F469663

General Info

Members Datasets Scaffolds Average Seq Length
617 298 610 158

Family's Representative Sequence

Representative Sequence 3300046513|Ga0495616_0215052|Ga0495616_0215052_16_603
Length 195
Sequence MDWVSGATAEAVAPRNRMAVAQGGRPGNQGARMSQSKTEEPQASEGSANIDIAEILNRIPHRYPFLLVDRAEAYRAHQSIVGIKCVTINEPFFQGHFPGNPVMPGVLIIEALAQTGAVLMSKSLEVDTDGKTIFFMSVDNARFRNPVRPGDVIRMEVEVVRARSSIFKFKGVAKVGDKVAAEAEFAAMVVETPKA

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2643221583 Caulobacter sp. Root655 Isolate Unclassified
5 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
6 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
7 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
164 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
165 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
166 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
167 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
168 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
174 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
178 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
184 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
190 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
234 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
243 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
244 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
256 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
257 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
258 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
259 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
260 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
261 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
262 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
263 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
264 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
265 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
266 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
267 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
268 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
269 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
270 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
271 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
272 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
273 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
274 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
275 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
276 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
277 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
278 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
279 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
280 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
281 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
282 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
285 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
286 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
287 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
288 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
289 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
290 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
291 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
292 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
293 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
294 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
295 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
296 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
297 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.53
Nodule 0
Rhizoplane 3.73
Rhizosphere 68.56
Stem 0
Stem Tuber 0
Unclassified 5.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10049192 3300003215 Bacteria 1225
2 Ga0055526_1036615 3300003771 Bacteria 1299
3 Ga0055537_1002539 3300003773 Bacteria 6044
4 Ga0055524_1013139 3300003775 Bacteria 3138
5 Ga0055524_1070227 3300003775 Bacteria 678
6 Ga0055536_1004962 3300003781 Bacteria 6625
7 Ga0055528_1036149 3300003790 Bacteria 1185
8 Ga0055530_10000685 3300003791 Bacteria 28722
9 Ga0055530_10005956 3300003791 Bacteria 5611
10 Ga0055530_10020668 3300003791 Bacteria 1960
11 Ga0055540_1008688 3300003792 Bacteria 3622
12 Ga0055531_10001281 3300003794 Bacteria 18942
13 Ga0055531_10002834 3300003794 Bacteria 11348
14 Ga0055531_10005104 3300003794 Bacteria 7758
15 Ga0055531_10019911 3300003794 Bacteria 2685
16 Ga0055531_10075680 3300003794 Bacteria 759
17 Ga0065165_1000552 3300005262 Bacteria 56291
18 Ga0065165_1001772 3300005262 Bacteria 21379
19 Ga0065165_1012666 3300005262 Bacteria 3416
20 Ga0070658_10820665 3300005327 Bacteria 808
21 Ga0070658_10959006 3300005327 Bacteria 744
22 Ga0070670_100000037 3300005331 Bacteria 156070
23 Ga0068869_100022583 3300005334 Bacteria 4337
24 Ga0070666_10049818 3300005335 Bacteria 2816
25 Ga0070666_10450255 3300005335 Bacteria 929
26 Ga0070680_100034575 3300005336 Bacteria 4075
27 Ga0070660_100017823 3300005339 Bacteria 5180
28 Ga0070660_100019403 3300005339 Bacteria 4983
29 Ga0070660_100064682 3300005339 Bacteria 2846
30 Ga0070660_100898354 3300005339 Bacteria 747
31 Ga0070691_10007536 3300005341 Bacteria 4990
32 Ga0070661_100129853 3300005344 Bacteria 1892
33 Ga0070661_100760126 3300005344 Bacteria 793
34 Ga0070668_100000489 3300005347 Bacteria 26287
35 Ga0070668_100000745 3300005347 Bacteria 22317
36 Ga0070668_100003730 3300005347 Bacteria 11234
37 Ga0070668_100009254 3300005347 Bacteria 7305
38 Ga0070668_100032745 3300005347 Bacteria 3955
39 Ga0070669_100056933 3300005353 Bacteria 2867
40 Ga0070671_100009285 3300005355 Bacteria 7899
41 Ga0070671_100028062 3300005355 Bacteria 4635
42 Ga0070671_100779205 3300005355 Bacteria 832
43 Ga0070673_100236321 3300005364 Bacteria 1587
44 Ga0070659_100001077 3300005366 Bacteria 19933
45 Ga0070659_100035777 3300005366 Bacteria 3868
46 Ga0070659_100896069 3300005366 Bacteria 775
47 Ga0070667_100000083 3300005367 Bacteria 118261
48 Ga0070667_100002362 3300005367 Bacteria 16528
49 Ga0070667_100027061 3300005367 Bacteria 4770
50 Ga0070667_100046160 3300005367 Bacteria 3664
51 Ga0070694_100535307 3300005444 Bacteria 936
52 Ga0070663_100303780 3300005455 Bacteria 1278
53 Ga0070662_100125186 3300005457 Bacteria 1975
54 Ga0070681_10014098 3300005458 Bacteria 7955
55 Ga0070681_10072032 3300005458 Bacteria 3419
56 Ga0070681_10112147 3300005458 Bacteria 2666
57 Ga0070685_11312247 3300005466 Bacteria 553
58 Ga0070679_100154113 3300005530 Bacteria 2273
59 Ga0070679_100175111 3300005530 Bacteria 2118
60 Ga0070679_101320624 3300005530 Bacteria 667
61 Ga0068853_100377820 3300005539 Bacteria 1323
62 Ga0068853_100524092 3300005539 Bacteria 1120
63 Ga0068853_100902226 3300005539 Bacteria 849
64 Ga0068853_101562841 3300005539 Bacteria 639
65 Ga0070665_100000116 3300005548 Bacteria 150141
66 Ga0070665_100000483 3300005548 Bacteria 57237
67 Ga0070665_100001929 3300005548 Bacteria 23364
68 Ga0070665_100026394 3300005548 Bacteria 5850
69 Ga0068855_100010398 3300005563 Bacteria 11225
70 Ga0068855_100194919 3300005563 Bacteria 2283
71 Ga0068855_100526393 3300005563 Bacteria 1282
72 Ga0068855_100815869 3300005563 Bacteria 991
73 Ga0068857_101007591 3300005577 Bacteria 802
74 Ga0068857_101229175 3300005577 Bacteria 726
75 Ga0068856_100079161 3300005614 Bacteria 3259
76 Ga0068852_100688351 3300005616 Bacteria 1032
77 Ga0068852_101163455 3300005616 Bacteria 792
78 Ga0068859_100000391 3300005617 Bacteria 43751
79 Ga0068859_100012422 3300005617 Bacteria 8570
80 Ga0068864_100000116 3300005618 Bacteria 79213
81 Ga0068864_100002763 3300005618 Bacteria 14478
82 Ga0068864_100005899 3300005618 Bacteria 10040
83 Ga0068861_100024886 3300005719 Bacteria 4335
84 Ga0068861_100072964 3300005719 Bacteria 2665
85 Ga0068863_100000007 3300005841 Bacteria 257578
86 Ga0068863_100001697 3300005841 Bacteria 21819
87 Ga0068863_100003293 3300005841 Bacteria 15944
88 Ga0068863_100048943 3300005841 Bacteria 4008
89 Ga0068863_100124748 3300005841 Bacteria 2456
90 Ga0068863_100295107 3300005841 Bacteria 1572
91 Ga0068858_100000031 3300005842 Bacteria 143397
92 Ga0068858_100003203 3300005842 Bacteria 16353
93 Ga0068858_100023945 3300005842 Bacteria 5688
94 Ga0068858_100221704 3300005842 Bacteria 1791
95 Ga0068860_100000145 3300005843 Bacteria 115830
96 Ga0068860_100000348 3300005843 Bacteria 62147
97 Ga0068860_100019387 3300005843 Bacteria 6597
98 Ga0068860_100052579 3300005843 Bacteria 3874
99 Ga0068860_100093290 3300005843 Bacteria 2869
100 Ga0068862_100000235 3300005844 Bacteria 61301
101 Ga0068862_100006869 3300005844 Bacteria 9437
102 Ga0068862_100019209 3300005844 Bacteria 5699
103 Ga0068862_100139359 3300005844 Bacteria 2152
104 Ga0068862_100593761 3300005844 Bacteria 1062
105 Ga0070717_10061730 3300006028 Bacteria 3106
106 Ga0075368_10126982 3300006042 Bacteria 1059
107 Ga0075363_100047280 3300006048 Bacteria 2285
108 Ga0075362_10014998 3300006177 Bacteria 3142
109 Ga0075367_10000827 3300006178 Bacteria 12261
110 Ga0075366_10066173 3300006195 Bacteria 2150
111 Ga0075366_10162413 3300006195 Bacteria 1354
112 Ga0075366_10171330 3300006195 Bacteria 1317
113 Ga0097621_100366203 3300006237 Bacteria 1285
114 Ga0075370_10111103 3300006353 Bacteria 1592
115 Ga0075370_10272980 3300006353 Bacteria 1004
116 Ga0068865_100971690 3300006881 Bacteria 742
117 Ga0097620_100000391 3300006931 Bacteria 43751
118 Ga0097620_100012422 3300006931 Bacteria 8570
119 Ga0105250_10016054 3300009092 Bacteria 3056
120 Ga0105240_10013651 3300009093 Bacteria 11140
121 Ga0105240_10018121 3300009093 Bacteria 9467
122 Ga0105240_10048116 3300009093 Bacteria 5391
123 Ga0105240_10176905 3300009093 Bacteria 2522
124 Ga0105240_10181325 3300009093 Bacteria 2485
125 Ga0105240_10424124 3300009093 Bacteria 1494
126 Ga0105240_10586305 3300009093 Bacteria 1229
127 Ga0105245_11657758 3300009098 Bacteria 691
128 Ga0105242_10514307 3300009176 Bacteria 1141
129 Ga0105248_10000438 3300009177 Bacteria 47263
130 Ga0105248_10008920 3300009177 Bacteria 11024
131 Ga0105248_10047938 3300009177 Bacteria 4792
132 Ga0105248_10207564 3300009177 Bacteria 2207
133 Ga0105248_10428707 3300009177 Bacteria 1489
134 Ga0105248_11859839 3300009177 Bacteria 683
135 Ga0105237_10940924 3300009545 Bacteria 871
136 Ga0105238_10054654 3300009551 Bacteria 4009
137 Ga0105238_10079328 3300009551 Bacteria 3273
138 Ga0105238_10127960 3300009551 Bacteria 2518
139 Ga0105238_10270096 3300009551 Bacteria 1681
140 Ga0105249_10003334 3300009553 Bacteria 13911
141 Ga0105249_10138547 3300009553 Bacteria 2331
142 Ga0105239_10192236 3300010375 Bacteria 2284
143 Ga0105239_10262352 3300010375 Bacteria 1942
144 Ga0105239_10394213 3300010375 Bacteria 1566
145 Ga0105239_11736346 3300010375 Bacteria 723
146 Ga0105239_11949111 3300010375 Bacteria 682
147 Ga0105239_12280600 3300010375 Bacteria 630
148 Ga0157325_1001950 3300012485 Bacteria 1004
149 Ga0157373_10001429 3300013100 Bacteria 18213
150 Ga0157373_10004486 3300013100 Bacteria 10506
151 Ga0157370_10115622 3300013104 Bacteria 2506
152 Ga0157369_10123007 3300013105 Bacteria 2752
153 Ga0163162_10680000 3300013306 Bacteria 1152
154 Ga0163162_10839660 3300013306 Bacteria 1034
155 Ga0157372_10067297 3300013307 Bacteria 4025
156 Ga0157372_11992119 3300013307 Bacteria 667
157 Ga0157375_10057082 3300013308 Bacteria 3858
158 Ga0157375_13442027 3300013308 Bacteria 527
159 Ga0163163_10022137 3300014325 Bacteria 6012
160 Ga0163163_10023583 3300014325 Bacteria 5841
161 Ga0163163_10028528 3300014325 Bacteria 5361
162 Ga0163163_10255190 3300014325 Bacteria 1804
163 Ga0163163_10709862 3300014325 Bacteria 1069
164 Ga0163163_10798594 3300014325 Bacteria 1007
165 Ga0163163_10831066 3300014325 Bacteria 987
166 Ga0157380_10133222 3300014326 Bacteria 2123
167 Ga0157377_10338831 3300014745 Bacteria 1005
168 Ga0157379_10003351 3300014968 Bacteria 13575
169 Ga0157379_10003384 3300014968 Bacteria 13491
170 Ga0157379_10009938 3300014968 Bacteria 8286
171 Ga0157379_10437717 3300014968 Bacteria 1205
172 Ga0157376_10815033 3300014969 Bacteria 947
173 Ga0209026_1000864 3300025250 Bacteria 15837
174 Ga0209565_1000332 3300025263 Bacteria 42136
175 Ga0209673_1000523 3300025273 Bacteria 62816
176 Ga0209675_1016141 3300025291 Bacteria 2187
177 Ga0209676_1000327 3300025292 Bacteria 91596
178 Ga0209676_1000409 3300025292 Bacteria 77127
179 Ga0209676_1087652 3300025292 Bacteria 692
180 Ga0209564_1003781 3300025295 Bacteria 9852
181 Ga0209564_1032654 3300025295 Bacteria 1563
182 Ga0209758_1002471 3300025297 Bacteria 18803
183 Ga0209758_1002872 3300025297 Bacteria 16699
184 Ga0209050_1000101 3300025298 Bacteria 230076
185 Ga0209050_1001254 3300025298 Bacteria 29280
186 Ga0209050_1002240 3300025298 Bacteria 17254
187 Ga0209256_1003815 3300025299 Bacteria 10097
188 Ga0209256_1010099 3300025299 Bacteria 4015
189 Ga0209256_1030703 3300025299 Bacteria 1480
190 Ga0209051_1000338 3300025303 Bacteria 70301
191 Ga0209257_1000221 3300025304 Bacteria 134870
192 Ga0209257_1000386 3300025304 Bacteria 88085
193 Ga0209257_1001334 3300025304 Bacteria 29951
194 Ga0209257_1009760 3300025304 Bacteria 5039
195 Ga0209257_1015174 3300025304 Bacteria 3234
196 Ga0207680_10550769 3300025903 Bacteria 823
197 Ga0207705_10001576 3300025909 Bacteria 18123
198 Ga0207705_10054342 3300025909 Bacteria 2886
199 Ga0207705_10057508 3300025909 Bacteria 2805
200 Ga0207705_10518484 3300025909 Bacteria 926
201 Ga0207705_10651536 3300025909 Bacteria 819
202 Ga0207654_10401657 3300025911 Bacteria 953
203 Ga0207707_10018184 3300025912 Bacteria 6126
204 Ga0207707_10038477 3300025912 Bacteria 4179
205 Ga0207695_10001229 3300025913 Bacteria 43850
206 Ga0207695_10007605 3300025913 Bacteria 13731
207 Ga0207695_10094918 3300025913 Bacteria 2988
208 Ga0207695_10095316 3300025913 Bacteria 2980
209 Ga0207695_10451602 3300025913 Bacteria 1168
210 Ga0207695_10686598 3300025913 Bacteria 904
211 Ga0207671_11069794 3300025914 Bacteria 634
212 Ga0207660_10003244 3300025917 Bacteria 10652
213 Ga0207660_10953358 3300025917 Bacteria 700
214 Ga0207657_10024382 3300025919 Bacteria 5604
215 Ga0207657_10028952 3300025919 Bacteria 5046
216 Ga0207657_10103078 3300025919 Bacteria 2365
217 Ga0207657_11171149 3300025919 Bacteria 585
218 Ga0207652_10417649 3300025921 Bacteria 1210
219 Ga0207652_10904957 3300025921 Bacteria 779
220 Ga0207652_11079446 3300025921 Bacteria 703
221 Ga0207681_10319977 3300025923 Bacteria 1233
222 Ga0207694_10043685 3300025924 Bacteria 3459
223 Ga0207694_10070172 3300025924 Bacteria 2737
224 Ga0207694_10103724 3300025924 Bacteria 2255
225 Ga0207694_10185509 3300025924 Bacteria 1688
226 Ga0207694_10282104 3300025924 Bacteria 1365
227 Ga0207650_10000062 3300025925 Bacteria 149776
228 Ga0207650_10039689 3300025925 Bacteria 3440
229 Ga0207650_10133319 3300025925 Bacteria 1946
230 Ga0207650_10159401 3300025925 Bacteria 1787
231 Ga0207650_10395314 3300025925 Bacteria 1143
232 Ga0207650_11292430 3300025925 Bacteria 621
233 Ga0207644_10002801 3300025931 Bacteria 11240
234 Ga0207644_10005572 3300025931 Bacteria 8195
235 Ga0207644_10024374 3300025931 Bacteria 4153
236 Ga0207690_10000129 3300025932 Bacteria 62350
237 Ga0207690_10018962 3300025932 Bacteria 4224
238 Ga0207706_10155536 3300025933 Bacteria 2011
239 Ga0207709_10547950 3300025935 Bacteria 909
240 Ga0207704_10006201 3300025938 Bacteria 5557
241 Ga0207704_10906187 3300025938 Bacteria 742
242 Ga0207704_11093831 3300025938 Bacteria 677
243 Ga0207711_10000962 3300025941 Bacteria 27597
244 Ga0207711_10009637 3300025941 Bacteria 8047
245 Ga0207711_10103528 3300025941 Bacteria 2521
246 Ga0207711_10152261 3300025941 Bacteria 2088
247 Ga0207711_10152804 3300025941 Bacteria 2084
248 Ga0207689_10076301 3300025942 Bacteria 2756
249 Ga0207679_10946062 3300025945 Bacteria 789
250 Ga0207667_10005781 3300025949 Bacteria 15088
251 Ga0207667_10039889 3300025949 Bacteria 5001
252 Ga0207667_10158435 3300025949 Bacteria 2329
253 Ga0207667_10526318 3300025949 Bacteria 1197
254 Ga0207667_10651059 3300025949 Bacteria 1059
255 Ga0207667_11724275 3300025949 Bacteria 592
256 Ga0207651_10127749 3300025960 Bacteria 1940
257 Ga0207712_10038925 3300025961 Bacteria 3254
258 Ga0207712_10583230 3300025961 Bacteria 965
259 Ga0207668_10000028 3300025972 Bacteria 125361
260 Ga0207668_10000130 3300025972 Bacteria 53528
261 Ga0207668_10000879 3300025972 Bacteria 18115
262 Ga0207668_10001036 3300025972 Bacteria 16597
263 Ga0207668_10005134 3300025972 Bacteria 7702
264 Ga0207668_10015874 3300025972 Bacteria 4689
265 Ga0207640_10763102 3300025981 Bacteria 835
266 Ga0207658_10005685 3300025986 Bacteria 8526
267 Ga0207658_10006459 3300025986 Bacteria 8003
268 Ga0207658_10006804 3300025986 Bacteria 7790
269 Ga0207658_10008544 3300025986 Bacteria 6966
270 Ga0207677_10531733 3300026023 Bacteria 1021
271 Ga0207703_10000038 3300026035 Bacteria 175917
272 Ga0207703_10000843 3300026035 Bacteria 30142
273 Ga0207703_10009331 3300026035 Bacteria 7711
274 Ga0207703_10020047 3300026035 Bacteria 5225
275 Ga0207639_10113304 3300026041 Bacteria 2215
276 Ga0207639_10549174 3300026041 Bacteria 1060
277 Ga0207639_10569721 3300026041 Bacteria 1041
278 Ga0207639_11052841 3300026041 Bacteria 762
279 Ga0207678_10070628 3300026067 Bacteria 2994
280 Ga0207702_10428784 3300026078 Bacteria 1280
281 Ga0207641_10000012 3300026088 Bacteria 375486
282 Ga0207641_10020343 3300026088 Bacteria 5450
283 Ga0207641_10028888 3300026088 Bacteria 4583
284 Ga0207641_10074873 3300026088 Bacteria 2922
285 Ga0207641_10143210 3300026088 Bacteria 2159
286 Ga0207641_10192384 3300026088 Bacteria 1876
287 Ga0207676_10000179 3300026095 Bacteria 55697
288 Ga0207676_10000716 3300026095 Bacteria 26001
289 Ga0207676_10002829 3300026095 Bacteria 12349
290 Ga0207676_10200930 3300026095 Bacteria 1761
291 Ga0207676_10469426 3300026095 Bacteria 1190
292 Ga0207674_10153517 3300026116 Bacteria 2259
293 Ga0207674_10943839 3300026116 Bacteria 831
294 Ga0207675_100016217 3300026118 Bacteria 6955
295 Ga0207675_100095867 3300026118 Bacteria 2792
296 Ga0207675_100661465 3300026118 Bacteria 1051
297 Ga0207698_10714161 3300026142 Bacteria 998
298 Ga0207698_10838715 3300026142 Bacteria 923
299 Ga0209981_1000636 3300027378 Bacteria 4418
300 Ga0209999_1004727 3300027543 Bacteria 2447
301 Ga0209983_1005703 3300027665 Bacteria 2568
302 Ga0209813_10061786 3300027866 Bacteria 1197
303 Ga0268266_10000064 3300028379 Bacteria 249533
304 Ga0268266_10000792 3300028379 Bacteria 42146
305 Ga0268266_10038612 3300028379 Bacteria 4065
306 Ga0268266_10062910 3300028379 Bacteria 3203
307 Ga0268266_10285797 3300028379 Bacteria 1535
308 Ga0268266_10529634 3300028379 Bacteria 1127
309 Ga0268265_10001998 3300028380 Bacteria 16117
310 Ga0268265_10002126 3300028380 Bacteria 15366
311 Ga0268265_10029963 3300028380 Bacteria 3915
312 Ga0268265_10703683 3300028380 Bacteria 976
313 Ga0268264_10000046 3300028381 Bacteria 364597
314 Ga0268264_10000059 3300028381 Bacteria 306927
315 Ga0268264_10115851 3300028381 Bacteria 2355
316 Ga0265318_10180781 3300028577 Bacteria 772
317 Ga0307517_10000497 3300028786 Bacteria 67390
318 Ga0307517_10108076 3300028786 Bacteria 2138
319 Ga0307515_10050621 3300028794 Bacteria 6215
320 Ga0265338_10010137 3300028800 Bacteria 11117
321 Ga0307511_10038070 3300030521 Bacteria 4139
322 Ga0265327_10001180 3300031251 Bacteria 35383
323 Ga0265327_10268247 3300031251 Bacteria 757
324 Ga0307513_10000448 3300031456 Bacteria 59427
325 Ga0307513_10002007 3300031456 Bacteria 28699
326 Ga0307513_10004437 3300031456 Bacteria 18736
327 Ga0307513_10005088 3300031456 Bacteria 17402
328 Ga0307513_10901491 3300031456 Bacteria 592
329 Ga0307508_10738071 3300031616 Bacteria 597
330 Ga0265314_10105552 3300031711 Bacteria 1801
331 Ga0307516_10000004 3300031730 Bacteria 367451
332 Ga0307407_10136819 3300031903 Bacteria 1575
333 Ga0307409_100528901 3300031995 Bacteria 1153
334 Ga0307416_101235706 3300032002 Bacteria 853
335 Ga0307414_10132552 3300032004 Bacteria 1937
336 Ga0307411_10105354 3300032005 Bacteria 2005
337 Ga0307411_10180674 3300032005 Bacteria 1601
338 Ga0307510_10011693 3300033180 Bacteria 10421
339 Ga0307510_10084254 3300033180 Bacteria 3063
340 Ga0373943_0375079 3300035170 Bacteria 818
341 Ga0373935_1162688 3300035692 Bacteria 575
342 Ga0373927_0000526 3300035695 Bacteria 29046
343 Ga0373925_0000061 3300037068 Bacteria 117783
344 Ga0395899_0055404 3300037312 Bacteria 2933
345 Ga0395899_0116012 3300037312 Bacteria 1921
346 Ga0395900_0109974 3300037418 Bacteria 2831
347 Ga0395900_0167427 3300037418 Bacteria 2239
348 Ga0395900_0205994 3300037418 Bacteria 1988
349 Ga0395900_0531966 3300037418 Bacteria 1122
350 Ga0395900_0586300 3300037418 Bacteria 1056
351 Ga0395900_0954187 3300037418 Bacteria 779
352 Ga0395898_0016546 3300037466 Bacteria 7542
353 Ga0395898_0126913 3300037466 Bacteria 2444
354 Ga0395898_0174058 3300037466 Bacteria 2057
355 Ga0395898_1663451 3300037466 Bacteria 562
356 Ga0395905_0025239 3300037471 Bacteria 5605
357 Ga0395905_0034223 3300037471 Bacteria 4771
358 Ga0395905_0093793 3300037471 Bacteria 2815
359 Ga0395905_0106788 3300037471 Bacteria 2629
360 Ga0395905_0169966 3300037471 Bacteria 2048
361 Ga0395905_0997886 3300037471 Bacteria 740
362 Ga0395905_1246178 3300037471 Bacteria 647
363 Ga0395901_0046843 3300038443 Bacteria 4492
364 Ga0395901_0064787 3300038443 Bacteria 3804
365 Ga0395901_0105946 3300038443 Bacteria 2951
366 Ga0395901_0826394 3300038443 Bacteria 913
367 Ga0436365_1676837 3300039437 Bacteria 2995
368 Ga0436363_0474361 3300039450 Bacteria 1496
369 Ga0451793_0195077 3300041452 Bacteria 722
370 Ga0451849_0975671 3300041505 Bacteria 572
371 Ga0439441_178905 3300042001 Bacteria 509
372 Ga0450890_010669 3300042127 Bacteria 1183
373 Ga0439435_0028353 3300042436 Bacteria 1504
374 Ga0439459_0039880 3300042438 Bacteria 994
375 Ga0466965_0074640 3300044683 Bacteria 1709
376 Ga0466963_0437910 3300044694 Bacteria 922
377 Ga0466957_0690272 3300044842 Bacteria 720
378 Ga0466957_0884232 3300044842 Bacteria 638
379 Ga0466960_0272354 3300044901 Bacteria 946
380 Ga0495627_000443 3300046453 Bacteria 36101
381 Ga0495590_0001954 3300046457 Bacteria 8715
382 Ga0495629_0018656 3300046459 Bacteria 4959
383 Ga0495638_0000701 3300046460 Bacteria 36250
384 Ga0495638_0001931 3300046460 Bacteria 17833
385 Ga0495638_0002456 3300046460 Bacteria 15116
386 Ga0495638_0002536 3300046460 Bacteria 14843
387 Ga0495638_0015888 3300046460 Bacteria 5044
388 Ga0495638_0119425 3300046460 Bacteria 1559
389 Ga0495650_0000017 3300046471 Bacteria 542552
390 Ga0495607_0036504 3300046501 Bacteria 2960
391 Ga0495583_0000020 3300046506 Bacteria 296185
392 Ga0495606_0007343 3300046507 Bacteria 9898
393 Ga0495606_0012983 3300046507 Bacteria 6626
394 Ga0495610_0000535 3300046512 Bacteria 38235
395 Ga0495610_0006241 3300046512 Bacteria 8263
396 Ga0495610_0023019 3300046512 Bacteria 3394
397 Ga0495616_0000375 3300046513 Bacteria 34773
398 Ga0495616_0189287 3300046513 Bacteria 910
399 Ga0495616_0215052 3300046513 Bacteria 839
400 Ga0495620_0016467 3300046515 Bacteria 3708
401 Ga0495631_0009992 3300046518 Bacteria 4716
402 Ga0495631_0128938 3300046518 Bacteria 1087
403 Ga0495632_0002115 3300046519 Bacteria 15508
404 Ga0495632_0143785 3300046519 Bacteria 1105
405 Ga0495637_0005524 3300046520 Bacteria 6426
406 Ga0495637_0019459 3300046520 Bacteria 3138
407 Ga0495643_0059246 3300046522 Bacteria 2036
408 Ga0495648_0006618 3300046524 Bacteria 9397
409 Ga0495648_0092740 3300046524 Bacteria 1686
410 Ga0495648_0319462 3300046524 Bacteria 720
411 Ga0495648_0386109 3300046524 Bacteria 630
412 Ga0495663_0023177 3300046525 Bacteria 1797
413 Ga0495642_0001981 3300046528 Bacteria 8590
414 Ga0495652_0577262 3300046529 Bacteria 770
415 Ga0495654_0000750 3300046530 Bacteria 25116
416 Ga0495587_0380999 3300046536 Bacteria 785
417 Ga0495597_0001428 3300046542 Bacteria 17175
418 Ga0495597_0042638 3300046542 Bacteria 2023
419 Ga0495645_0024641 3300046543 Bacteria 4366
420 Ga0495668_0000092 3300046616 Bacteria 142835
421 Ga0495668_0003409 3300046616 Bacteria 11939
422 Ga0495668_0038062 3300046616 Bacteria 2689
423 Ga0495668_0041050 3300046616 Bacteria 2579
424 Ga0495668_0122382 3300046616 Bacteria 1423
425 Ga0495625_0000865 3300046660 Bacteria 41188
426 Ga0495625_0004098 3300046660 Bacteria 13905
427 Ga0495625_0006433 3300046660 Bacteria 10457
428 Ga0495625_0016645 3300046660 Bacteria 5777
429 Ga0495625_0020347 3300046660 Bacteria 5126
430 Ga0495625_0025295 3300046660 Bacteria 4503
431 Ga0495625_0031934 3300046660 Bacteria 3911
432 Ga0495625_0064135 3300046660 Bacteria 2592
433 Ga0495625_0096626 3300046660 Bacteria 2035
434 Ga0495625_0133394 3300046660 Bacteria 1681
435 Ga0495625_0163407 3300046660 Bacteria 1490
436 Ga0495659_0184561 3300046664 Bacteria 851
437 Ga0495669_0000003 3300046684 Bacteria 267741
438 Ga0495669_0010381 3300046684 Bacteria 3934
439 Ga0495669_0061444 3300046684 Bacteria 1700
440 Ga0495670_0129809 3300046691 Bacteria 1313
441 Ga0495670_0178051 3300046691 Bacteria 1122
442 Ga0495649_0492864 3300046694 Bacteria 610
443 Ga0495589_0007451 3300046794 Bacteria 5734
444 Ga0495672_0001016 3300047320 Bacteria 28910
445 Ga0495672_0024965 3300047320 Bacteria 3837
446 Ga0495672_0034544 3300047320 Bacteria 3123
447 Ga0495683_0103166 3300047323 Bacteria 1369
448 Ga0495677_0103324 3300047445 Bacteria 1080
449 Ga0495679_016776 3300047446 Bacteria 2640
450 Ga0495673_0000078 3300047469 Bacteria 203066
451 Ga0495673_0000401 3300047469 Bacteria 50743
452 Ga0495673_0004040 3300047469 Bacteria 9351
453 Ga0495681_0037146 3300047470 Bacteria 2403
454 Ga0495686_0000259 3300047472 Bacteria 94672
455 Ga0495686_0022623 3300047472 Bacteria 4159
456 Ga0495686_0104072 3300047472 Bacteria 1709
457 Ga0495686_0400775 3300047472 Bacteria 736
458 Ga0495602_0442144 3300048088 Bacteria 919
459 Ga0495615_0012594 3300048090 Bacteria 1747
460 Ga0496100_0127129 3300048903 Bacteria 1790
461 Ga0496101_0033852 3300048904 Bacteria 3607
462 Ga0496101_0091493 3300048904 Bacteria 2264
463 Ga0496102_0030313 3300048905 Bacteria 4841
464 Ga0496102_0072338 3300048905 Bacteria 3168
465 Ga0496102_0602355 3300048905 Bacteria 1022
466 Ga0496102_0622804 3300048905 Bacteria 1002
467 Ga0496103_0277331 3300048906 Bacteria 1078
468 Ga0496106_0003278 3300048909 Bacteria 12096
469 Ga0496107_0000851 3300048910 Bacteria 17893
470 Ga0496107_0014019 3300048910 Bacteria 5611
471 Ga0496107_0336502 3300048910 Bacteria 1123
472 Ga0496108_0063699 3300048911 Bacteria 3105
473 Ga0496109_0002851 3300048912 Bacteria 14465
474 Ga0496110_0281583 3300048913 Bacteria 1514
475 Ga0496110_0624083 3300048913 Bacteria 977
476 Ga0496112_0339576 3300048915 Bacteria 1445
477 Ga0496112_1083391 3300048915 Bacteria 720
478 Ga0496115_0002173 3300048918 Bacteria 14034
479 Ga0496115_0002548 3300048918 Bacteria 13093
480 Ga0496115_0007602 3300048918 Bacteria 7983
481 Ga0496115_0038843 3300048918 Bacteria 3780
482 Ga0496116_0045237 3300048919 Bacteria 2982
483 Ga0496117_0005253 3300048920 Bacteria 13741
484 Ga0496118_0005535 3300048921 Bacteria 14332
485 Ga0496119_0139078 3300048922 Bacteria 1313
486 Ga0496120_0217912 3300048923 Bacteria 914
487 Ga0496121_0000009 3300048924 Bacteria 836971
488 Ga0496121_0001613 3300048924 Bacteria 37440
489 Ga0496123_0197473 3300048926 Bacteria 1035
490 Ga0496124_0033194 3300048927 Bacteria 4543
491 Ga0496125_0019090 3300048928 Bacteria 6484
492 Ga0496126_0005746 3300048929 Bacteria 14039
493 Ga0496126_0167670 3300048929 Bacteria 1873
494 Ga0495678_001694 3300049459 Bacteria 16655
495 Ga0495682_0191850 3300049460 Bacteria 725
496 Ga0501033_0008404 3300049570 Bacteria 7996
497 Ga0501037_0059766 3300049573 Bacteria 2780
498 Ga0501037_0065489 3300049573 Bacteria 2647
499 Ga0501047_0020196 3300049581 Bacteria 6396
500 Ga0501047_0095613 3300049581 Bacteria 2850
501 Ga0501047_0113667 3300049581 Bacteria 2590
502 Ga0501047_0216722 3300049581 Bacteria 1771
503 Ga0501047_0502390 3300049581 Bacteria 1039
504 Ga0501047_0883778 3300049581 Bacteria 707
505 Ga0501047_1030469 3300049581 Bacteria 636
506 Ga0501067_0021611 3300049583 Bacteria 3561
507 Ga0501072_0055826 3300049588 Bacteria 3112
508 Ga0501073_0007054 3300049589 Bacteria 8370
509 Ga0501074_0379791 3300049590 Bacteria 1002
510 Ga0501238_003056 3300049671 Bacteria 2043
511 Ga0501251_079925 3300049681 Bacteria 572
512 Ga0501257_002177 3300049686 Bacteria 4106
513 Ga0501080_0012907 3300049742 Bacteria 7667
514 Ga0501080_0786091 3300049742 Bacteria 835
515 Ga0501083_0014643 3300049744 Bacteria 5482
516 Ga0501241_026953 3300049758 Bacteria 1074
517 Ga0501035_0262587 3300049822 Bacteria 1463
518 Ga0501044_0000504 3300049823 Bacteria 47543
519 Ga0501044_0010085 3300049823 Bacteria 10265
520 Ga0501044_0383176 3300049823 Bacteria 1321
521 Ga0501044_0565992 3300049823 Bacteria 1032
522 nmdc:mga03683_90583_c1 3300050489 Bacteria 1333
523 nmdc:mga03n38_380141_c1 3300050490 Bacteria 774
524 nmdc:mga03n38_40649_c1 3300050490 Bacteria 2022
525 nmdc:mga0k408_10134_c1 3300050493 Bacteria 5092
526 nmdc:mga0k408_125345_c1 3300050493 Bacteria 1523
527 nmdc:mga04h51_73822_c1 3300050495 Bacteria 1197
528 nmdc:mga07m45_14110_c1 3300050496 Bacteria 4251
529 nmdc:mga07m45_184801_c1 3300050496 Bacteria 1212
530 nmdc:mga07m45_232853_c1 3300050496 Bacteria 1072
531 nmdc:mga07m45_79587_c1 3300050496 Bacteria 1871
532 nmdc:mga0sz30_29728_c1 3300050516 Bacteria 2254
533 Ga0500635_0000228 3300053080 Bacteria 24908
534 Ga0500578_0000420 3300053086 Bacteria 51926
535 Ga0500643_005954 3300053087 Bacteria 5168
536 Ga0500643_011284 3300053087 Bacteria 3267
537 Ga0500643_039219 3300053087 Bacteria 1400
538 Ga0500644_0001153 3300053088 Bacteria 7664
539 Ga0500646_0003762 3300053090 Bacteria 3881
540 Ga0500646_0008178 3300053090 Bacteria 2675
541 Ga0500583_0034722 3300053092 Bacteria 2244
542 Ga0500566_0074713 3300053094 Bacteria 1897
543 Ga0500641_0001139 3300053096 Bacteria 9447
544 Ga0500641_0015768 3300053096 Bacteria 2809
545 Ga0500554_001349 3300053102 Bacteria 4746
546 Ga0500556_0011034 3300053104 Bacteria 2666
547 Ga0500556_0011180 3300053104 Bacteria 2653
548 Ga0500556_0143772 3300053104 Bacteria 938
549 Ga0500556_0174822 3300053104 Bacteria 848
550 Ga0500562_013138 3300053108 Bacteria 2110
551 Ga0500562_025024 3300053108 Bacteria 1561
552 Ga0500569_011335 3300053109 Bacteria 2126
553 Ga0500572_002871 3300053111 Bacteria 4048
554 Ga0500594_0000212 3300053118 Bacteria 14226
555 Ga0500594_0031058 3300053118 Bacteria 1407
556 Ga0500595_002687 3300053119 Bacteria 8632
557 Ga0500595_009124 3300053119 Bacteria 4020
558 Ga0500597_256103 3300053120 Bacteria 714
559 Ga0500608_000059 3300053122 Bacteria 48253
560 Ga0500608_032146 3300053122 Bacteria 2492
561 Ga0500614_003176 3300053123 Bacteria 3565
562 Ga0500614_004047 3300053123 Bacteria 3121
563 Ga0500618_002667 3300053125 Bacteria 6549
564 Ga0500642_0341253 3300053130 Bacteria 667
565 Ga0500658_0004419 3300053134 Bacteria 5262
566 Ga0500658_0072909 3300053134 Bacteria 1453
567 Ga0500559_0000077 3300053136 Bacteria 76287
568 Ga0500559_0000111 3300053136 Bacteria 64064
569 Ga0500559_0020710 3300053136 Bacteria 2782
570 Ga0500559_0021293 3300053136 Bacteria 2747
571 Ga0500559_0021419 3300053136 Bacteria 2739
572 Ga0500564_000021 3300053138 Bacteria 47765
573 Ga0500577_0001426 3300053142 Bacteria 6118
574 Ga0500588_0061576 3300053146 Bacteria 1204
575 Ga0500590_013948 3300053148 Bacteria 4134
576 Ga0500604_0338976 3300053151 Bacteria 522
577 Ga0500616_0015967 3300053153 Bacteria 4284
578 Ga0500616_0018780 3300053153 Bacteria 3905
579 Ga0500616_0020742 3300053153 Bacteria 3690
580 Ga0500616_0047953 3300053153 Bacteria 2266
581 Ga0500616_0051933 3300053153 Bacteria 2158
582 Ga0500622_0000526 3300053156 Bacteria 35500
583 Ga0500622_0008486 3300053156 Bacteria 5743
584 Ga0500622_0014867 3300053156 Bacteria 4173
585 Ga0500622_0023470 3300053156 Bacteria 3267
586 Ga0500622_0058402 3300053156 Bacteria 1971
587 Ga0500627_0022301 3300053158 Bacteria 2566
588 Ga0500638_088613 3300053162 Bacteria 1460
589 Ga0500639_179950 3300053163 Bacteria 936
590 Ga0500636_0028477 3300053177 Bacteria 3299
591 Ga0500636_0116303 3300053177 Bacteria 1505
592 Ga0500636_0199075 3300053177 Bacteria 1061
593 Ga0500637_0023362 3300053178 Bacteria 3380
594 Ga0500637_0068739 3300053178 Bacteria 2035
595 Ga0500576_104458 3300053725 Bacteria 1149
596 Ga0500611_001826 3300053727 Bacteria 2433
597 Ga0500625_093384 3300053729 Bacteria 1281
598 Ga0500645_000649 3300053730 Bacteria 21995
599 Ga0500645_002967 3300053730 Bacteria 7199
600 Ga0500645_003640 3300053730 Bacteria 6166
601 Ga0500645_004869 3300053730 Bacteria 5058
602 Ga0500645_039749 3300053730 Bacteria 1393
603 Ga0500645_039982 3300053730 Bacteria 1389
604 Ga0500645_074393 3300053730 Bacteria 973
605 Ga0500609_000612 3300053731 Bacteria 5437
606 Ga0500552_057734 3300053733 Bacteria 672
607 Ga0500596_000416 3300053735 Bacteria 7824
608 Ga0500661_048586 3300055283 Bacteria 756
609 Ga0500661_070376 3300055283 Bacteria 639
610 Ga0501082_0051849 3300060353 Bacteria 3536

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053096 Ga0500641_0001139 Ga0500641_0001139_8441_8911 151
2 3300053104 Ga0500556_0011034 Ga0500556_0011034_539_1009 151
3 3300053104 Ga0500556_0174822 Ga0500556_0174822_200_670 151
4 3300053153 Ga0500616_0018780 Ga0500616_0018780_2210_2680 151
5 3300053153 Ga0500616_0020742 Ga0500616_0020742_1508_1978 151
6 3300053730 Ga0500645_000649 Ga0500645_000649_9321_9791 151
7 3300053730 Ga0500645_004869 Ga0500645_004869_2993_3463 151
8 3300044842 Ga0466957_0884232 Ga0466957_0884232_87_563 152
9 3300013306 Ga0163162_10680000 Ga0163162_106800002 153
10 3300005444 Ga0070694_100535307 Ga0070694_1005353072 154
11 iso_pu_bacteria 2643221661 2644342535 154
12 iso_pu_bacteria 2643221666 2644365835 154
13 3300005563 Ga0068855_100815869 Ga0068855_1008158692 155
14 3300009176 Ga0105242_10514307 Ga0105242_105143072 155
15 3300013100 Ga0157373_10001429 Ga0157373_1000142916 155
16 3300013307 Ga0157372_11992119 Ga0157372_119921192 155
17 3300014969 Ga0157376_10815033 Ga0157376_108150332 155
18 3300025949 Ga0207667_11724275 Ga0207667_117242752 155
19 3300028379 Ga0268266_10285797 Ga0268266_102857972 155
20 3300028577 Ga0265318_10180781 Ga0265318_101807812 155
21 3300028800 Ga0265338_10010137 Ga0265338_100101374 155
22 3300031251 Ga0265327_10001180 Ga0265327_100011806 155
23 3300031251 Ga0265327_10268247 Ga0265327_102682472 155
24 3300031711 Ga0265314_10105552 Ga0265314_101055522 155
25 3300033180 Ga0307510_10084254 Ga0307510_100842543 155
26 3300037418 Ga0395900_0167427 Ga0395900_0167427_1743_2213 155
27 3300037418 Ga0395900_0205994 Ga0395900_0205994_1411_1881 155
28 3300037471 Ga0395905_0034223 Ga0395905_0034223_969_1439 155
29 3300038443 Ga0395901_0064787 Ga0395901_0064787_162_632 155
30 3300046536 Ga0495587_0380999 Ga0495587_0380999_279_749 155
31 3300049823 Ga0501044_0383176 Ga0501044_0383176_513_983 155
32 3300053090 Ga0500646_0008178 Ga0500646_0008178_1387_1857 155
33 3300053111 Ga0500572_002871 Ga0500572_002871_785_1255 155
34 3300053119 Ga0500595_009124 Ga0500595_009124_633_1103 155
35 3300053156 Ga0500622_0008486 Ga0500622_0008486_1335_1805 155
36 3300003791 Ga0055530_10000685 Ga0055530_100006854 156
37 3300003794 Ga0055531_10001281 Ga0055531_1000128117 156
38 3300003794 Ga0055531_10002834 Ga0055531_100028347 156
39 3300003794 Ga0055531_10075680 Ga0055531_100756802 156
40 3300005262 Ga0065165_1000552 Ga0065165_100055223 156
41 3300005262 Ga0065165_1012666 Ga0065165_10126663 156
42 3300005327 Ga0070658_10820665 Ga0070658_108206652 156
43 3300005331 Ga0070670_100000037 Ga0070670_10000003752 156
44 3300005335 Ga0070666_10049818 Ga0070666_100498184 156
45 3300005344 Ga0070661_100760126 Ga0070661_1007601261 156
46 3300005347 Ga0070668_100000489 Ga0070668_10000048912 156
47 3300005347 Ga0070668_100000745 Ga0070668_10000074510 156
48 3300005355 Ga0070671_100779205 Ga0070671_1007792052 156
49 3300005367 Ga0070667_100000083 Ga0070667_10000008352 156
50 3300005367 Ga0070667_100046160 Ga0070667_1000461604 156
51 3300005455 Ga0070663_100303780 Ga0070663_1003037802 156
52 3300005458 Ga0070681_10112147 Ga0070681_101121472 156
53 3300005530 Ga0070679_101320624 Ga0070679_1013206241 156
54 3300005539 Ga0068853_101562841 Ga0068853_1015628411 156
55 3300005548 Ga0070665_100000483 Ga0070665_10000048343 156
56 3300005548 Ga0070665_100001929 Ga0070665_1000019299 156
57 3300005563 Ga0068855_100194919 Ga0068855_1001949192 156
58 3300005563 Ga0068855_100526393 Ga0068855_1005263932 156
59 3300005577 Ga0068857_101007591 Ga0068857_1010075912 156
60 3300005616 Ga0068852_100688351 Ga0068852_1006883512 156
61 3300005618 Ga0068864_100000116 Ga0068864_10000011614 156
62 3300005841 Ga0068863_100001697 Ga0068863_1000016972 156
63 3300005842 Ga0068858_100003203 Ga0068858_1000032036 156
64 3300005843 Ga0068860_100000348 Ga0068860_1000003488 156
65 3300005843 Ga0068860_100093290 Ga0068860_1000932904 156
66 3300005844 Ga0068862_100000235 Ga0068862_10000023513 156
67 3300005844 Ga0068862_100593761 Ga0068862_1005937611 156
68 3300006028 Ga0070717_10061730 Ga0070717_100617303 156
69 3300006177 Ga0075362_10014998 Ga0075362_100149982 156
70 3300009093 Ga0105240_10013651 Ga0105240_100136517 156
71 3300009093 Ga0105240_10018121 Ga0105240_100181212 156
72 3300009093 Ga0105240_10586305 Ga0105240_105863052 156
73 3300009177 Ga0105248_10000438 Ga0105248_1000043836 156
74 3300009177 Ga0105248_10047938 Ga0105248_100479383 156
75 3300009177 Ga0105248_11859839 Ga0105248_118598392 156
76 3300009545 Ga0105237_10940924 Ga0105237_109409241 156
77 3300009551 Ga0105238_10079328 Ga0105238_100793282 156
78 3300009553 Ga0105249_10003334 Ga0105249_100033345 156
79 3300010375 Ga0105239_10192236 Ga0105239_101922362 156
80 3300010375 Ga0105239_10262352 Ga0105239_102623522 156
81 3300010375 Ga0105239_11736346 Ga0105239_117363462 156
82 3300013100 Ga0157373_10004486 Ga0157373_100044869 156
83 3300013104 Ga0157370_10115622 Ga0157370_101156223 156
84 3300013105 Ga0157369_10123007 Ga0157369_101230072 156
85 3300013307 Ga0157372_10067297 Ga0157372_100672973 156
86 3300014325 Ga0163163_10255190 Ga0163163_102551903 156
87 3300014325 Ga0163163_10709862 Ga0163163_107098622 156
88 3300014325 Ga0163163_10798594 Ga0163163_107985942 156
89 3300014325 Ga0163163_10831066 Ga0163163_108310661 156
90 3300014968 Ga0157379_10003351 Ga0157379_100033514 156
91 3300025250 Ga0209026_1000864 Ga0209026_10008646 156
92 3300025298 Ga0209050_1000101 Ga0209050_1000101198 156
93 3300025304 Ga0209257_1000221 Ga0209257_10002214 156
94 3300025304 Ga0209257_1015174 Ga0209257_10151743 156
95 3300025909 Ga0207705_10054342 Ga0207705_100543424 156
96 3300025909 Ga0207705_10518484 Ga0207705_105184842 156
97 3300025909 Ga0207705_10651536 Ga0207705_106515362 156
98 3300025911 Ga0207654_10401657 Ga0207654_104016572 156
99 3300025913 Ga0207695_10007605 Ga0207695_100076057 156
100 3300025913 Ga0207695_10686598 Ga0207695_106865982 156
101 3300025914 Ga0207671_11069794 Ga0207671_110697942 156
102 3300025921 Ga0207652_10417649 Ga0207652_104176492 156
103 3300025921 Ga0207652_11079446 Ga0207652_110794462 156
104 3300025924 Ga0207694_10043685 Ga0207694_100436853 156
105 3300025924 Ga0207694_10103724 Ga0207694_101037243 156
106 3300025925 Ga0207650_10000062 Ga0207650_1000006238 156
107 3300025925 Ga0207650_11292430 Ga0207650_112924301 156
108 3300025935 Ga0207709_10547950 Ga0207709_105479502 156
109 3300025938 Ga0207704_10006201 Ga0207704_100062015 156
110 3300025938 Ga0207704_11093831 Ga0207704_110938312 156
111 3300025941 Ga0207711_10000962 Ga0207711_1000096221 156
112 3300025941 Ga0207711_10152261 Ga0207711_101522611 156
113 3300025949 Ga0207667_10039889 Ga0207667_100398893 156
114 3300025949 Ga0207667_10526318 Ga0207667_105263182 156
115 3300025949 Ga0207667_10651059 Ga0207667_106510592 156
116 3300025961 Ga0207712_10038925 Ga0207712_100389254 156
117 3300025972 Ga0207668_10000028 Ga0207668_1000002891 156
118 3300025972 Ga0207668_10000130 Ga0207668_1000013040 156
119 3300025981 Ga0207640_10763102 Ga0207640_107631022 156
120 3300025986 Ga0207658_10005685 Ga0207658_100056855 156
121 3300025986 Ga0207658_10006804 Ga0207658_100068044 156
122 3300026023 Ga0207677_10531733 Ga0207677_105317332 156
123 3300026035 Ga0207703_10000843 Ga0207703_1000084316 156
124 3300026041 Ga0207639_10569721 Ga0207639_105697212 156
125 3300026067 Ga0207678_10070628 Ga0207678_100706284 156
126 3300026088 Ga0207641_10028888 Ga0207641_100288882 156
127 3300026095 Ga0207676_10000716 Ga0207676_1000071613 156
128 3300026116 Ga0207674_10943839 Ga0207674_109438392 156
129 3300026142 Ga0207698_10714161 Ga0207698_107141612 156
130 3300026142 Ga0207698_10838715 Ga0207698_108387152 156
131 3300027378 Ga0209981_1000636 Ga0209981_10006363 156
132 3300027543 Ga0209999_1004727 Ga0209999_10047274 156
133 3300027665 Ga0209983_1005703 Ga0209983_10057033 156
134 3300028379 Ga0268266_10000792 Ga0268266_100007929 156
135 3300028379 Ga0268266_10062910 Ga0268266_100629102 156
136 3300028380 Ga0268265_10001998 Ga0268265_100019988 156
137 3300028380 Ga0268265_10029963 Ga0268265_100299633 156
138 3300028381 Ga0268264_10000059 Ga0268264_10000059257 156
139 3300028381 Ga0268264_10115851 Ga0268264_101158514 156
140 3300030521 Ga0307511_10038070 Ga0307511_100380702 156
141 3300031903 Ga0307407_10136819 Ga0307407_101368192 156
142 3300031995 Ga0307409_100528901 Ga0307409_1005289012 156
143 3300032002 Ga0307416_101235706 Ga0307416_1012357062 156
144 3300032004 Ga0307414_10132552 Ga0307414_101325522 156
145 3300032005 Ga0307411_10105354 Ga0307411_101053542 156
146 3300032005 Ga0307411_10180674 Ga0307411_101806742 156
147 3300035170 Ga0373943_0375079 Ga0373943_0375079_56_526 156
148 3300035692 Ga0373935_1162688 Ga0373935_1162688_94_564 156
149 3300035695 Ga0373927_0000526 Ga0373927_0000526_28088_28558 156
150 3300037068 Ga0373925_0000061 Ga0373925_0000061_28636_29106 156
151 3300037418 Ga0395900_0954187 Ga0395900_0954187_22_492 156
152 3300037466 Ga0395898_1663451 Ga0395898_1663451_74_544 156
153 3300037471 Ga0395905_0106788 Ga0395905_0106788_849_1319 156
154 3300037471 Ga0395905_0997886 Ga0395905_0997886_249_719 156
155 3300037471 Ga0395905_1246178 Ga0395905_1246178_93_563 156
156 3300039437 Ga0436365_1676837 Ga0436365_1676837_831_1301 156
157 3300042127 Ga0450890_010669 Ga0450890_010669_298_768 156
158 3300044694 Ga0466963_0437910 Ga0466963_0437910_38_508 156
159 3300044842 Ga0466957_0690272 Ga0466957_0690272_208_678 156
160 3300044901 Ga0466960_0272354 Ga0466960_0272354_397_867 156
161 3300046529 Ga0495652_0577262 Ga0495652_0577262_286_756 156
162 3300046543 Ga0495645_0024641 Ga0495645_0024641_1397_1867 156
163 3300046664 Ga0495659_0184561 Ga0495659_0184561_89_559 156
164 3300046684 Ga0495669_0010381 Ga0495669_0010381_2952_3422 156
165 3300046694 Ga0495649_0492864 Ga0495649_0492864_65_535 156
166 3300047472 Ga0495686_0022623 Ga0495686_0022623_2794_3264 156
167 3300048905 Ga0496102_0030313 Ga0496102_0030313_1813_2283 156
168 3300048913 Ga0496110_0624083 Ga0496110_0624083_344_814 156
169 3300048915 Ga0496112_1083391 Ga0496112_1083391_127_597 156
170 3300049573 Ga0501037_0059766 Ga0501037_0059766_762_1232 156
171 3300049581 Ga0501047_0095613 Ga0501047_0095613_252_722 156
172 3300049581 Ga0501047_0113667 Ga0501047_0113667_538_1008 156
173 3300049581 Ga0501047_0502390 Ga0501047_0502390_400_870 156
174 3300049581 Ga0501047_0883778 Ga0501047_0883778_67_537 156
175 3300049581 Ga0501047_1030469 Ga0501047_1030469_88_558 156
176 3300049583 Ga0501067_0021611 Ga0501067_0021611_2139_2618 156
177 3300049588 Ga0501072_0055826 Ga0501072_0055826_275_754 156
178 3300049589 Ga0501073_0007054 Ga0501073_0007054_6113_6592 156
179 3300049590 Ga0501074_0379791 Ga0501074_0379791_47_526 156
180 3300049681 Ga0501251_079925 Ga0501251_079925_86_556 156
181 3300049742 Ga0501080_0012907 Ga0501080_0012907_2965_3444 156
182 3300049744 Ga0501083_0014643 Ga0501083_0014643_3793_4272 156
183 3300049822 Ga0501035_0262587 Ga0501035_0262587_152_622 156
184 3300049823 Ga0501044_0010085 Ga0501044_0010085_1514_1984 156
185 3300049823 Ga0501044_0565992 Ga0501044_0565992_173_643 156
186 3300050489 nmdc:mga03683_90583_c1 nmdc:mga03683_90583_c1_613_1083 156
187 3300050490 nmdc:mga03n38_40649_c1 nmdc:mga03n38_40649_c1_1352_1822 156
188 3300053087 Ga0500643_005954 Ga0500643_005954_1968_2438 156
189 3300053090 Ga0500646_0003762 Ga0500646_0003762_1817_2287 156
190 3300053108 Ga0500562_013138 Ga0500562_013138_650_1120 156
191 3300053730 Ga0500645_002967 Ga0500645_002967_4345_4815 156
192 3300060353 Ga0501082_0051849 Ga0501082_0051849_553_1032 156
193 iso_pu_bacteria 2510917020 2511125379 156
194 iso_pu_bacteria 2582581280 2585153129 156
195 iso_pu_bacteria 2582581293 2585196690 156
196 iso_pu_bacteria 2643221583 2643923519 156
197 3300005327 Ga0070658_10959006 Ga0070658_109590061 157
198 3300005334 Ga0068869_100022583 Ga0068869_1000225832 157
199 3300005335 Ga0070666_10450255 Ga0070666_104502551 157
200 3300005336 Ga0070680_100034575 Ga0070680_1000345752 157
201 3300005339 Ga0070660_100017823 Ga0070660_1000178234 157
202 3300005339 Ga0070660_100019403 Ga0070660_1000194034 157
203 3300005339 Ga0070660_100064682 Ga0070660_1000646821 157
204 3300005339 Ga0070660_100898354 Ga0070660_1008983541 157
205 3300005341 Ga0070691_10007536 Ga0070691_100075363 157
206 3300005344 Ga0070661_100129853 Ga0070661_1001298532 157
207 3300005347 Ga0070668_100003730 Ga0070668_1000037308 157
208 3300005347 Ga0070668_100032745 Ga0070668_1000327454 157
209 3300005355 Ga0070671_100028062 Ga0070671_1000280624 157
210 3300005364 Ga0070673_100236321 Ga0070673_1002363212 157
211 3300005366 Ga0070659_100001077 Ga0070659_1000010774 157
212 3300005366 Ga0070659_100035777 Ga0070659_1000357771 157
213 3300005366 Ga0070659_100896069 Ga0070659_1008960691 157
214 3300005367 Ga0070667_100002362 Ga0070667_10000236211 157
215 3300005457 Ga0070662_100125186 Ga0070662_1001251863 157
216 3300005458 Ga0070681_10014098 Ga0070681_100140985 157
217 3300005458 Ga0070681_10072032 Ga0070681_100720324 157
218 3300005530 Ga0070679_100154113 Ga0070679_1001541132 157
219 3300005530 Ga0070679_100175111 Ga0070679_1001751112 157
220 3300005539 Ga0068853_100377820 Ga0068853_1003778202 157
221 3300005539 Ga0068853_100524092 Ga0068853_1005240922 157
222 3300005539 Ga0068853_100902226 Ga0068853_1009022262 157
223 3300005548 Ga0070665_100000116 Ga0070665_10000011694 157
224 3300005548 Ga0070665_100026394 Ga0070665_1000263945 157
225 3300005563 Ga0068855_100010398 Ga0068855_1000103983 157
226 3300005577 Ga0068857_101229175 Ga0068857_1012291752 157
227 3300005614 Ga0068856_100079161 Ga0068856_1000791614 157
228 3300005616 Ga0068852_101163455 Ga0068852_1011634552 157
229 3300005617 Ga0068859_100012422 Ga0068859_1000124225 157
230 3300005618 Ga0068864_100002763 Ga0068864_1000027635 157
231 3300005618 Ga0068864_100005899 Ga0068864_1000058993 157
232 3300005719 Ga0068861_100024886 Ga0068861_1000248863 157
233 3300005841 Ga0068863_100000007 Ga0068863_100000007179 157
234 3300005841 Ga0068863_100048943 Ga0068863_1000489432 157
235 3300005841 Ga0068863_100124748 Ga0068863_1001247483 157
236 3300005841 Ga0068863_100295107 Ga0068863_1002951072 157
237 3300005842 Ga0068858_100000031 Ga0068858_100000031119 157
238 3300005842 Ga0068858_100221704 Ga0068858_1002217043 157
239 3300005843 Ga0068860_100000145 Ga0068860_100000145111 157
240 3300005843 Ga0068860_100019387 Ga0068860_1000193874 157
241 3300005844 Ga0068862_100006869 Ga0068862_1000068692 157
242 3300005844 Ga0068862_100019209 Ga0068862_1000192094 157
243 3300006237 Ga0097621_100366203 Ga0097621_1003662032 157
244 3300006881 Ga0068865_100971690 Ga0068865_1009716902 157
245 3300006931 Ga0097620_100012422 Ga0097620_1000124225 157
246 3300009092 Ga0105250_10016054 Ga0105250_100160544 157
247 3300009093 Ga0105240_10048116 Ga0105240_100481164 157
248 3300009093 Ga0105240_10176905 Ga0105240_101769054 157
249 3300009093 Ga0105240_10181325 Ga0105240_101813252 157
250 3300009093 Ga0105240_10424124 Ga0105240_104241242 157
251 3300009098 Ga0105245_11657758 Ga0105245_116577581 157
252 3300009177 Ga0105248_10207564 Ga0105248_102075643 157
253 3300009177 Ga0105248_10428707 Ga0105248_104287072 157
254 3300009551 Ga0105238_10054654 Ga0105238_100546542 157
255 3300009551 Ga0105238_10127960 Ga0105238_101279603 157
256 3300009551 Ga0105238_10270096 Ga0105238_102700962 157
257 3300009553 Ga0105249_10138547 Ga0105249_101385473 157
258 3300010375 Ga0105239_10394213 Ga0105239_103942132 157
259 3300010375 Ga0105239_11949111 Ga0105239_119491112 157
260 3300010375 Ga0105239_12280600 Ga0105239_122806001 157
261 3300013306 Ga0163162_10839660 Ga0163162_108396602 157
262 3300013308 Ga0157375_10057082 Ga0157375_100570822 157
263 3300013308 Ga0157375_13442027 Ga0157375_134420271 157
264 3300014325 Ga0163163_10023583 Ga0163163_100235833 157
265 3300014325 Ga0163163_10028528 Ga0163163_100285284 157
266 3300014326 Ga0157380_10133222 Ga0157380_101332223 157
267 3300014745 Ga0157377_10338831 Ga0157377_103388312 157
268 3300014968 Ga0157379_10009938 Ga0157379_100099384 157
269 3300014968 Ga0157379_10437717 Ga0157379_104377172 157
270 3300025903 Ga0207680_10550769 Ga0207680_105507692 157
271 3300025909 Ga0207705_10001576 Ga0207705_100015768 157
272 3300025909 Ga0207705_10057508 Ga0207705_100575084 157
273 3300025912 Ga0207707_10018184 Ga0207707_100181842 157
274 3300025912 Ga0207707_10038477 Ga0207707_100384773 157
275 3300025913 Ga0207695_10001229 Ga0207695_1000122922 157
276 3300025913 Ga0207695_10094918 Ga0207695_100949185 157
277 3300025913 Ga0207695_10095316 Ga0207695_100953164 157
278 3300025913 Ga0207695_10451602 Ga0207695_104516022 157
279 3300025917 Ga0207660_10003244 Ga0207660_1000324411 157
280 3300025917 Ga0207660_10953358 Ga0207660_109533582 157
281 3300025919 Ga0207657_10024382 Ga0207657_100243822 157
282 3300025919 Ga0207657_10028952 Ga0207657_100289524 157
283 3300025919 Ga0207657_10103078 Ga0207657_101030783 157
284 3300025919 Ga0207657_11171149 Ga0207657_111711491 157
285 3300025921 Ga0207652_10904957 Ga0207652_109049572 157
286 3300025924 Ga0207694_10070172 Ga0207694_100701724 157
287 3300025924 Ga0207694_10185509 Ga0207694_101855093 157
288 3300025924 Ga0207694_10282104 Ga0207694_102821042 157
289 3300025925 Ga0207650_10039689 Ga0207650_100396894 157
290 3300025925 Ga0207650_10133319 Ga0207650_101333192 157
291 3300025925 Ga0207650_10159401 Ga0207650_101594012 157
292 3300025925 Ga0207650_10395314 Ga0207650_103953141 157
293 3300025931 Ga0207644_10002801 Ga0207644_100028011 157
294 3300025931 Ga0207644_10024374 Ga0207644_100243744 157
295 3300025932 Ga0207690_10000129 Ga0207690_100001292 157
296 3300025932 Ga0207690_10018962 Ga0207690_100189623 157
297 3300025933 Ga0207706_10155536 Ga0207706_101555362 157
298 3300025938 Ga0207704_10906187 Ga0207704_109061872 157
299 3300025941 Ga0207711_10103528 Ga0207711_101035283 157
300 3300025941 Ga0207711_10152804 Ga0207711_101528041 157
301 3300025942 Ga0207689_10076301 Ga0207689_100763014 157
302 3300025945 Ga0207679_10946062 Ga0207679_109460622 157
303 3300025949 Ga0207667_10005781 Ga0207667_1000578114 157
304 3300025949 Ga0207667_10158435 Ga0207667_101584352 157
305 3300025960 Ga0207651_10127749 Ga0207651_101277492 157
306 3300025961 Ga0207712_10583230 Ga0207712_105832302 157
307 3300025972 Ga0207668_10001036 Ga0207668_1000103615 157
308 3300025972 Ga0207668_10005134 Ga0207668_100051342 157
309 3300025972 Ga0207668_10015874 Ga0207668_100158744 157
310 3300025986 Ga0207658_10006459 Ga0207658_100064594 157
311 3300026035 Ga0207703_10000038 Ga0207703_1000003869 157
312 3300026035 Ga0207703_10020047 Ga0207703_100200474 157
313 3300026041 Ga0207639_10113304 Ga0207639_101133043 157
314 3300026041 Ga0207639_10549174 Ga0207639_105491742 157
315 3300026041 Ga0207639_11052841 Ga0207639_110528411 157
316 3300026078 Ga0207702_10428784 Ga0207702_104287842 157
317 3300026088 Ga0207641_10000012 Ga0207641_10000012130 157
318 3300026088 Ga0207641_10074873 Ga0207641_100748734 157
319 3300026088 Ga0207641_10143210 Ga0207641_101432103 157
320 3300026088 Ga0207641_10192384 Ga0207641_101923842 157
321 3300026095 Ga0207676_10000179 Ga0207676_1000017951 157
322 3300026095 Ga0207676_10002829 Ga0207676_100028297 157
323 3300026095 Ga0207676_10200930 Ga0207676_102009302 157
324 3300026095 Ga0207676_10469426 Ga0207676_104694262 157
325 3300026116 Ga0207674_10153517 Ga0207674_101535173 157
326 3300026118 Ga0207675_100016217 Ga0207675_1000162174 157
327 3300026118 Ga0207675_100661465 Ga0207675_1006614652 157
328 3300028379 Ga0268266_10000064 Ga0268266_10000064200 157
329 3300028379 Ga0268266_10529634 Ga0268266_105296342 157
330 3300028380 Ga0268265_10002126 Ga0268265_1000212614 157
331 3300028381 Ga0268264_10000046 Ga0268264_10000046160 157
332 3300028786 Ga0307517_10000497 Ga0307517_1000049745 157
333 3300028786 Ga0307517_10108076 Ga0307517_101080762 157
334 3300031456 Ga0307513_10000448 Ga0307513_1000044842 157
335 3300031456 Ga0307513_10002007 Ga0307513_1000200719 157
336 3300031456 Ga0307513_10004437 Ga0307513_1000443713 157
337 3300031456 Ga0307513_10005088 Ga0307513_100050884 157
338 3300033180 Ga0307510_10011693 Ga0307510_100116932 157
339 3300037312 Ga0395899_0055404 Ga0395899_0055404_1062_1535 157
340 3300037312 Ga0395899_0116012 Ga0395899_0116012_1236_1709 157
341 3300037418 Ga0395900_0531966 Ga0395900_0531966_210_683 157
342 3300037418 Ga0395900_0586300 Ga0395900_0586300_569_1042 157
343 3300037466 Ga0395898_0126913 Ga0395898_0126913_1596_2069 157
344 3300037466 Ga0395898_0174058 Ga0395898_0174058_213_686 157
345 3300037471 Ga0395905_0025239 Ga0395905_0025239_1364_1837 157
346 3300037471 Ga0395905_0169966 Ga0395905_0169966_1463_1936 157
347 3300038443 Ga0395901_0826394 Ga0395901_0826394_154_627 157
348 3300039450 Ga0436363_0474361 Ga0436363_0474361_738_1226 157
349 3300046524 Ga0495648_0386109 Ga0495648_0386109_125_598 157
350 3300046528 Ga0495642_0001981 Ga0495642_0001981_1794_2267 157
351 3300046616 Ga0495668_0000092 Ga0495668_0000092_89168_89644 157
352 3300046660 Ga0495625_0025295 Ga0495625_0025295_3345_3818 157
353 3300046660 Ga0495625_0096626 Ga0495625_0096626_511_984 157
354 3300046684 Ga0495669_0000003 Ga0495669_0000003_260755_261228 157
355 3300046684 Ga0495669_0061444 Ga0495669_0061444_660_1133 157
356 3300047320 Ga0495672_0024965 Ga0495672_0024965_1179_1652 157
357 3300047320 Ga0495672_0034544 Ga0495672_0034544_2577_3053 157
358 3300047445 Ga0495677_0103324 Ga0495677_0103324_445_918 157
359 3300048903 Ga0496100_0127129 Ga0496100_0127129_977_1450 157
360 3300048904 Ga0496101_0091493 Ga0496101_0091493_714_1187 157
361 3300048905 Ga0496102_0072338 Ga0496102_0072338_2473_2946 157
362 3300048905 Ga0496102_0622804 Ga0496102_0622804_460_933 157
363 3300048906 Ga0496103_0277331 Ga0496103_0277331_550_1023 157
364 3300048910 Ga0496107_0014019 Ga0496107_0014019_428_901 157
365 3300048910 Ga0496107_0336502 Ga0496107_0336502_514_987 157
366 3300048911 Ga0496108_0063699 Ga0496108_0063699_503_976 157
367 3300048912 Ga0496109_0002851 Ga0496109_0002851_3522_3995 157
368 3300048913 Ga0496110_0281583 Ga0496110_0281583_510_983 157
369 3300048915 Ga0496112_0339576 Ga0496112_0339576_508_981 157
370 3300048918 Ga0496115_0002173 Ga0496115_0002173_3634_4107 157
371 3300048918 Ga0496115_0007602 Ga0496115_0007602_3301_3774 157
372 3300048918 Ga0496115_0038843 Ga0496115_0038843_924_1397 157
373 3300048919 Ga0496116_0045237 Ga0496116_0045237_1836_2309 157
374 3300048920 Ga0496117_0005253 Ga0496117_0005253_7835_8308 157
375 3300048921 Ga0496118_0005535 Ga0496118_0005535_10311_10784 157
376 3300048922 Ga0496119_0139078 Ga0496119_0139078_66_539 157
377 3300048923 Ga0496120_0217912 Ga0496120_0217912_408_881 157
378 3300048924 Ga0496121_0000009 Ga0496121_0000009_654625_655098 157
379 3300049581 Ga0501047_0020196 Ga0501047_0020196_2211_2684 157
380 3300049686 Ga0501257_002177 Ga0501257_002177_1492_1965 157
381 3300049742 Ga0501080_0786091 Ga0501080_0786091_108_581 157
382 3300053096 Ga0500641_0015768 Ga0500641_0015768_1680_2153 157
383 3300053108 Ga0500562_025024 Ga0500562_025024_447_920 157
384 3300053118 Ga0500594_0031058 Ga0500594_0031058_632_1105 157
385 3300053153 Ga0500616_0051933 Ga0500616_0051933_774_1253 157
386 3300053730 Ga0500645_039982 Ga0500645_039982_855_1334 157
387 3300003775 Ga0055524_1070227 Ga0055524_10702272 158
388 3300003781 Ga0055536_1004962 Ga0055536_10049627 158
389 3300003791 Ga0055530_10005956 Ga0055530_100059565 158
390 3300003791 Ga0055530_10020668 Ga0055530_100206682 158
391 3300003792 Ga0055540_1008688 Ga0055540_10086884 158
392 3300003794 Ga0055531_10005104 Ga0055531_100051047 158
393 3300003794 Ga0055531_10019911 Ga0055531_100199113 158
394 3300005262 Ga0065165_1001772 Ga0065165_100177210 158
395 3300005347 Ga0070668_100009254 Ga0070668_1000092545 158
396 3300005353 Ga0070669_100056933 Ga0070669_1000569334 158
397 3300005355 Ga0070671_100009285 Ga0070671_1000092856 158
398 3300005367 Ga0070667_100027061 Ga0070667_1000270614 158
399 3300005466 Ga0070685_11312247 Ga0070685_113122471 158
400 3300005617 Ga0068859_100000391 Ga0068859_10000039119 158
401 3300005719 Ga0068861_100072964 Ga0068861_1000729644 158
402 3300005841 Ga0068863_100003293 Ga0068863_1000032939 158
403 3300005842 Ga0068858_100023945 Ga0068858_1000239454 158
404 3300005843 Ga0068860_100052579 Ga0068860_1000525793 158
405 3300005844 Ga0068862_100139359 Ga0068862_1001393591 158
406 3300006042 Ga0075368_10126982 Ga0075368_101269822 158
407 3300006048 Ga0075363_100047280 Ga0075363_1000472802 158
408 3300006178 Ga0075367_10000827 Ga0075367_100008277 158
409 3300006195 Ga0075366_10066173 Ga0075366_100661733 158
410 3300006195 Ga0075366_10162413 Ga0075366_101624132 158
411 3300006195 Ga0075366_10171330 Ga0075366_101713302 158
412 3300006353 Ga0075370_10111103 Ga0075370_101111031 158
413 3300006353 Ga0075370_10272980 Ga0075370_102729802 158
414 3300006931 Ga0097620_100000391 Ga0097620_10000039119 158
415 3300009177 Ga0105248_10008920 Ga0105248_1000892010 158
416 3300012485 Ga0157325_1001950 Ga0157325_10019501 158
417 3300014325 Ga0163163_10022137 Ga0163163_100221374 158
418 3300014968 Ga0157379_10003384 Ga0157379_100033845 158
419 3300025292 Ga0209676_1000327 Ga0209676_100032755 158
420 3300025292 Ga0209676_1000409 Ga0209676_100040938 158
421 3300025292 Ga0209676_1087652 Ga0209676_10876521 158
422 3300025295 Ga0209564_1003781 Ga0209564_10037814 158
423 3300025298 Ga0209050_1001254 Ga0209050_100125422 158
424 3300025298 Ga0209050_1002240 Ga0209050_100224012 158
425 3300025299 Ga0209256_1010099 Ga0209256_10100992 158
426 3300025299 Ga0209256_1030703 Ga0209256_10307032 158
427 3300025303 Ga0209051_1000338 Ga0209051_100033837 158
428 3300025304 Ga0209257_1000386 Ga0209257_10003861 158
429 3300025304 Ga0209257_1001334 Ga0209257_10013347 158
430 3300025304 Ga0209257_1009760 Ga0209257_10097604 158
431 3300025923 Ga0207681_10319977 Ga0207681_103199772 158
432 3300025931 Ga0207644_10005572 Ga0207644_100055726 158
433 3300025941 Ga0207711_10009637 Ga0207711_100096373 158
434 3300025972 Ga0207668_10000879 Ga0207668_100008799 158
435 3300025986 Ga0207658_10008544 Ga0207658_100085445 158
436 3300026035 Ga0207703_10009331 Ga0207703_100093316 158
437 3300026088 Ga0207641_10020343 Ga0207641_100203434 158
438 3300026118 Ga0207675_100095867 Ga0207675_1000958672 158
439 3300027866 Ga0209813_10061786 Ga0209813_100617862 158
440 3300028379 Ga0268266_10038612 Ga0268266_100386124 158
441 3300028380 Ga0268265_10703683 Ga0268265_107036831 158
442 3300031456 Ga0307513_10901491 Ga0307513_109014911 158
443 3300031616 Ga0307508_10738071 Ga0307508_107380711 158
444 3300031730 Ga0307516_10000004 Ga0307516_10000004364 158
445 3300037418 Ga0395900_0109974 Ga0395900_0109974_43_519 158
446 3300037466 Ga0395898_0016546 Ga0395898_0016546_726_1202 158
447 3300037471 Ga0395905_0093793 Ga0395905_0093793_309_785 158
448 3300038443 Ga0395901_0046843 Ga0395901_0046843_809_1285 158
449 3300038443 Ga0395901_0105946 Ga0395901_0105946_1500_1976 158
450 3300041452 Ga0451793_0195077 Ga0451793_0195077_99_575 158
451 3300041505 Ga0451849_0975671 Ga0451849_0975671_25_504 158
452 3300042001 Ga0439441_178905 Ga0439441_178905_23_499 158
453 3300042436 Ga0439435_0028353 Ga0439435_0028353_897_1373 158
454 3300042438 Ga0439459_0039880 Ga0439459_0039880_360_836 158
455 3300044683 Ga0466965_0074640 Ga0466965_0074640_18_593 158
456 3300046457 Ga0495590_0001954 Ga0495590_0001954_3770_4246 158
457 3300046460 Ga0495638_0000701 Ga0495638_0000701_9424_9900 158
458 3300046460 Ga0495638_0001931 Ga0495638_0001931_11603_12079 158
459 3300046460 Ga0495638_0002456 Ga0495638_0002456_5096_5572 158
460 3300046460 Ga0495638_0002536 Ga0495638_0002536_7351_7827 158
461 3300046460 Ga0495638_0119425 Ga0495638_0119425_402_881 158
462 3300046471 Ga0495650_0000017 Ga0495650_0000017_110271_110747 158
463 3300046506 Ga0495583_0000020 Ga0495583_0000020_155869_156345 158
464 3300046507 Ga0495606_0012983 Ga0495606_0012983_1840_2319 158
465 3300046512 Ga0495610_0006241 Ga0495610_0006241_3811_4287 158
466 3300046513 Ga0495616_0189287 Ga0495616_0189287_52_528 158
467 3300046515 Ga0495620_0016467 Ga0495620_0016467_1427_1903 158
468 3300046518 Ga0495631_0009992 Ga0495631_0009992_3361_3837 158
469 3300046518 Ga0495631_0128938 Ga0495631_0128938_86_562 158
470 3300046519 Ga0495632_0143785 Ga0495632_0143785_470_946 158
471 3300046520 Ga0495637_0005524 Ga0495637_0005524_5640_6116 158
472 3300046525 Ga0495663_0023177 Ga0495663_0023177_936_1412 158
473 3300046530 Ga0495654_0000750 Ga0495654_0000750_6940_7416 158
474 3300046542 Ga0495597_0042638 Ga0495597_0042638_113_592 158
475 3300046616 Ga0495668_0003409 Ga0495668_0003409_10414_10890 158
476 3300046616 Ga0495668_0041050 Ga0495668_0041050_1845_2324 158
477 3300046660 Ga0495625_0004098 Ga0495625_0004098_9344_9820 158
478 3300046660 Ga0495625_0016645 Ga0495625_0016645_3492_3971 158
479 3300046660 Ga0495625_0020347 Ga0495625_0020347_2458_2934 158
480 3300046660 Ga0495625_0031934 Ga0495625_0031934_2458_2934 158
481 3300046660 Ga0495625_0064135 Ga0495625_0064135_1808_2284 158
482 3300046660 Ga0495625_0133394 Ga0495625_0133394_700_1176 158
483 3300046794 Ga0495589_0007451 Ga0495589_0007451_4350_4826 158
484 3300047320 Ga0495672_0001016 Ga0495672_0001016_18121_18597 158
485 3300047446 Ga0495679_016776 Ga0495679_016776_1733_2209 158
486 3300047469 Ga0495673_0004040 Ga0495673_0004040_3236_3712 158
487 3300047470 Ga0495681_0037146 Ga0495681_0037146_1057_1533 158
488 3300047472 Ga0495686_0000259 Ga0495686_0000259_93237_93713 158
489 3300047472 Ga0495686_0104072 Ga0495686_0104072_183_659 158
490 3300047472 Ga0495686_0400775 Ga0495686_0400775_25_501 158
491 3300048090 Ga0495615_0012594 Ga0495615_0012594_578_1054 158
492 3300048904 Ga0496101_0033852 Ga0496101_0033852_1320_1796 158
493 3300048905 Ga0496102_0602355 Ga0496102_0602355_56_532 158
494 3300048909 Ga0496106_0003278 Ga0496106_0003278_8610_9086 158
495 3300048910 Ga0496107_0000851 Ga0496107_0000851_16622_17098 158
496 3300048924 Ga0496121_0001613 Ga0496121_0001613_28290_28766 158
497 3300048926 Ga0496123_0197473 Ga0496123_0197473_85_561 158
498 3300048927 Ga0496124_0033194 Ga0496124_0033194_56_631 158
499 3300048928 Ga0496125_0019090 Ga0496125_0019090_4137_4616 158
500 3300048929 Ga0496126_0005746 Ga0496126_0005746_8516_8995 158
501 3300048929 Ga0496126_0167670 Ga0496126_0167670_877_1353 158
502 3300049459 Ga0495678_001694 Ga0495678_001694_15247_15723 158
503 3300049581 Ga0501047_0216722 Ga0501047_0216722_834_1310 158
504 3300049758 Ga0501241_026953 Ga0501241_026953_537_1016 158
505 3300050490 nmdc:mga03n38_380141_c1 nmdc:mga03n38_380141_c1_70_546 158
506 3300050493 nmdc:mga0k408_10134_c1 nmdc:mga0k408_10134_c1_563_1039 158
507 3300050493 nmdc:mga0k408_125345_c1 nmdc:mga0k408_125345_c1_212_688 158
508 3300050495 nmdc:mga04h51_73822_c1 nmdc:mga04h51_73822_c1_223_699 158
509 3300050496 nmdc:mga07m45_14110_c1 nmdc:mga07m45_14110_c1_846_1322 158
510 3300050496 nmdc:mga07m45_184801_c1 nmdc:mga07m45_184801_c1_369_848 158
511 3300050496 nmdc:mga07m45_232853_c1 nmdc:mga07m45_232853_c1_18_497 158
512 3300050496 nmdc:mga07m45_79587_c1 nmdc:mga07m45_79587_c1_748_1224 158
513 3300050516 nmdc:mga0sz30_29728_c1 nmdc:mga0sz30_29728_c1_1011_1490 158
514 3300053086 Ga0500578_0000420 Ga0500578_0000420_44711_45187 158
515 3300053102 Ga0500554_001349 Ga0500554_001349_1260_1736 158
516 3300053104 Ga0500556_0011180 Ga0500556_0011180_1097_1573 158
517 3300053104 Ga0500556_0143772 Ga0500556_0143772_305_781 158
518 3300053118 Ga0500594_0000212 Ga0500594_0000212_1022_1498 158
519 3300053120 Ga0500597_256103 Ga0500597_256103_207_683 158
520 3300053122 Ga0500608_000059 Ga0500608_000059_10678_11157 158
521 3300053123 Ga0500614_003176 Ga0500614_003176_566_1042 158
522 3300053125 Ga0500618_002667 Ga0500618_002667_1064_1540 158
523 3300053136 Ga0500559_0000077 Ga0500559_0000077_52722_53198 158
524 3300053136 Ga0500559_0000111 Ga0500559_0000111_58593_59069 158
525 3300053136 Ga0500559_0021293 Ga0500559_0021293_1468_1947 158
526 3300053142 Ga0500577_0001426 Ga0500577_0001426_607_1083 158
527 3300053146 Ga0500588_0061576 Ga0500588_0061576_151_627 158
528 3300053153 Ga0500616_0015967 Ga0500616_0015967_558_1034 158
529 3300053156 Ga0500622_0000526 Ga0500622_0000526_3947_4423 158
530 3300053156 Ga0500622_0014867 Ga0500622_0014867_673_1152 158
531 3300053156 Ga0500622_0058402 Ga0500622_0058402_408_887 158
532 3300053158 Ga0500627_0022301 Ga0500627_0022301_1316_1792 158
533 3300053163 Ga0500639_179950 Ga0500639_179950_309_785 158
534 3300053177 Ga0500636_0028477 Ga0500636_0028477_487_963 158
535 3300053727 Ga0500611_001826 Ga0500611_001826_1397_1873 158
536 3300053730 Ga0500645_074393 Ga0500645_074393_89_661 158
537 3300053733 Ga0500552_057734 Ga0500552_057734_12_491 158
538 iso_pu_bacteria 2928531327 2928535360 158
539 3300046459 Ga0495629_0018656 Ga0495629_0018656_1912_2391 159
540 3300046524 Ga0495648_0006618 Ga0495648_0006618_7837_8316 159
541 3300046542 Ga0495597_0001428 Ga0495597_0001428_11941_12420 159
542 3300046616 Ga0495668_0122382 Ga0495668_0122382_878_1357 159
543 3300046660 Ga0495625_0163407 Ga0495625_0163407_669_1148 159
544 3300047469 Ga0495673_0000401 Ga0495673_0000401_34522_35001 159
545 3300048088 Ga0495602_0442144 Ga0495602_0442144_425_904 159
546 3300049460 Ga0495682_0191850 Ga0495682_0191850_188_667 159
547 3300049570 Ga0501033_0008404 Ga0501033_0008404_3998_4483 159
548 3300049573 Ga0501037_0065489 Ga0501037_0065489_1458_1943 159
549 3300049823 Ga0501044_0000504 Ga0501044_0000504_40523_41008 159
550 3300053080 Ga0500635_0000228 Ga0500635_0000228_4020_4499 159
551 3300053087 Ga0500643_011284 Ga0500643_011284_621_1100 159
552 3300053088 Ga0500644_0001153 Ga0500644_0001153_2174_2653 159
553 3300053092 Ga0500583_0034722 Ga0500583_0034722_1475_1954 159
554 3300053094 Ga0500566_0074713 Ga0500566_0074713_343_822 159
555 3300053109 Ga0500569_011335 Ga0500569_011335_704_1183 159
556 3300053119 Ga0500595_002687 Ga0500595_002687_47_526 159
557 3300053122 Ga0500608_032146 Ga0500608_032146_1310_1789 159
558 3300053123 Ga0500614_004047 Ga0500614_004047_2080_2559 159
559 3300053130 Ga0500642_0341253 Ga0500642_0341253_95_574 159
560 3300053134 Ga0500658_0072909 Ga0500658_0072909_776_1255 159
561 3300053136 Ga0500559_0021419 Ga0500559_0021419_1006_1485 159
562 3300053138 Ga0500564_000021 Ga0500564_000021_15900_16379 159
563 3300053148 Ga0500590_013948 Ga0500590_013948_46_525 159
564 3300053162 Ga0500638_088613 Ga0500638_088613_400_879 159
565 3300053177 Ga0500636_0116303 Ga0500636_0116303_318_797 159
566 3300053177 Ga0500636_0199075 Ga0500636_0199075_180_659 159
567 3300053178 Ga0500637_0023362 Ga0500637_0023362_2577_3056 159
568 3300053178 Ga0500637_0068739 Ga0500637_0068739_569_1048 159
569 3300053725 Ga0500576_104458 Ga0500576_104458_305_784 159
570 3300053729 Ga0500625_093384 Ga0500625_093384_732_1211 159
571 3300053730 Ga0500645_039749 Ga0500645_039749_101_580 159
572 3300053735 Ga0500596_000416 Ga0500596_000416_6162_6641 159
573 3300055283 Ga0500661_048586 Ga0500661_048586_84_563 159
574 3300055283 Ga0500661_070376 Ga0500661_070376_10_489 159
575 3300003215 JGI25153J46596_10049192 JGI25153J46596_100491922 160
576 3300003771 Ga0055526_1036615 Ga0055526_10366151 160
577 3300003773 Ga0055537_1002539 Ga0055537_10025394 160
578 3300003775 Ga0055524_1013139 Ga0055524_10131393 160
579 3300003790 Ga0055528_1036149 Ga0055528_10361492 160
580 3300025263 Ga0209565_1000332 Ga0209565_10003328 160
581 3300025273 Ga0209673_1000523 Ga0209673_100052331 160
582 3300025291 Ga0209675_1016141 Ga0209675_10161412 160
583 3300025295 Ga0209564_1032654 Ga0209564_10326542 160
584 3300025297 Ga0209758_1002471 Ga0209758_100247117 160
585 3300025297 Ga0209758_1002872 Ga0209758_10028728 160
586 3300025299 Ga0209256_1003815 Ga0209256_10038154 160
587 3300028794 Ga0307515_10050621 Ga0307515_100506215 160
588 3300046453 Ga0495627_000443 Ga0495627_000443_8681_9172 160
589 3300046460 Ga0495638_0015888 Ga0495638_0015888_3373_3864 160
590 3300046501 Ga0495607_0036504 Ga0495607_0036504_1781_2272 160
591 3300046507 Ga0495606_0007343 Ga0495606_0007343_1157_1648 160
592 3300046512 Ga0495610_0000535 Ga0495610_0000535_11712_12203 160
593 3300046512 Ga0495610_0023019 Ga0495610_0023019_775_1266 160
594 3300046513 Ga0495616_0000375 Ga0495616_0000375_11639_12130 160
595 3300046513 Ga0495616_0215052 Ga0495616_0215052_16_603 160
596 3300046519 Ga0495632_0002115 Ga0495632_0002115_2965_3456 160
597 3300046520 Ga0495637_0019459 Ga0495637_0019459_980_1471 160
598 3300046522 Ga0495643_0059246 Ga0495643_0059246_132_623 160
599 3300046524 Ga0495648_0092740 Ga0495648_0092740_669_1160 160
600 3300046524 Ga0495648_0319462 Ga0495648_0319462_73_564 160
601 3300046616 Ga0495668_0038062 Ga0495668_0038062_396_887 160
602 3300046660 Ga0495625_0000865 Ga0495625_0000865_11448_11939 160
603 3300046660 Ga0495625_0006433 Ga0495625_0006433_4087_4578 160
604 3300046691 Ga0495670_0129809 Ga0495670_0129809_714_1205 160
605 3300046691 Ga0495670_0178051 Ga0495670_0178051_502_1089 160
606 3300047323 Ga0495683_0103166 Ga0495683_0103166_289_780 160
607 3300047469 Ga0495673_0000078 Ga0495673_0000078_168947_169438 160
608 3300048918 Ga0496115_0002548 Ga0496115_0002548_7056_7538 160
609 3300049671 Ga0501238_003056 Ga0501238_003056_932_1423 160
610 3300053087 Ga0500643_039219 Ga0500643_039219_397_888 160
611 3300053134 Ga0500658_0004419 Ga0500658_0004419_4466_4957 160
612 3300053136 Ga0500559_0020710 Ga0500559_0020710_13_504 160
613 3300053151 Ga0500604_0338976 Ga0500604_0338976_18_509 160
614 3300053153 Ga0500616_0047953 Ga0500616_0047953_1680_2171 160
615 3300053156 Ga0500622_0023470 Ga0500622_0023470_1249_1740 160
616 3300053730 Ga0500645_003640 Ga0500645_003640_1569_2060 160
617 3300053731 Ga0500609_000612 Ga0500609_000612_3225_3716 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

59

184

0.94

PF03061

4HBT

Thioesterase superfamily

108

182

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d6x-assembly1.cif.gz_A crystal structure of campylobacter jejuni fabz 0.9646 15 155
3d6x-assembly1.cif.gz_F crystal structure of campylobacter jejuni fabz 0.956 15 155
3d6x-assembly1.cif.gz_B crystal structure of campylobacter jejuni fabz 0.9549 15 156
3d6x-assembly1.cif.gz_A crystal structure of campylobacter jejuni fabz 0.951 15 155
4zw0-assembly1.cif.gz_C crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from candidatus asiaticum 0.9497 14 156
ID Description Score Start End Superfamily
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9537 15 155 3.10.129.10
2gllA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9485 13 158 3.10.129.10
4zw0B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9467 14 153 3.10.129.10
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9467 15 155 3.10.129.10
af_Q2FWF5_1_146_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9291 16 158 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7Y8SSH0-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9698 10 158 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A4P1K7R3-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9697 10 160 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A4Y9RBG6-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9684 10 159 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A1G9VA18-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.9664 14 156 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171
AF-A0A7L5Z9R0-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) 0.966 11 160 GO:0005737
GO:0006633
GO:0009245
GO:0016020
GO:0019171

Feature Viewer

pLDDT pTM Quality
85.91 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map