0495616_0143055 Ga0495616_0143055_197_769 187
129 3300046518 Ga0495631_0015029 Ga0495631_0015029_175_753 187
130 3300046518 Ga0495631_0060815 Ga0495631_0060815_582_1154 187
131 3300046519 Ga0495632_0001958 Ga0495632_0001958_6181_6753 187
132 3300046519 Ga0495632_0003345 Ga0495632_0003345_9393_9965 187
133 3300046522 Ga0495643_0148528 Ga0495643_0148528_445_1023 187
134 3300046523 Ga0495644_0039836 Ga0495644_0039836_310_888 187
135 3300046523 Ga0495644_0060302 Ga0495644_0060302_364_936 187
136 3300046524 Ga0495648_0007875 Ga0495648_0007875_7862_8440 187
137 3300046524 Ga0495648_0108236 Ga0495648_0108236_243_815 187
138 3300046524 Ga0495648_0115684 Ga0495648_0115684_551_1123 187
139 3300046525 Ga0495663_0055752 Ga0495663_0055752_470_1048 187
140 3300046528 Ga0495642_0055221 Ga0495642_0055221_190_768 187
141 3300046528 Ga0495642_0209445 Ga0495642_0209445_142_720 187
142 3300046535 Ga0495586_0010637 Ga0495586_0010637_821_1399 187
143 3300046536 Ga0495587_0306780 Ga0495587_0306780_121_693 187
144 3300046538 Ga0495609_0070934 Ga0495609_0070934_777_1355 187
145 3300046542 Ga0495597_0001562 Ga0495597_0001562_6198_6770 187
146 3300046648 Ga0495611_0062149 Ga0495611_0062149_550_1128 187
147 3300046660 Ga0495625_0086256 Ga0495625_0086256_1276_1854 187
148 3300046660 Ga0495625_0338255 Ga0495625_0338255_153_731 187
149 3300046660 Ga0495625_0388298 Ga0495625_0388298_12_590 187
150 3300046663 Ga0495635_0013595 Ga0495635_0013595_2268_2846 187
151 3300046665 Ga0495661_0004355 Ga0495661_0004355_9353_9931 187
152 3300046665 Ga0495661_0029564 Ga0495661_0029564_1222_1800 187
153 3300046665 Ga0495661_0082498 Ga0495661_0082498_717_1289 187
154 3300046665 Ga0495661_0084522 Ga0495661_0084522_1079_1657 187
155 3300046665 Ga0495661_0170061 Ga0495661_0170061_258_836 187
156 3300046674 Ga0495588_0009132 Ga0495588_0009132_167_745 187
157 3300046684 Ga0495669_0001187 Ga0495669_0001187_9547_10125 187
158 3300046692 Ga0495671_0008818 Ga0495671_0008818_4915_5487 187
159 3300046694 Ga0495649_0057787 Ga0495649_0057787_1138_1710 187
160 3300046694 Ga0495649_0066863 Ga0495649_0066863_1148_1726 187
161 3300046694 Ga0495649_0083155 Ga0495649_0083155_915_1487 187
162 3300046810 Ga0495660_0053919 Ga0495660_0053919_1091_1663 187
163 3300047317 Ga0495604_0069951 Ga0495604_0069951_1118_1696 187
164 3300047318 Ga0495636_0127131 Ga0495636_0127131_395_973 187
165 3300047320 Ga0495672_0122360 Ga0495672_0122360_266_844 187
166 3300047322 Ga0495680_0011678 Ga0495680_0011678_970_1548 187
167 3300047323 Ga0495683_0028068 Ga0495683_0028068_224_796 187
168 3300047323 Ga0495683_0175401 Ga0495683_0175401_315_893 187
169 3300047443 Ga0495687_002705 Ga0495687_002705_3695_4273 187
170 3300047444 Ga0495675_0024518 Ga0495675_0024518_1275_1853 187
171 3300047470 Ga0495681_0015665 Ga0495681_0015665_921_1493 187
172 3300047673 Ga0495593_0002952 Ga0495593_0002952_9404_9982 187
173 3300048088 Ga0495602_0096813 Ga0495602_0096813_1300_1872 187
174 3300048089 Ga0495614_0005712 Ga0495614_0005712_4503_5081 187
175 3300048091 Ga0495626_0036804 Ga0495626_0036804_922_1500 187
176 3300048091 Ga0495626_0056762 Ga0495626_0056762_573_1145 187
177 3300048903 Ga0496100_0021811 Ga0496100_0021811_2951_3529 187
178 3300048904 Ga0496101_0029250 Ga0496101_0029250_2723_3301 187
179 3300048927 Ga0496124_0123556 Ga0496124_0123556_1278_1856 187
180 3300049459 Ga0495678_002103 Ga0495678_002103_4090_4662 187
181 3300049459 Ga0495678_002762 Ga0495678_002762_9464_10036 187
182 3300049460 Ga0495682_0003783 Ga0495682_0003783_3880_4452 187
183 3300049569 Ga0501032_0101876 Ga0501032_0101876_264_830 187
184 3300049570 Ga0501033_0140968 Ga0501033_0140968_692_1258 187
185 3300049571 Ga0501034_0646675 Ga0501034_0646675_383_949 187
186 3300049579 Ga0501043_0032490 Ga0501043_0032490_789_1355 187
187 3300049589 Ga0501073_0355538 Ga0501073_0355538_175_741 187
188 3300049742 Ga0501080_0289822 Ga0501080_0289822_64_630 187
189 3300049822 Ga0501035_0329865 Ga0501035_0329865_688_1254 187
190 3300054114 Ga0501084_0366044 Ga0501084_0366044_385_951 187
191 3300003163 Ga0006759J45824_1023430 Ga0006759J45824_10234301 188
192 3300003305 Ga0006770J48903_1023836 Ga0006770J48903_10238361 188
193 3300003544 Ga0007417J51691_1017275 Ga0007417J51691_10172752 188
194 3300003574 Ga0007410J51695_1025237 Ga0007410J51695_10252372 188
195 3300003575 Ga0007409J51694_1017164 Ga0007409J51694_10171642 188
196 3300003579 Ga0007429J51699_1065422 Ga0007429J51699_10654222 188
197 3300003693 Ga0032354_1055850 Ga0032354_10558501 188
198 3300004800 Ga0058861_10031194 Ga0058861_100311941 188
199 3300005328 Ga0070676_10101962 Ga0070676_101019622 188
200 3300005330 Ga0070690_100005749 Ga0070690_1000057497 188
201 3300005331 Ga0070670_100322927 Ga0070670_1003229272 188
202 3300005331 Ga0070670_100650431 Ga0070670_1006504312 188
203 3300005333 Ga0070677_10041315 Ga0070677_100413152 188
204 3300005333 Ga0070677_10043910 Ga0070677_100439102 188
205 3300005334 Ga0068869_100058999 Ga0068869_1000589991 188
206 3300005334 Ga0068869_100235870 Ga0068869_1002358701 188
207 3300005334 Ga0068869_100299598 Ga0068869_1002995982 188
208 3300005337 Ga0070682_100021003 Ga0070682_1000210035 188
209 3300005337 Ga0070682_100894514 Ga0070682_1008945141 188
210 3300005338 Ga0068868_100039029 Ga0068868_1000390292 188
211 3300005338 Ga0068868_100270052 Ga0068868_1002700522 188
212 3300005340 Ga0070689_100001150 Ga0070689_10000115012 188
213 3300005340 Ga0070689_100760515 Ga0070689_1007605151 188
214 3300005343 Ga0070687_100033649 Ga0070687_1000336494 188
215 3300005343 Ga0070687_100142902 Ga0070687_1001429022 188
216 3300005347 Ga0070668_100165386 Ga0070668_1001653862 188
217 3300005353 Ga0070669_100011396 Ga0070669_1000113962 188
218 3300005353 Ga0070669_100682012 Ga0070669_1006820122 188
219 3300005354 Ga0070675_100066564 Ga0070675_1000665642 188
220 3300005354 Ga0070675_100094539 Ga0070675_1000945394 188
221 3300005354 Ga0070675_100135769 Ga0070675_1001357693 188
222 3300005355 Ga0070671_100285699 Ga0070671_1002856992 188
223 3300005356 Ga0070674_100011465 Ga0070674_1000114653 188
224 3300005356 Ga0070674_100106209 Ga0070674_1001062092 188
225 3300005356 Ga0070674_100516984 Ga0070674_1005169842 188
226 3300005364 Ga0070673_100011520 Ga0070673_1000115202 188
227 3300005364 Ga0070673_100030355 Ga0070673_1000303553 188
228 3300005366 Ga0070659_100300975 Ga0070659_1003009751 188
229 3300005366 Ga0070659_100402544 Ga0070659_1004025442 188
230 3300005434 Ga0070709_10002670 Ga0070709_100026703 188
231 3300005435 Ga0070714_100030639 Ga0070714_1000306392 188
232 3300005436 Ga0070713_100049060 Ga0070713_1000490602 188
233 3300005437 Ga0070710_10058601 Ga0070710_100586013 188
234 3300005438 Ga0070701_10068760 Ga0070701_100687602 188
235 3300005438 Ga0070701_10329259 Ga0070701_103292592 188
236 3300005440 Ga0070705_100003706 Ga0070705_1000037068 188
237 3300005440 Ga0070705_100179304 Ga0070705_1001793041 188
238 3300005441 Ga0070700_100036312 Ga0070700_1000363124 188
239 3300005441 Ga0070700_100197281 Ga0070700_1001972812 188
240 3300005441 Ga0070700_100339581 Ga0070700_1003395812 188
241 3300005444 Ga0070694_100004882 Ga0070694_1000048825 188
242 3300005455 Ga0070663_100073219 Ga0070663_1000732192 188
243 3300005456 Ga0070678_100029248 Ga0070678_1000292484 188
244 3300005456 Ga0070678_100126444 Ga0070678_1001264442 188
245 3300005456 Ga0070678_100417633 Ga0070678_1004176332 188
246 3300005457 Ga0070662_100059233 Ga0070662_1000592332 188
247 3300005518 Ga0070699_100064925 Ga0070699_1000649252 188
248 3300005518 Ga0070699_100388509 Ga0070699_1003885092 188
249 3300005536 Ga0070697_100217816 Ga0070697_1002178164 188
250 3300005539 Ga0068853_100055406 Ga0068853_1000554062 188
251 3300005543 Ga0070672_100013413 Ga0070672_1000134132 188
252 3300005543 Ga0070672_100072842 Ga0070672_1000728421 188
253 3300005543 Ga0070672_100207441 Ga0070672_1002074412 188
254 3300005544 Ga0070686_100162243 Ga0070686_1001622432 188
255 3300005544 Ga0070686_100394737 Ga0070686_1003947372 188
256 3300005544 Ga0070686_100547519 Ga0070686_1005475192 188
257 3300005545 Ga0070695_100013674 Ga0070695_1000136743 188
258 3300005547 Ga0070693_100157995 Ga0070693_1001579952 188
259 3300005547 Ga0070693_100729260 Ga0070693_1007292601 188
260 3300005548 Ga0070665_100152388 Ga0070665_1001523883 188
261 3300005548 Ga0070665_100274245 Ga0070665_1002742452 188
262 3300005548 Ga0070665_100624465 Ga0070665_1006244652 188
263 3300005548 Ga0070665_100628579 Ga0070665_1006285792 188
264 3300005548 Ga0070665_100651833 Ga0070665_1006518332 188
265 3300005548 Ga0070665_100690568 Ga0070665_1006905682 188
266 3300005549 Ga0070704_100088418 Ga0070704_1000884182 188
267 3300005563 Ga0068855_100083690 Ga0068855_1000836904 188
268 3300005564 Ga0070664_100877307 Ga0070664_1008773072 188
269 3300005577 Ga0068857_100765851 Ga0068857_1007658512 188
270 3300005614 Ga0068856_100147817 Ga0068856_1001478172 188
271 3300005615 Ga0070702_100222647 Ga0070702_1002226471 188
272 3300005616 Ga0068852_100639319 Ga0068852_1006393192 188
273 3300005617 Ga0068859_100147415 Ga0068859_1001474153 188
274 3300005618 Ga0068864_100142183 Ga0068864_1001421832 188
275 3300005618 Ga0068864_100317351 Ga0068864_1003173512 188
276 3300005618 Ga0068864_100524187 Ga0068864_1005241872 188
277 3300005719 Ga0068861_100000527 Ga0068861_1000005272 188
278 3300005719 Ga0068861_100017283 Ga0068861_1000172834 188
279 3300005719 Ga0068861_100084824 Ga0068861_1000848242 188
280 3300005719 Ga0068861_100834839 Ga0068861_1008348392 188
281 3300005840 Ga0068870_10012979 Ga0068870_100129795 188
282 3300005841 Ga0068863_100069157 Ga0068863_1000691572 188
283 3300005841 Ga0068863_100175955 Ga0068863_1001759552 188
284 3300005841 Ga0068863_100360842 Ga0068863_1003608421 188
285 3300005842 Ga0068858_100085742 Ga0068858_1000857424 188
286 3300005842 Ga0068858_100222297 Ga0068858_1002222972 188
287 3300005844 Ga0068862_100046446 Ga0068862_1000464464 188
288 3300005844 Ga0068862_100576257 Ga0068862_1005762571 188
289 3300005844 Ga0068862_100938236 Ga0068862_1009382361 188
290 3300005937 Ga0081455_10001291 Ga0081455_100012916 188
291 3300006038 Ga0075365_10293234 Ga0075365_102932342 188
292 3300006042 Ga0075368_10147300 Ga0075368_101473001 188
293 3300006048 Ga0075363_100017074 Ga0075363_1000170742 188
294 3300006051 Ga0075364_10052860 Ga0075364_100528602 188
295 3300006051 Ga0075364_10589089 Ga0075364_105890891 188
296 3300006173 Ga0070716_100308907 Ga0070716_1003089072 188
297 3300006186 Ga0075369_10062059 Ga0075369_100620592 188
298 3300006353 Ga0075370_10048405 Ga0075370_100484052 188
299 3300006358 Ga0068871_100054828 Ga0068871_1000548282 188
300 3300006358 Ga0068871_100418255 Ga0068871_1004182551 188
301 3300006871 Ga0075434_100014712 Ga0075434_1000147126 188
302 3300006871 Ga0075434_100097147 Ga0075434_1000971472 188
303 3300006881 Ga0068865_100018617 Ga0068865_1000186172 188
304 3300006881 Ga0068865_100112928 Ga0068865_1001129283 188
305 3300006881 Ga0068865_100577737 Ga0068865_1005777372 188
306 3300006931 Ga0097620_100147400 Ga0097620_1001474003 188
307 3300007076 Ga0075435_100139090 Ga0075435_1001390903 188
308 3300007076 Ga0075435_100467920 Ga0075435_1004679202 188
309 3300007265 Ga0099794_10254534 Ga0099794_102545342 188
310 3300009094 Ga0111539_10221694 Ga0111539_102216942 188
311 3300009148 Ga0105243_10797672 Ga0105243_107976722 188
312 3300009174 Ga0105241_10028543 Ga0105241_100285432 188
313 3300009176 Ga0105242_10241016 Ga0105242_102410162 188
314 3300009177 Ga0105248_10187587 Ga0105248_101875872 188
315 3300009177 Ga0105248_10383029 Ga0105248_103830292 188
316 3300009177 Ga0105248_11017033 Ga0105248_110170332 188
317 3300009545 Ga0105237_10388731 Ga0105237_103887312 188
318 3300009551 Ga0105238_10078735 Ga0105238_100787352 188
319 3300009551 Ga0105238_10586568 Ga0105238_105865682 188
320 3300009553 Ga0105249_10628574 Ga0105249_106285741 188
321 3300010375 Ga0105239_10032029 Ga0105239_100320295 188
322 3300010375 Ga0105239_10041589 Ga0105239_100415894 188
323 3300010375 Ga0105239_10056868 Ga0105239_100568685 188
324 3300010375 Ga0105239_10439379 Ga0105239_104393792 188
325 3300011119 Ga0105246_10087483 Ga0105246_100874832 188
326 3300011119 Ga0105246_10199204 Ga0105246_101992042 188
327 3300013104 Ga0157370_10355250 Ga0157370_103552502 188
328 3300013296 Ga0157374_10013357 Ga0157374_100133577 188
329 3300013296 Ga0157374_10101374 Ga0157374_101013742 188
330 3300013297 Ga0157378_10096348 Ga0157378_100963482 188
331 3300013306 Ga0163162_11277380 Ga0163162_112773802 188
332 3300013306 Ga0163162_11530602 Ga0163162_115306022 188
333 3300013308 Ga0157375_10663982 Ga0157375_106639822 188
334 3300014325 Ga0163163_10191352 Ga0163163_101913522 188
335 3300014325 Ga0163163_11282143 Ga0163163_112821431 188
336 3300014326 Ga0157380_10093387 Ga0157380_100933872 188
337 3300014326 Ga0157380_10525822 Ga0157380_105258222 188
338 3300014326 Ga0157380_10745759 Ga0157380_107457592 188
339 3300014326 Ga0157380_11408754 Ga0157380_114087541 188
340 3300014326 Ga0157380_11759819 Ga0157380_117598191 188
341 3300014968 Ga0157379_10431027 Ga0157379_104310272 188
342 3300014969 Ga0157376_10182387 Ga0157376_101823872 188
343 3300017792 Ga0163161_10317464 Ga0163161_103174642 188
344 3300021441 Ga0213871_10015537 Ga0213871_100155372 188
345 3300025321 Ga0207656_10198824 Ga0207656_101988241 188
346 3300025893 Ga0207682_10006385 Ga0207682_100063856 188
347 3300025893 Ga0207682_10066823 Ga0207682_100668232 188
348 3300025893 Ga0207682_10081010 Ga0207682_100810102 188
349 3300025899 Ga0207642_10314584 Ga0207642_103145842 188
350 3300025906 Ga0207699_10002666 Ga0207699_100026662 188
351 3300025907 Ga0207645_10035317 Ga0207645_100353172 188
352 3300025908 Ga0207643_10041620 Ga0207643_100416204 188
353 3300025909 Ga0207705_10616183 Ga0207705_106161832 188
354 3300025911 Ga0207654_10016729 Ga0207654_100167291 188
355 3300025918 Ga0207662_10266191 Ga0207662_102661912 188
356 3300025918 Ga0207662_10268340 Ga0207662_102683401 188
357 3300025918 Ga0207662_10318493 Ga0207662_103184932 188
358 3300025920 Ga0207649_10130870 Ga0207649_101308701 188
359 3300025920 Ga0207649_10722262 Ga0207649_107222622 188
360 3300025921 Ga0207652_10530857 Ga0207652_105308571 188
361 3300025925 Ga0207650_10420601 Ga0207650_104206011 188
362 3300025926 Ga0207659_10031789 Ga0207659_100317894 188
363 3300025926 Ga0207659_10180346 Ga0207659_101803462 188
364 3300025926 Ga0207659_10310832 Ga0207659_103108322 188
365 3300025927 Ga0207687_10456219 Ga0207687_104562191 188
366 3300025928 Ga0207700_10067759 Ga0207700_100677593 188
367 3300025929 Ga0207664_10173951 Ga0207664_101739512 188
368 3300025931 Ga0207644_10063995 Ga0207644_100639952 188
369 3300025933 Ga0207706_10158590 Ga0207706_101585902 188
370 3300025933 Ga0207706_10227494 Ga0207706_102274942 188
371 3300025934 Ga0207686_10119918 Ga0207686_101199181 188
372 3300025936 Ga0207670_10003275 Ga0207670_100032756 188
373 3300025937 Ga0207669_10053305 Ga0207669_100533054 188
374 3300025937 Ga0207669_10437815 Ga0207669_104378152 188
375 3300025938 Ga0207704_10214552 Ga0207704_102145521 188
376 3300025938 Ga0207704_10417891 Ga0207704_104178912 188
377 3300025940 Ga0207691_10010191 Ga0207691_100101915 188
378 3300025940 Ga0207691_10014947 Ga0207691_100149472 188
379 3300025940 Ga0207691_10555885 Ga0207691_105558852 188
380 3300025941 Ga0207711_10265787 Ga0207711_102657872 188
381 3300025942 Ga0207689_10019230 Ga0207689_100192307 188
382 3300025942 Ga0207689_10096166 Ga0207689_100961662 188
383 3300025942 Ga0207689_10339297 Ga0207689_103392971 188
384 3300025944 Ga0207661_10918948 Ga0207661_109189482 188
385 3300025945 Ga0207679_10294050 Ga0207679_102940502 188
386 3300025945 Ga0207679_10640738 Ga0207679_106407382 188
387 3300025949 Ga0207667_10233982 Ga0207667_102339822 188
388 3300025960 Ga0207651_10022430 Ga0207651_100224305 188
389 3300025960 Ga0207651_10055919 Ga0207651_100559192 188
390 3300025960 Ga0207651_10146487 Ga0207651_101464872 188
391 3300025960 Ga0207651_10994862 Ga0207651_109948622 188
392 3300025961 Ga0207712_10644550 Ga0207712_106445502 188
393 3300025972 Ga0207668_10345691 Ga0207668_103456912 188
394 3300025972 Ga0207668_10876441 Ga0207668_108764411 188
395 3300025986 Ga0207658_10511348 Ga0207658_105113481 188
396 3300026035 Ga0207703_10092301 Ga0207703_100923013 188
397 3300026041 Ga0207639_10036977 Ga0207639_100369773 188
398 3300026067 Ga0207678_10214526 Ga0207678_102145262 188
399 3300026075 Ga0207708_10046326 Ga0207708_100463262 188
400 3300026075 Ga0207708_10100374 Ga0207708_101003742 188
401 3300026075 Ga0207708_10113715 Ga0207708_101137151 188
402 3300026075 Ga0207708_10172039 Ga0207708_101720392 188
403 3300026075 Ga0207708_10328989 Ga0207708_103289892 188
404 3300026078 Ga0207702_10756573 Ga0207702_107565731 188
405 3300026088 Ga0207641_10131892 Ga0207641_101318922 188
406 3300026088 Ga0207641_10132681 Ga0207641_101326813 188
407 3300026088 Ga0207641_10264911 Ga0207641_102649113 188
408 3300026088 Ga0207641_10965269 Ga0207641_109652692 188
409 3300026089 Ga0207648_10074116 Ga0207648_100741164 188
410 3300026089 Ga0207648_10093102 Ga0207648_100931022 188
411 3300026095 Ga0207676_10069809 Ga0207676_100698094 188
412 3300026095 Ga0207676_10248613 Ga0207676_102486132 188
413 3300026095 Ga0207676_10579574 Ga0207676_105795742 188
414 3300026116 Ga0207674_10035147 Ga0207674_100351474 188
415 3300026116 Ga0207674_10364702 Ga0207674_103647022 188
416 3300026118 Ga0207675_100001153 Ga0207675_10000115324 188
417 3300026118 Ga0207675_100001636 Ga0207675_10000163621 188
418 3300026118 Ga0207675_100081273 Ga0207675_1000812733 188
419 3300026118 Ga0207675_100094886 Ga0207675_1000948864 188
420 3300026118 Ga0207675_100100260 Ga0207675_1001002604 188
421 3300026118 Ga0207675_101100700 Ga0207675_1011007002 188
422 3300026121 Ga0207683_10006481 Ga0207683_1000648110 188
423 3300026121 Ga0207683_10043558 Ga0207683_100435582 188
424 3300026121 Ga0207683_10098919 Ga0207683_100989192 188
425 3300026142 Ga0207698_10360546 Ga0207698_103605462 188
426 3300026142 Ga0207698_11669668 Ga0207698_116696681 188
427 3300028379 Ga0268266_10233873 Ga0268266_102338732 188
428 3300028379 Ga0268266_10352325 Ga0268266_103523251 188
429 3300028379 Ga0268266_10473967 Ga0268266_104739672 188
430 3300028379 Ga0268266_10606456 Ga0268266_106064562 188
431 3300028379 Ga0268266_10913186 Ga0268266_109131862 188
432 3300028380 Ga0268265_10020656 Ga0268265_100206564 188
433 3300028380 Ga0268265_10196756 Ga0268265_101967563 188
434 3300028381 Ga0268264_10543158 Ga0268264_105431582 188
435 3300028381 Ga0268264_11088929 Ga0268264_110889292 188
436 3300028786 Ga0307517_10207464 Ga0307517_102074642 188
437 3300028794 Ga0307515_10223256 Ga0307515_102232562 188
438 3300029277 Ga0311001_1004563 Ga0311001_10045632 188
439 3300030521 Ga0307511_10113779 Ga0307511_101137792 188
440 3300031238 Ga0265332_10215282 Ga0265332_102152821 188
441 3300031251 Ga0265327_10001037 Ga0265327_1000103727 188
442 3300031456 Ga0307513_10039521 Ga0307513_100395214 188
443 3300031456 Ga0307513_10075527 Ga0307513_100755272 188
444 3300031456 Ga0307513_10338051 Ga0307513_103380512 188
445 3300031507 Ga0307509_10116301 Ga0307509_101163012 188
446 3300031507 Ga0307509_10130983 Ga0307509_101309833 188
447 3300031731 Ga0307405_10087546 Ga0307405_100875462 188
448 3300031824 Ga0307413_10005441 Ga0307413_100054412 188
449 3300031824 Ga0307413_10218052 Ga0307413_102180522 188
450 3300031824 Ga0307413_10293800 Ga0307413_102938002 188
451 3300031901 Ga0307406_10008182 Ga0307406_100081825 188
452 3300031911 Ga0307412_10157107 Ga0307412_101571071 188
453 3300031995 Ga0307409_100678700 Ga0307409_1006787002 188
454 3300032002 Ga0307416_100109787 Ga0307416_1001097873 188
455 3300032002 Ga0307416_100181734 Ga0307416_1001817342 188
456 3300032002 Ga0307416_100559337 Ga0307416_1005593372 188
457 3300032004 Ga0307414_10531830 Ga0307414_105318301 188
458 3300032005 Ga0307411_10018164 Ga0307411_100181642 188
459 3300032005 Ga0307411_11234147 Ga0307411_112341471 188
460 3300032126 Ga0307415_100290464 Ga0307415_1002904642 188
461 3300033180 Ga0307510_10003003 Ga0307510_1000300316 188
462 3300035692 Ga0373935_0441763 Ga0373935_0441763_112_687 188
463 3300037312 Ga0395899_0280457 Ga0395899_0280457_351_938 188
464 3300037418 Ga0395900_0325871 Ga0395900_0325871_316_903 188
465 3300037471 Ga0395905_0130046 Ga0395905_0130046_1216_1803 188
466 3300039438 Ga0436360_0615805 Ga0436360_0615805_2683_3261 188
467 3300041451 Ga0451791_1831530 Ga0451791_1831530_176_751 188
468 3300041453 Ga0451797_1132125 Ga0451797_1132125_199_774 188
469 3300041458 Ga0451798_0828765 Ga0451798_0828765_114_689 188
470 3300041486 Ga0451807_2251806 Ga0451807_2251806_481_1056 188
471 3300041494 Ga0451837_0227098 Ga0451837_0227098_869_1444 188
472 3300041509 Ga0451843_1622578 Ga0451843_1622578_696_1271 188
473 3300044694 Ga0466963_0194352 Ga0466963_0194352_127_696 188
474 3300044901 Ga0466960_0439956 Ga0466960_0439956_26_601 188
475 3300045976 Ga0466967_0369288 Ga0466967_0369288_105_674 188
476 3300046452 Ga0495617_070387 Ga0495617_070387_223_789 188
477 3300046452 Ga0495617_114977 Ga0495617_114977_121_687 188
478 3300046454 Ga0495592_0005300 Ga0495592_0005300_6586_7161 188
479 3300046455 Ga0495603_0005505 Ga0495603_0005505_2855_3421 188
480 3300046457 Ga0495590_0001203 Ga0495590_0001203_147_722 188
481 3300046457 Ga0495590_0023603 Ga0495590_0023603_338_904 188
482 3300046459 Ga0495629_0107491 Ga0495629_0107491_1215_1781 188
483 3300046459 Ga0495629_0121386 Ga0495629_0121386_1219_1797 188
484 3300046460 Ga0495638_0010135 Ga0495638_0010135_5201_5782 188
485 3300046460 Ga0495638_0028677 Ga0495638_0028677_1868_2443 188
486 3300046460 Ga0495638_0069253 Ga0495638_0069253_1259_1825 188
487 3300046460 Ga0495638_0157903 Ga0495638_0157903_233_799 188
488 3300046462 Ga0495651_0344659 Ga0495651_0344659_244_819 188
489 3300046463 Ga0495653_0400871 Ga0495653_0400871_25_600 188
490 3300046463 Ga0495653_0520025 Ga0495653_0520025_109_684 188
491 3300046473 Ga0495582_0143309 Ga0495582_0143309_741_1307 188
492 3300046491 Ga0495584_0133606 Ga0495584_0133606_286_861 188
493 3300046492 Ga0495585_0043218 Ga0495585_0043218_270_836 188
494 3300046499 Ga0495594_0086290 Ga0495594_0086290_719_1285 188
495 3300046506 Ga0495583_0102792 Ga0495583_0102792_323_889 188
496 3300046507 Ga0495606_0186421 Ga0495606_0186421_151_717 188
497 3300046513 Ga0495616_0024626 Ga0495616_0024626_1193_1768 188
498 3300046515 Ga0495620_0066811 Ga0495620_0066811_671_1252 188
499 3300046516 Ga0495628_0005560 Ga0495628_0005560_6438_7013 188
500 3300046519 Ga0495632_0129966 Ga0495632_0129966_363_929 188
501 3300046524 Ga0495648_0010475 Ga0495648_0010475_1293_1862 188
502 3300046524 Ga0495648_0089586 Ga0495648_0089586_294_860 188
503 3300046528 Ga0495642_0062421 Ga0495642_0062421_408_998 188
504 3300046529 Ga0495652_0058905 Ga0495652_0058905_2549_3124 188
505 3300046535 Ga0495586_0057855 Ga0495586_0057855_1427_2002 188
506 3300046537 Ga0495598_0046836 Ga0495598_0046836_628_1194 188
507 3300046538 Ga0495609_0114646 Ga0495609_0114646_74_640 188
508 3300046539 Ga0495621_0145442 Ga0495621_0145442_256_837 188
509 3300046542 Ga0495597_0248746 Ga0495597_0248746_60_626 188
510 3300046543 Ga0495645_0363989 Ga0495645_0363989_144_719 188
511 3300046557 Ga0495622_0052103 Ga0495622_0052103_497_1063 188
512 3300046558 Ga0495633_0166830 Ga0495633_0166830_183_749 188
513 3300046616 Ga0495668_0025683 Ga0495668_0025683_343_909 188
514 3300046616 Ga0495668_0043386 Ga0495668_0043386_1214_1789 188
515 3300046648 Ga0495611_0041632 Ga0495611_0041632_1095_1661 188
516 3300046660 Ga0495625_0009026 Ga0495625_0009026_153_734 188
517 3300046663 Ga0495635_0328218 Ga0495635_0328218_216_782 188
518 3300046665 Ga0495661_0134158 Ga0495661_0134158_274_864 188
519 3300046678 Ga0495599_0075253 Ga0495599_0075253_1402_1977 188
520 3300046683 Ga0495658_0450449 Ga0495658_0450449_168_734 188
521 3300046692 Ga0495671_0133109 Ga0495671_0133109_436_1002 188
522 3300047320 Ga0495672_0000198 Ga0495672_0000198_73538_74131 188
523 3300047320 Ga0495672_0072576 Ga0495672_0072576_1020_1595 188
524 3300047443 Ga0495687_009929 Ga0495687_009929_2514_3092 188
525 3300047469 Ga0495673_0031927 Ga0495673_0031927_892_1458 188
526 3300048091 Ga0495626_0241855 Ga0495626_0241855_62_628 188
527 3300048903 Ga0496100_0146503 Ga0496100_0146503_318_896 188
528 3300048904 Ga0496101_0380670 Ga0496101_0380670_257_835 188
529 3300048905 Ga0496102_0367327 Ga0496102_0367327_75_644 188
530 3300048906 Ga0496103_0101306 Ga0496103_0101306_1113_1688 188
531 3300048906 Ga0496103_0506660 Ga0496103_0506660_171_749 188
532 3300048907 Ga0496104_0001311 Ga0496104_0001311_4329_4904 188
533 3300048907 Ga0496104_0162793 Ga0496104_0162793_1216_1794 188
534 3300048907 Ga0496104_0705073 Ga0496104_0705073_77_646 188
535 3300048908 Ga0496105_0000231 Ga0496105_0000231_15421_15996 188
536 3300048909 Ga0496106_0129368 Ga0496106_0129368_1316_1885 188
537 3300048910 Ga0496107_0128129 Ga0496107_0128129_938_1510 188
538 3300048910 Ga0496107_0182717 Ga0496107_0182717_311_880 188
539 3300048910 Ga0496107_0332730 Ga0496107_0332730_71_649 188
540 3300048910 Ga0496107_0518406 Ga0496107_0518406_163_732 188
541 3300048911 Ga0496108_0177753 Ga0496108_0177753_196_765 188
542 3300048911 Ga0496108_0193352 Ga0496108_0193352_1092_1667 188
543 3300048912 Ga0496109_0024245 Ga0496109_0024245_1950_2528 188
544 3300048912 Ga0496109_0056961 Ga0496109_0056961_840_1409 188
545 3300048913 Ga0496110_0033205 Ga0496110_0033205_3068_3643 188
546 3300048913 Ga0496110_0078155 Ga0496110_0078155_2088_2666 188
547 3300048913 Ga0496110_0094867 Ga0496110_0094867_1183_1761 188
548 3300048914 Ga0496111_0032506 Ga0496111_0032506_2794_3372 188
549 3300048914 Ga0496111_0269657 Ga0496111_0269657_411_980 188
550 3300048914 Ga0496111_0281341 Ga0496111_0281341_621_1196 188
551 3300048915 Ga0496112_0026997 Ga0496112_0026997_1416_1991 188
552 3300048915 Ga0496112_0236304 Ga0496112_0236304_573_1142 188
553 3300048915 Ga0496112_0666718 Ga0496112_0666718_273_869 188
554 3300048916 Ga0496113_0051563 Ga0496113_0051563_1889_2485 188
555 3300048916 Ga0496113_0086445 Ga0496113_0086445_811_1380 188
556 3300048917 Ga0496114_0170041 Ga0496114_0170041_329_907 188
557 3300048918 Ga0496115_0000077 Ga0496115_0000077_2763_3338 188
558 3300048918 Ga0496115_0021945 Ga0496115_0021945_64_639 188
559 3300048918 Ga0496115_0029788 Ga0496115_0029788_2933_3505 188
560 3300048919 Ga0496116_0180337 Ga0496116_0180337_216_782 188
561 3300048920 Ga0496117_0065160 Ga0496117_0065160_355_930 188
562 3300048921 Ga0496118_0064618 Ga0496118_0064618_1312_1887 188
563 3300048922 Ga0496119_0007747 Ga0496119_0007747_410_1084 188
564 3300048925 Ga0496122_0009572 Ga0496122_0009572_356_952 188
565 3300048926 Ga0496123_0003835 Ga0496123_0003835_6312_6908 188
566 3300048927 Ga0496124_0520289 Ga0496124_0520289_181_747 188
567 3300048928 Ga0496125_0008961 Ga0496125_0008961_9581_10177 188
568 3300048928 Ga0496125_0113643 Ga0496125_0113643_298_873 188
569 3300048928 Ga0496125_0201030 Ga0496125_0201030_679_1248 188
570 3300048929 Ga0496126_0000047 Ga0496126_0000047_291244_291819 188
571 3300049460 Ga0495682_0047474 Ga0495682_0047474_235_801 188
572 3300049460 Ga0495682_0050840 Ga0495682_0050840_880_1446 188
573 3300049570 Ga0501033_0780855 Ga0501033_0780855_32_607 188
574 3300049571 Ga0501034_0597849 Ga0501034_0597849_168_764 188
575 3300049583 Ga0501067_0457279 Ga0501067_0457279_102_677 188
576 3300049584 Ga0501068_0170991 Ga0501068_0170991_180_755 188
577 3300049587 Ga0501071_0020230 Ga0501071_0020230_3497_4072 188
578 3300049588 Ga0501072_0549087 Ga0501072_0549087_133_708 188
579 3300049589 Ga0501073_0010684 Ga0501073_0010684_5557_6132 188
580 3300049592 Ga0501076_0119653 Ga0501076_0119653_208_783 188
581 3300049592 Ga0501076_0379484 Ga0501076_0379484_71_646 188
582 3300049593 Ga0501077_0081002 Ga0501077_0081002_251_826 188
583 3300049741 Ga0501079_0035049 Ga0501079_0035049_808_1383 188
584 3300049742 Ga0501080_0004373 Ga0501080_0004373_2899_3474 188
585 3300049742 Ga0501080_0463337 Ga0501080_0463337_313_888 188
586 3300050489 nmdc:mga03683_211327_c1 nmdc:mga03683_211327_c1_46_615 188
587 3300050491 nmdc:mga00v17_112371_c1 nmdc:mga00v17_112371_c1_558_1127 188
588 3300050494 nmdc:mga06z11_72338_c1 nmdc:mga06z11_72338_c1_1174_1743 188
589 3300050495 nmdc:mga04h51_95348_c1 nmdc:mga04h51_95348_c1_355_924 188
590 3300050511 nmdc:mga08y16_65452_c1 nmdc:mga08y16_65452_c1_2707_3330 188
591 3300050512 nmdc:mga0n895_1048_c1 nmdc:mga0n895_1048_c1_8130_8753 188
592 3300050512 nmdc:mga0n895_80031_c1 nmdc:mga0n895_80031_c1_1746_2321 188
593 3300050513 nmdc:mga0rr50_124533_c1 nmdc:mga0rr50_124533_c1_62_637 188
594 3300050513 nmdc:mga0rr50_231_c1 nmdc:mga0rr50_231_c1_1327_1950 188
595 3300050514 nmdc:mga08x19_12588_c1 nmdc:mga08x19_12588_c1_2430_3053 188
596 3300050515 nmdc:mga0a205_1314_c1 nmdc:mga0a205_1314_c1_20080_20703 188
597 3300050515 nmdc:mga0a205_14878_c1 nmdc:mga0a205_14878_c1_950_1525 188
598 3300050515 nmdc:mga0a205_616697_c1 nmdc:mga0a205_616697_c1_48_623 188
599 3300050516 nmdc:mga0sz30_73293_c1 nmdc:mga0sz30_73293_c1_523_1092 188
600 3300053086 Ga0500578_0174604 Ga0500578_0174604_362_928 188
601 3300053088 Ga0500644_0095452 Ga0500644_0095452_107_673 188
602 3300053088 Ga0500644_0130828 Ga0500644_0130828_27_599 188
603 3300053094 Ga0500566_0356031 Ga0500566_0356031_68_640 188
604 3300053106 Ga0500558_229787 Ga0500558_229787_34_603 188
605 3300053111 Ga0500572_000514 Ga0500572_000514_10847_11419 188
606 3300053114 Ga0500582_055327 Ga0500582_055327_593_1159 188
607 3300053119 Ga0500595_003720 Ga0500595_003720_2787_3356 188
608 3300053130 Ga0500642_0096285 Ga0500642_0096285_527_1093 188
609 3300053134 Ga0500658_0017757 Ga0500658_0017757_1701_2267 188
610 3300053142 Ga0500577_0031216 Ga0500577_0031216_649_1215 188
611 3300053156 Ga0500622_0110518 Ga0500622_0110518_217_783 188
612 3300053161 Ga0500634_0151880 Ga0500634_0151880_67_633 188
613 3300053730 Ga0500645_083578 Ga0500645_083578_120_686 188
614 3300053739 Ga0500587_020594 Ga0500587_020594_216_785 188
615 3300059646 Ga0587078_011609 Ga0587078_011609_90_659 188
616 3300059647 Ga0587079_087795 Ga0587079_087795_55_639 188
617 3300060353 Ga0501082_0103223 Ga0501082_0103223_681_1256 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

79

173

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.983 3 188
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.9675 3 188
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7626 22 168
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7236 24 165
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7059 24 165
ID Description Score Start End Superfamily
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.985 3 188 3.90.1590.10
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.9694 3 188 3.90.1590.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8099 22 140 3.90.1590.10
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.6972 24 166 2.170.150.70
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.685 22 140 3.90.1590.10
ID Description Score Start End GO Terms
AF-D4ZD20-F1-model_v4 Glutathione-dependent formaldehyde-activating enzyme (EC 4.4.1.22) (S-(hydroxymethyl)glutathione synthase) 1.001 25 184 GO:0008270
GO:0046294
GO:0051907
AF-A0A3S3D3N2-F1-model_v4 deleted 0.9995 19 100
AF-A0A556BAF4-F1-model_v4 Glutathione-dependent formaldehyde-activating protein 0.9992 38 130 GO:0016846
GO:0046872
AF-A0A512E1Q9-F1-model_v4 Glutathione-dependent formaldehyde-activating enzyme (EC 4.4.1.22) (S-(hydroxymethyl)glutathione synthase) 0.9988 3 186 GO:0008270
GO:0046294
GO:0051907
AF-A0A4Q0QI08-F1-model_v4 Glutathione-dependent formaldehyde-activating protein 0.9988 79 186 GO:0016846
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.25 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map