F469663
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 617 | 298 | 610 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300046513|Ga0495616_0215052|Ga0495616_0215052_16_603 |
| Length | 195 |
| Sequence | MDWVSGATAEAVAPRNRMAVAQGGRPGNQGARMSQSKTEEPQASEGSANIDIAEILNRIPHRYPFLLVDRAEAYRAHQSIVGIKCVTINEPFFQGHFPGNPVMPGVLIIEALAQTGAVLMSKSLEVDTDGKTIFFMSVDNARFRNPVRPGDVIRMEVEVVRARSSIFKFKGVAKVGDKVAAEAEFAAMVVETPKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 3 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 4 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 5 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 6 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 7 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 137 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 138 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 139 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 141 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 143 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 144 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 146 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 147 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 148 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 149 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 150 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 151 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 152 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 154 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 155 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 157 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 158 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 159 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 160 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 161 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 162 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 163 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 164 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 165 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 166 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 167 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 168 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 169 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 170 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 171 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 172 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 173 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 222 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 223 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 224 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 225 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 226 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 227 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 228 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 229 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 230 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 231 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 232 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 233 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 243 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 244 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 245 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 248 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 251 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 252 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 253 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 254 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 255 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 256 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 257 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 258 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 259 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 260 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 261 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 262 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 263 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 264 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 265 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 266 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 267 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 268 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 269 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 270 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 271 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 272 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 273 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 274 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 275 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 276 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 277 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 278 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 279 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 280 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 281 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 282 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 283 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 284 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 285 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 287 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 288 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 289 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 290 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 291 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 292 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 293 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 294 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 295 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 296 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 297 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 298 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.87 |
| Metatranscriptomes | 0 |
| Isolates | 1.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.53 |
| Nodule | 0 |
| Rhizoplane | 3.73 |
| Rhizosphere | 68.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10049192 | 3300003215 | Bacteria | 1225 |
| 2 | Ga0055526_1036615 | 3300003771 | Bacteria | 1299 |
| 3 | Ga0055537_1002539 | 3300003773 | Bacteria | 6044 |
| 4 | Ga0055524_1013139 | 3300003775 | Bacteria | 3138 |
| 5 | Ga0055524_1070227 | 3300003775 | Bacteria | 678 |
| 6 | Ga0055536_1004962 | 3300003781 | Bacteria | 6625 |
| 7 | Ga0055528_1036149 | 3300003790 | Bacteria | 1185 |
| 8 | Ga0055530_10000685 | 3300003791 | Bacteria | 28722 |
| 9 | Ga0055530_10005956 | 3300003791 | Bacteria | 5611 |
| 10 | Ga0055530_10020668 | 3300003791 | Bacteria | 1960 |
| 11 | Ga0055540_1008688 | 3300003792 | Bacteria | 3622 |
| 12 | Ga0055531_10001281 | 3300003794 | Bacteria | 18942 |
| 13 | Ga0055531_10002834 | 3300003794 | Bacteria | 11348 |
| 14 | Ga0055531_10005104 | 3300003794 | Bacteria | 7758 |
| 15 | Ga0055531_10019911 | 3300003794 | Bacteria | 2685 |
| 16 | Ga0055531_10075680 | 3300003794 | Bacteria | 759 |
| 17 | Ga0065165_1000552 | 3300005262 | Bacteria | 56291 |
| 18 | Ga0065165_1001772 | 3300005262 | Bacteria | 21379 |
| 19 | Ga0065165_1012666 | 3300005262 | Bacteria | 3416 |
| 20 | Ga0070658_10820665 | 3300005327 | Bacteria | 808 |
| 21 | Ga0070658_10959006 | 3300005327 | Bacteria | 744 |
| 22 | Ga0070670_100000037 | 3300005331 | Bacteria | 156070 |
| 23 | Ga0068869_100022583 | 3300005334 | Bacteria | 4337 |
| 24 | Ga0070666_10049818 | 3300005335 | Bacteria | 2816 |
| 25 | Ga0070666_10450255 | 3300005335 | Bacteria | 929 |
| 26 | Ga0070680_100034575 | 3300005336 | Bacteria | 4075 |
| 27 | Ga0070660_100017823 | 3300005339 | Bacteria | 5180 |
| 28 | Ga0070660_100019403 | 3300005339 | Bacteria | 4983 |
| 29 | Ga0070660_100064682 | 3300005339 | Bacteria | 2846 |
| 30 | Ga0070660_100898354 | 3300005339 | Bacteria | 747 |
| 31 | Ga0070691_10007536 | 3300005341 | Bacteria | 4990 |
| 32 | Ga0070661_100129853 | 3300005344 | Bacteria | 1892 |
| 33 | Ga0070661_100760126 | 3300005344 | Bacteria | 793 |
| 34 | Ga0070668_100000489 | 3300005347 | Bacteria | 26287 |
| 35 | Ga0070668_100000745 | 3300005347 | Bacteria | 22317 |
| 36 | Ga0070668_100003730 | 3300005347 | Bacteria | 11234 |
| 37 | Ga0070668_100009254 | 3300005347 | Bacteria | 7305 |
| 38 | Ga0070668_100032745 | 3300005347 | Bacteria | 3955 |
| 39 | Ga0070669_100056933 | 3300005353 | Bacteria | 2867 |
| 40 | Ga0070671_100009285 | 3300005355 | Bacteria | 7899 |
| 41 | Ga0070671_100028062 | 3300005355 | Bacteria | 4635 |
| 42 | Ga0070671_100779205 | 3300005355 | Bacteria | 832 |
| 43 | Ga0070673_100236321 | 3300005364 | Bacteria | 1587 |
| 44 | Ga0070659_100001077 | 3300005366 | Bacteria | 19933 |
| 45 | Ga0070659_100035777 | 3300005366 | Bacteria | 3868 |
| 46 | Ga0070659_100896069 | 3300005366 | Bacteria | 775 |
| 47 | Ga0070667_100000083 | 3300005367 | Bacteria | 118261 |
| 48 | Ga0070667_100002362 | 3300005367 | Bacteria | 16528 |
| 49 | Ga0070667_100027061 | 3300005367 | Bacteria | 4770 |
| 50 | Ga0070667_100046160 | 3300005367 | Bacteria | 3664 |
| 51 | Ga0070694_100535307 | 3300005444 | Bacteria | 936 |
| 52 | Ga0070663_100303780 | 3300005455 | Bacteria | 1278 |
| 53 | Ga0070662_100125186 | 3300005457 | Bacteria | 1975 |
| 54 | Ga0070681_10014098 | 3300005458 | Bacteria | 7955 |
| 55 | Ga0070681_10072032 | 3300005458 | Bacteria | 3419 |
| 56 | Ga0070681_10112147 | 3300005458 | Bacteria | 2666 |
| 57 | Ga0070685_11312247 | 3300005466 | Bacteria | 553 |
| 58 | Ga0070679_100154113 | 3300005530 | Bacteria | 2273 |
| 59 | Ga0070679_100175111 | 3300005530 | Bacteria | 2118 |
| 60 | Ga0070679_101320624 | 3300005530 | Bacteria | 667 |
| 61 | Ga0068853_100377820 | 3300005539 | Bacteria | 1323 |
| 62 | Ga0068853_100524092 | 3300005539 | Bacteria | 1120 |
| 63 | Ga0068853_100902226 | 3300005539 | Bacteria | 849 |
| 64 | Ga0068853_101562841 | 3300005539 | Bacteria | 639 |
| 65 | Ga0070665_100000116 | 3300005548 | Bacteria | 150141 |
| 66 | Ga0070665_100000483 | 3300005548 | Bacteria | 57237 |
| 67 | Ga0070665_100001929 | 3300005548 | Bacteria | 23364 |
| 68 | Ga0070665_100026394 | 3300005548 | Bacteria | 5850 |
| 69 | Ga0068855_100010398 | 3300005563 | Bacteria | 11225 |
| 70 | Ga0068855_100194919 | 3300005563 | Bacteria | 2283 |
| 71 | Ga0068855_100526393 | 3300005563 | Bacteria | 1282 |
| 72 | Ga0068855_100815869 | 3300005563 | Bacteria | 991 |
| 73 | Ga0068857_101007591 | 3300005577 | Bacteria | 802 |
| 74 | Ga0068857_101229175 | 3300005577 | Bacteria | 726 |
| 75 | Ga0068856_100079161 | 3300005614 | Bacteria | 3259 |
| 76 | Ga0068852_100688351 | 3300005616 | Bacteria | 1032 |
| 77 | Ga0068852_101163455 | 3300005616 | Bacteria | 792 |
| 78 | Ga0068859_100000391 | 3300005617 | Bacteria | 43751 |
| 79 | Ga0068859_100012422 | 3300005617 | Bacteria | 8570 |
| 80 | Ga0068864_100000116 | 3300005618 | Bacteria | 79213 |
| 81 | Ga0068864_100002763 | 3300005618 | Bacteria | 14478 |
| 82 | Ga0068864_100005899 | 3300005618 | Bacteria | 10040 |
| 83 | Ga0068861_100024886 | 3300005719 | Bacteria | 4335 |
| 84 | Ga0068861_100072964 | 3300005719 | Bacteria | 2665 |
| 85 | Ga0068863_100000007 | 3300005841 | Bacteria | 257578 |
| 86 | Ga0068863_100001697 | 3300005841 | Bacteria | 21819 |
| 87 | Ga0068863_100003293 | 3300005841 | Bacteria | 15944 |
| 88 | Ga0068863_100048943 | 3300005841 | Bacteria | 4008 |
| 89 | Ga0068863_100124748 | 3300005841 | Bacteria | 2456 |
| 90 | Ga0068863_100295107 | 3300005841 | Bacteria | 1572 |
| 91 | Ga0068858_100000031 | 3300005842 | Bacteria | 143397 |
| 92 | Ga0068858_100003203 | 3300005842 | Bacteria | 16353 |
| 93 | Ga0068858_100023945 | 3300005842 | Bacteria | 5688 |
| 94 | Ga0068858_100221704 | 3300005842 | Bacteria | 1791 |
| 95 | Ga0068860_100000145 | 3300005843 | Bacteria | 115830 |
| 96 | Ga0068860_100000348 | 3300005843 | Bacteria | 62147 |
| 97 | Ga0068860_100019387 | 3300005843 | Bacteria | 6597 |
| 98 | Ga0068860_100052579 | 3300005843 | Bacteria | 3874 |
| 99 | Ga0068860_100093290 | 3300005843 | Bacteria | 2869 |
| 100 | Ga0068862_100000235 | 3300005844 | Bacteria | 61301 |
| 101 | Ga0068862_100006869 | 3300005844 | Bacteria | 9437 |
| 102 | Ga0068862_100019209 | 3300005844 | Bacteria | 5699 |
| 103 | Ga0068862_100139359 | 3300005844 | Bacteria | 2152 |
| 104 | Ga0068862_100593761 | 3300005844 | Bacteria | 1062 |
| 105 | Ga0070717_10061730 | 3300006028 | Bacteria | 3106 |
| 106 | Ga0075368_10126982 | 3300006042 | Bacteria | 1059 |
| 107 | Ga0075363_100047280 | 3300006048 | Bacteria | 2285 |
| 108 | Ga0075362_10014998 | 3300006177 | Bacteria | 3142 |
| 109 | Ga0075367_10000827 | 3300006178 | Bacteria | 12261 |
| 110 | Ga0075366_10066173 | 3300006195 | Bacteria | 2150 |
| 111 | Ga0075366_10162413 | 3300006195 | Bacteria | 1354 |
| 112 | Ga0075366_10171330 | 3300006195 | Bacteria | 1317 |
| 113 | Ga0097621_100366203 | 3300006237 | Bacteria | 1285 |
| 114 | Ga0075370_10111103 | 3300006353 | Bacteria | 1592 |
| 115 | Ga0075370_10272980 | 3300006353 | Bacteria | 1004 |
| 116 | Ga0068865_100971690 | 3300006881 | Bacteria | 742 |
| 117 | Ga0097620_100000391 | 3300006931 | Bacteria | 43751 |
| 118 | Ga0097620_100012422 | 3300006931 | Bacteria | 8570 |
| 119 | Ga0105250_10016054 | 3300009092 | Bacteria | 3056 |
| 120 | Ga0105240_10013651 | 3300009093 | Bacteria | 11140 |
| 121 | Ga0105240_10018121 | 3300009093 | Bacteria | 9467 |
| 122 | Ga0105240_10048116 | 3300009093 | Bacteria | 5391 |
| 123 | Ga0105240_10176905 | 3300009093 | Bacteria | 2522 |
| 124 | Ga0105240_10181325 | 3300009093 | Bacteria | 2485 |
| 125 | Ga0105240_10424124 | 3300009093 | Bacteria | 1494 |
| 126 | Ga0105240_10586305 | 3300009093 | Bacteria | 1229 |
| 127 | Ga0105245_11657758 | 3300009098 | Bacteria | 691 |
| 128 | Ga0105242_10514307 | 3300009176 | Bacteria | 1141 |
| 129 | Ga0105248_10000438 | 3300009177 | Bacteria | 47263 |
| 130 | Ga0105248_10008920 | 3300009177 | Bacteria | 11024 |
| 131 | Ga0105248_10047938 | 3300009177 | Bacteria | 4792 |
| 132 | Ga0105248_10207564 | 3300009177 | Bacteria | 2207 |
| 133 | Ga0105248_10428707 | 3300009177 | Bacteria | 1489 |
| 134 | Ga0105248_11859839 | 3300009177 | Bacteria | 683 |
| 135 | Ga0105237_10940924 | 3300009545 | Bacteria | 871 |
| 136 | Ga0105238_10054654 | 3300009551 | Bacteria | 4009 |
| 137 | Ga0105238_10079328 | 3300009551 | Bacteria | 3273 |
| 138 | Ga0105238_10127960 | 3300009551 | Bacteria | 2518 |
| 139 | Ga0105238_10270096 | 3300009551 | Bacteria | 1681 |
| 140 | Ga0105249_10003334 | 3300009553 | Bacteria | 13911 |
| 141 | Ga0105249_10138547 | 3300009553 | Bacteria | 2331 |
| 142 | Ga0105239_10192236 | 3300010375 | Bacteria | 2284 |
| 143 | Ga0105239_10262352 | 3300010375 | Bacteria | 1942 |
| 144 | Ga0105239_10394213 | 3300010375 | Bacteria | 1566 |
| 145 | Ga0105239_11736346 | 3300010375 | Bacteria | 723 |
| 146 | Ga0105239_11949111 | 3300010375 | Bacteria | 682 |
| 147 | Ga0105239_12280600 | 3300010375 | Bacteria | 630 |
| 148 | Ga0157325_1001950 | 3300012485 | Bacteria | 1004 |
| 149 | Ga0157373_10001429 | 3300013100 | Bacteria | 18213 |
| 150 | Ga0157373_10004486 | 3300013100 | Bacteria | 10506 |
| 151 | Ga0157370_10115622 | 3300013104 | Bacteria | 2506 |
| 152 | Ga0157369_10123007 | 3300013105 | Bacteria | 2752 |
| 153 | Ga0163162_10680000 | 3300013306 | Bacteria | 1152 |
| 154 | Ga0163162_10839660 | 3300013306 | Bacteria | 1034 |
| 155 | Ga0157372_10067297 | 3300013307 | Bacteria | 4025 |
| 156 | Ga0157372_11992119 | 3300013307 | Bacteria | 667 |
| 157 | Ga0157375_10057082 | 3300013308 | Bacteria | 3858 |
| 158 | Ga0157375_13442027 | 3300013308 | Bacteria | 527 |
| 159 | Ga0163163_10022137 | 3300014325 | Bacteria | 6012 |
| 160 | Ga0163163_10023583 | 3300014325 | Bacteria | 5841 |
| 161 | Ga0163163_10028528 | 3300014325 | Bacteria | 5361 |
| 162 | Ga0163163_10255190 | 3300014325 | Bacteria | 1804 |
| 163 | Ga0163163_10709862 | 3300014325 | Bacteria | 1069 |
| 164 | Ga0163163_10798594 | 3300014325 | Bacteria | 1007 |
| 165 | Ga0163163_10831066 | 3300014325 | Bacteria | 987 |
| 166 | Ga0157380_10133222 | 3300014326 | Bacteria | 2123 |
| 167 | Ga0157377_10338831 | 3300014745 | Bacteria | 1005 |
| 168 | Ga0157379_10003351 | 3300014968 | Bacteria | 13575 |
| 169 | Ga0157379_10003384 | 3300014968 | Bacteria | 13491 |
| 170 | Ga0157379_10009938 | 3300014968 | Bacteria | 8286 |
| 171 | Ga0157379_10437717 | 3300014968 | Bacteria | 1205 |
| 172 | Ga0157376_10815033 | 3300014969 | Bacteria | 947 |
| 173 | Ga0209026_1000864 | 3300025250 | Bacteria | 15837 |
| 174 | Ga0209565_1000332 | 3300025263 | Bacteria | 42136 |
| 175 | Ga0209673_1000523 | 3300025273 | Bacteria | 62816 |
| 176 | Ga0209675_1016141 | 3300025291 | Bacteria | 2187 |
| 177 | Ga0209676_1000327 | 3300025292 | Bacteria | 91596 |
| 178 | Ga0209676_1000409 | 3300025292 | Bacteria | 77127 |
| 179 | Ga0209676_1087652 | 3300025292 | Bacteria | 692 |
| 180 | Ga0209564_1003781 | 3300025295 | Bacteria | 9852 |
| 181 | Ga0209564_1032654 | 3300025295 | Bacteria | 1563 |
| 182 | Ga0209758_1002471 | 3300025297 | Bacteria | 18803 |
| 183 | Ga0209758_1002872 | 3300025297 | Bacteria | 16699 |
| 184 | Ga0209050_1000101 | 3300025298 | Bacteria | 230076 |
| 185 | Ga0209050_1001254 | 3300025298 | Bacteria | 29280 |
| 186 | Ga0209050_1002240 | 3300025298 | Bacteria | 17254 |
| 187 | Ga0209256_1003815 | 3300025299 | Bacteria | 10097 |
| 188 | Ga0209256_1010099 | 3300025299 | Bacteria | 4015 |
| 189 | Ga0209256_1030703 | 3300025299 | Bacteria | 1480 |
| 190 | Ga0209051_1000338 | 3300025303 | Bacteria | 70301 |
| 191 | Ga0209257_1000221 | 3300025304 | Bacteria | 134870 |
| 192 | Ga0209257_1000386 | 3300025304 | Bacteria | 88085 |
| 193 | Ga0209257_1001334 | 3300025304 | Bacteria | 29951 |
| 194 | Ga0209257_1009760 | 3300025304 | Bacteria | 5039 |
| 195 | Ga0209257_1015174 | 3300025304 | Bacteria | 3234 |
| 196 | Ga0207680_10550769 | 3300025903 | Bacteria | 823 |
| 197 | Ga0207705_10001576 | 3300025909 | Bacteria | 18123 |
| 198 | Ga0207705_10054342 | 3300025909 | Bacteria | 2886 |
| 199 | Ga0207705_10057508 | 3300025909 | Bacteria | 2805 |
| 200 | Ga0207705_10518484 | 3300025909 | Bacteria | 926 |
| 201 | Ga0207705_10651536 | 3300025909 | Bacteria | 819 |
| 202 | Ga0207654_10401657 | 3300025911 | Bacteria | 953 |
| 203 | Ga0207707_10018184 | 3300025912 | Bacteria | 6126 |
| 204 | Ga0207707_10038477 | 3300025912 | Bacteria | 4179 |
| 205 | Ga0207695_10001229 | 3300025913 | Bacteria | 43850 |
| 206 | Ga0207695_10007605 | 3300025913 | Bacteria | 13731 |
| 207 | Ga0207695_10094918 | 3300025913 | Bacteria | 2988 |
| 208 | Ga0207695_10095316 | 3300025913 | Bacteria | 2980 |
| 209 | Ga0207695_10451602 | 3300025913 | Bacteria | 1168 |
| 210 | Ga0207695_10686598 | 3300025913 | Bacteria | 904 |
| 211 | Ga0207671_11069794 | 3300025914 | Bacteria | 634 |
| 212 | Ga0207660_10003244 | 3300025917 | Bacteria | 10652 |
| 213 | Ga0207660_10953358 | 3300025917 | Bacteria | 700 |
| 214 | Ga0207657_10024382 | 3300025919 | Bacteria | 5604 |
| 215 | Ga0207657_10028952 | 3300025919 | Bacteria | 5046 |
| 216 | Ga0207657_10103078 | 3300025919 | Bacteria | 2365 |
| 217 | Ga0207657_11171149 | 3300025919 | Bacteria | 585 |
| 218 | Ga0207652_10417649 | 3300025921 | Bacteria | 1210 |
| 219 | Ga0207652_10904957 | 3300025921 | Bacteria | 779 |
| 220 | Ga0207652_11079446 | 3300025921 | Bacteria | 703 |
| 221 | Ga0207681_10319977 | 3300025923 | Bacteria | 1233 |
| 222 | Ga0207694_10043685 | 3300025924 | Bacteria | 3459 |
| 223 | Ga0207694_10070172 | 3300025924 | Bacteria | 2737 |
| 224 | Ga0207694_10103724 | 3300025924 | Bacteria | 2255 |
| 225 | Ga0207694_10185509 | 3300025924 | Bacteria | 1688 |
| 226 | Ga0207694_10282104 | 3300025924 | Bacteria | 1365 |
| 227 | Ga0207650_10000062 | 3300025925 | Bacteria | 149776 |
| 228 | Ga0207650_10039689 | 3300025925 | Bacteria | 3440 |
| 229 | Ga0207650_10133319 | 3300025925 | Bacteria | 1946 |
| 230 | Ga0207650_10159401 | 3300025925 | Bacteria | 1787 |
| 231 | Ga0207650_10395314 | 3300025925 | Bacteria | 1143 |
| 232 | Ga0207650_11292430 | 3300025925 | Bacteria | 621 |
| 233 | Ga0207644_10002801 | 3300025931 | Bacteria | 11240 |
| 234 | Ga0207644_10005572 | 3300025931 | Bacteria | 8195 |
| 235 | Ga0207644_10024374 | 3300025931 | Bacteria | 4153 |
| 236 | Ga0207690_10000129 | 3300025932 | Bacteria | 62350 |
| 237 | Ga0207690_10018962 | 3300025932 | Bacteria | 4224 |
| 238 | Ga0207706_10155536 | 3300025933 | Bacteria | 2011 |
| 239 | Ga0207709_10547950 | 3300025935 | Bacteria | 909 |
| 240 | Ga0207704_10006201 | 3300025938 | Bacteria | 5557 |
| 241 | Ga0207704_10906187 | 3300025938 | Bacteria | 742 |
| 242 | Ga0207704_11093831 | 3300025938 | Bacteria | 677 |
| 243 | Ga0207711_10000962 | 3300025941 | Bacteria | 27597 |
| 244 | Ga0207711_10009637 | 3300025941 | Bacteria | 8047 |
| 245 | Ga0207711_10103528 | 3300025941 | Bacteria | 2521 |
| 246 | Ga0207711_10152261 | 3300025941 | Bacteria | 2088 |
| 247 | Ga0207711_10152804 | 3300025941 | Bacteria | 2084 |
| 248 | Ga0207689_10076301 | 3300025942 | Bacteria | 2756 |
| 249 | Ga0207679_10946062 | 3300025945 | Bacteria | 789 |
| 250 | Ga0207667_10005781 | 3300025949 | Bacteria | 15088 |
| 251 | Ga0207667_10039889 | 3300025949 | Bacteria | 5001 |
| 252 | Ga0207667_10158435 | 3300025949 | Bacteria | 2329 |
| 253 | Ga0207667_10526318 | 3300025949 | Bacteria | 1197 |
| 254 | Ga0207667_10651059 | 3300025949 | Bacteria | 1059 |
| 255 | Ga0207667_11724275 | 3300025949 | Bacteria | 592 |
| 256 | Ga0207651_10127749 | 3300025960 | Bacteria | 1940 |
| 257 | Ga0207712_10038925 | 3300025961 | Bacteria | 3254 |
| 258 | Ga0207712_10583230 | 3300025961 | Bacteria | 965 |
| 259 | Ga0207668_10000028 | 3300025972 | Bacteria | 125361 |
| 260 | Ga0207668_10000130 | 3300025972 | Bacteria | 53528 |
| 261 | Ga0207668_10000879 | 3300025972 | Bacteria | 18115 |
| 262 | Ga0207668_10001036 | 3300025972 | Bacteria | 16597 |
| 263 | Ga0207668_10005134 | 3300025972 | Bacteria | 7702 |
| 264 | Ga0207668_10015874 | 3300025972 | Bacteria | 4689 |
| 265 | Ga0207640_10763102 | 3300025981 | Bacteria | 835 |
| 266 | Ga0207658_10005685 | 3300025986 | Bacteria | 8526 |
| 267 | Ga0207658_10006459 | 3300025986 | Bacteria | 8003 |
| 268 | Ga0207658_10006804 | 3300025986 | Bacteria | 7790 |
| 269 | Ga0207658_10008544 | 3300025986 | Bacteria | 6966 |
| 270 | Ga0207677_10531733 | 3300026023 | Bacteria | 1021 |
| 271 | Ga0207703_10000038 | 3300026035 | Bacteria | 175917 |
| 272 | Ga0207703_10000843 | 3300026035 | Bacteria | 30142 |
| 273 | Ga0207703_10009331 | 3300026035 | Bacteria | 7711 |
| 274 | Ga0207703_10020047 | 3300026035 | Bacteria | 5225 |
| 275 | Ga0207639_10113304 | 3300026041 | Bacteria | 2215 |
| 276 | Ga0207639_10549174 | 3300026041 | Bacteria | 1060 |
| 277 | Ga0207639_10569721 | 3300026041 | Bacteria | 1041 |
| 278 | Ga0207639_11052841 | 3300026041 | Bacteria | 762 |
| 279 | Ga0207678_10070628 | 3300026067 | Bacteria | 2994 |
| 280 | Ga0207702_10428784 | 3300026078 | Bacteria | 1280 |
| 281 | Ga0207641_10000012 | 3300026088 | Bacteria | 375486 |
| 282 | Ga0207641_10020343 | 3300026088 | Bacteria | 5450 |
| 283 | Ga0207641_10028888 | 3300026088 | Bacteria | 4583 |
| 284 | Ga0207641_10074873 | 3300026088 | Bacteria | 2922 |
| 285 | Ga0207641_10143210 | 3300026088 | Bacteria | 2159 |
| 286 | Ga0207641_10192384 | 3300026088 | Bacteria | 1876 |
| 287 | Ga0207676_10000179 | 3300026095 | Bacteria | 55697 |
| 288 | Ga0207676_10000716 | 3300026095 | Bacteria | 26001 |
| 289 | Ga0207676_10002829 | 3300026095 | Bacteria | 12349 |
| 290 | Ga0207676_10200930 | 3300026095 | Bacteria | 1761 |
| 291 | Ga0207676_10469426 | 3300026095 | Bacteria | 1190 |
| 292 | Ga0207674_10153517 | 3300026116 | Bacteria | 2259 |
| 293 | Ga0207674_10943839 | 3300026116 | Bacteria | 831 |
| 294 | Ga0207675_100016217 | 3300026118 | Bacteria | 6955 |
| 295 | Ga0207675_100095867 | 3300026118 | Bacteria | 2792 |
| 296 | Ga0207675_100661465 | 3300026118 | Bacteria | 1051 |
| 297 | Ga0207698_10714161 | 3300026142 | Bacteria | 998 |
| 298 | Ga0207698_10838715 | 3300026142 | Bacteria | 923 |
| 299 | Ga0209981_1000636 | 3300027378 | Bacteria | 4418 |
| 300 | Ga0209999_1004727 | 3300027543 | Bacteria | 2447 |
| 301 | Ga0209983_1005703 | 3300027665 | Bacteria | 2568 |
| 302 | Ga0209813_10061786 | 3300027866 | Bacteria | 1197 |
| 303 | Ga0268266_10000064 | 3300028379 | Bacteria | 249533 |
| 304 | Ga0268266_10000792 | 3300028379 | Bacteria | 42146 |
| 305 | Ga0268266_10038612 | 3300028379 | Bacteria | 4065 |
| 306 | Ga0268266_10062910 | 3300028379 | Bacteria | 3203 |
| 307 | Ga0268266_10285797 | 3300028379 | Bacteria | 1535 |
| 308 | Ga0268266_10529634 | 3300028379 | Bacteria | 1127 |
| 309 | Ga0268265_10001998 | 3300028380 | Bacteria | 16117 |
| 310 | Ga0268265_10002126 | 3300028380 | Bacteria | 15366 |
| 311 | Ga0268265_10029963 | 3300028380 | Bacteria | 3915 |
| 312 | Ga0268265_10703683 | 3300028380 | Bacteria | 976 |
| 313 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 314 | Ga0268264_10000059 | 3300028381 | Bacteria | 306927 |
| 315 | Ga0268264_10115851 | 3300028381 | Bacteria | 2355 |
| 316 | Ga0265318_10180781 | 3300028577 | Bacteria | 772 |
| 317 | Ga0307517_10000497 | 3300028786 | Bacteria | 67390 |
| 318 | Ga0307517_10108076 | 3300028786 | Bacteria | 2138 |
| 319 | Ga0307515_10050621 | 3300028794 | Bacteria | 6215 |
| 320 | Ga0265338_10010137 | 3300028800 | Bacteria | 11117 |
| 321 | Ga0307511_10038070 | 3300030521 | Bacteria | 4139 |
| 322 | Ga0265327_10001180 | 3300031251 | Bacteria | 35383 |
| 323 | Ga0265327_10268247 | 3300031251 | Bacteria | 757 |
| 324 | Ga0307513_10000448 | 3300031456 | Bacteria | 59427 |
| 325 | Ga0307513_10002007 | 3300031456 | Bacteria | 28699 |
| 326 | Ga0307513_10004437 | 3300031456 | Bacteria | 18736 |
| 327 | Ga0307513_10005088 | 3300031456 | Bacteria | 17402 |
| 328 | Ga0307513_10901491 | 3300031456 | Bacteria | 592 |
| 329 | Ga0307508_10738071 | 3300031616 | Bacteria | 597 |
| 330 | Ga0265314_10105552 | 3300031711 | Bacteria | 1801 |
| 331 | Ga0307516_10000004 | 3300031730 | Bacteria | 367451 |
| 332 | Ga0307407_10136819 | 3300031903 | Bacteria | 1575 |
| 333 | Ga0307409_100528901 | 3300031995 | Bacteria | 1153 |
| 334 | Ga0307416_101235706 | 3300032002 | Bacteria | 853 |
| 335 | Ga0307414_10132552 | 3300032004 | Bacteria | 1937 |
| 336 | Ga0307411_10105354 | 3300032005 | Bacteria | 2005 |
| 337 | Ga0307411_10180674 | 3300032005 | Bacteria | 1601 |
| 338 | Ga0307510_10011693 | 3300033180 | Bacteria | 10421 |
| 339 | Ga0307510_10084254 | 3300033180 | Bacteria | 3063 |
| 340 | Ga0373943_0375079 | 3300035170 | Bacteria | 818 |
| 341 | Ga0373935_1162688 | 3300035692 | Bacteria | 575 |
| 342 | Ga0373927_0000526 | 3300035695 | Bacteria | 29046 |
| 343 | Ga0373925_0000061 | 3300037068 | Bacteria | 117783 |
| 344 | Ga0395899_0055404 | 3300037312 | Bacteria | 2933 |
| 345 | Ga0395899_0116012 | 3300037312 | Bacteria | 1921 |
| 346 | Ga0395900_0109974 | 3300037418 | Bacteria | 2831 |
| 347 | Ga0395900_0167427 | 3300037418 | Bacteria | 2239 |
| 348 | Ga0395900_0205994 | 3300037418 | Bacteria | 1988 |
| 349 | Ga0395900_0531966 | 3300037418 | Bacteria | 1122 |
| 350 | Ga0395900_0586300 | 3300037418 | Bacteria | 1056 |
| 351 | Ga0395900_0954187 | 3300037418 | Bacteria | 779 |
| 352 | Ga0395898_0016546 | 3300037466 | Bacteria | 7542 |
| 353 | Ga0395898_0126913 | 3300037466 | Bacteria | 2444 |
| 354 | Ga0395898_0174058 | 3300037466 | Bacteria | 2057 |
| 355 | Ga0395898_1663451 | 3300037466 | Bacteria | 562 |
| 356 | Ga0395905_0025239 | 3300037471 | Bacteria | 5605 |
| 357 | Ga0395905_0034223 | 3300037471 | Bacteria | 4771 |
| 358 | Ga0395905_0093793 | 3300037471 | Bacteria | 2815 |
| 359 | Ga0395905_0106788 | 3300037471 | Bacteria | 2629 |
| 360 | Ga0395905_0169966 | 3300037471 | Bacteria | 2048 |
| 361 | Ga0395905_0997886 | 3300037471 | Bacteria | 740 |
| 362 | Ga0395905_1246178 | 3300037471 | Bacteria | 647 |
| 363 | Ga0395901_0046843 | 3300038443 | Bacteria | 4492 |
| 364 | Ga0395901_0064787 | 3300038443 | Bacteria | 3804 |
| 365 | Ga0395901_0105946 | 3300038443 | Bacteria | 2951 |
| 366 | Ga0395901_0826394 | 3300038443 | Bacteria | 913 |
| 367 | Ga0436365_1676837 | 3300039437 | Bacteria | 2995 |
| 368 | Ga0436363_0474361 | 3300039450 | Bacteria | 1496 |
| 369 | Ga0451793_0195077 | 3300041452 | Bacteria | 722 |
| 370 | Ga0451849_0975671 | 3300041505 | Bacteria | 572 |
| 371 | Ga0439441_178905 | 3300042001 | Bacteria | 509 |
| 372 | Ga0450890_010669 | 3300042127 | Bacteria | 1183 |
| 373 | Ga0439435_0028353 | 3300042436 | Bacteria | 1504 |
| 374 | Ga0439459_0039880 | 3300042438 | Bacteria | 994 |
| 375 | Ga0466965_0074640 | 3300044683 | Bacteria | 1709 |
| 376 | Ga0466963_0437910 | 3300044694 | Bacteria | 922 |
| 377 | Ga0466957_0690272 | 3300044842 | Bacteria | 720 |
| 378 | Ga0466957_0884232 | 3300044842 | Bacteria | 638 |
| 379 | Ga0466960_0272354 | 3300044901 | Bacteria | 946 |
| 380 | Ga0495627_000443 | 3300046453 | Bacteria | 36101 |
| 381 | Ga0495590_0001954 | 3300046457 | Bacteria | 8715 |
| 382 | Ga0495629_0018656 | 3300046459 | Bacteria | 4959 |
| 383 | Ga0495638_0000701 | 3300046460 | Bacteria | 36250 |
| 384 | Ga0495638_0001931 | 3300046460 | Bacteria | 17833 |
| 385 | Ga0495638_0002456 | 3300046460 | Bacteria | 15116 |
| 386 | Ga0495638_0002536 | 3300046460 | Bacteria | 14843 |
| 387 | Ga0495638_0015888 | 3300046460 | Bacteria | 5044 |
| 388 | Ga0495638_0119425 | 3300046460 | Bacteria | 1559 |
| 389 | Ga0495650_0000017 | 3300046471 | Bacteria | 542552 |
| 390 | Ga0495607_0036504 | 3300046501 | Bacteria | 2960 |
| 391 | Ga0495583_0000020 | 3300046506 | Bacteria | 296185 |
| 392 | Ga0495606_0007343 | 3300046507 | Bacteria | 9898 |
| 393 | Ga0495606_0012983 | 3300046507 | Bacteria | 6626 |
| 394 | Ga0495610_0000535 | 3300046512 | Bacteria | 38235 |
| 395 | Ga0495610_0006241 | 3300046512 | Bacteria | 8263 |
| 396 | Ga0495610_0023019 | 3300046512 | Bacteria | 3394 |
| 397 | Ga0495616_0000375 | 3300046513 | Bacteria | 34773 |
| 398 | Ga0495616_0189287 | 3300046513 | Bacteria | 910 |
| 399 | Ga0495616_0215052 | 3300046513 | Bacteria | 839 |
| 400 | Ga0495620_0016467 | 3300046515 | Bacteria | 3708 |
| 401 | Ga0495631_0009992 | 3300046518 | Bacteria | 4716 |
| 402 | Ga0495631_0128938 | 3300046518 | Bacteria | 1087 |
| 403 | Ga0495632_0002115 | 3300046519 | Bacteria | 15508 |
| 404 | Ga0495632_0143785 | 3300046519 | Bacteria | 1105 |
| 405 | Ga0495637_0005524 | 3300046520 | Bacteria | 6426 |
| 406 | Ga0495637_0019459 | 3300046520 | Bacteria | 3138 |
| 407 | Ga0495643_0059246 | 3300046522 | Bacteria | 2036 |
| 408 | Ga0495648_0006618 | 3300046524 | Bacteria | 9397 |
| 409 | Ga0495648_0092740 | 3300046524 | Bacteria | 1686 |
| 410 | Ga0495648_0319462 | 3300046524 | Bacteria | 720 |
| 411 | Ga0495648_0386109 | 3300046524 | Bacteria | 630 |
| 412 | Ga0495663_0023177 | 3300046525 | Bacteria | 1797 |
| 413 | Ga0495642_0001981 | 3300046528 | Bacteria | 8590 |
| 414 | Ga0495652_0577262 | 3300046529 | Bacteria | 770 |
| 415 | Ga0495654_0000750 | 3300046530 | Bacteria | 25116 |
| 416 | Ga0495587_0380999 | 3300046536 | Bacteria | 785 |
| 417 | Ga0495597_0001428 | 3300046542 | Bacteria | 17175 |
| 418 | Ga0495597_0042638 | 3300046542 | Bacteria | 2023 |
| 419 | Ga0495645_0024641 | 3300046543 | Bacteria | 4366 |
| 420 | Ga0495668_0000092 | 3300046616 | Bacteria | 142835 |
| 421 | Ga0495668_0003409 | 3300046616 | Bacteria | 11939 |
| 422 | Ga0495668_0038062 | 3300046616 | Bacteria | 2689 |
| 423 | Ga0495668_0041050 | 3300046616 | Bacteria | 2579 |
| 424 | Ga0495668_0122382 | 3300046616 | Bacteria | 1423 |
| 425 | Ga0495625_0000865 | 3300046660 | Bacteria | 41188 |
| 426 | Ga0495625_0004098 | 3300046660 | Bacteria | 13905 |
| 427 | Ga0495625_0006433 | 3300046660 | Bacteria | 10457 |
| 428 | Ga0495625_0016645 | 3300046660 | Bacteria | 5777 |
| 429 | Ga0495625_0020347 | 3300046660 | Bacteria | 5126 |
| 430 | Ga0495625_0025295 | 3300046660 | Bacteria | 4503 |
| 431 | Ga0495625_0031934 | 3300046660 | Bacteria | 3911 |
| 432 | Ga0495625_0064135 | 3300046660 | Bacteria | 2592 |
| 433 | Ga0495625_0096626 | 3300046660 | Bacteria | 2035 |
| 434 | Ga0495625_0133394 | 3300046660 | Bacteria | 1681 |
| 435 | Ga0495625_0163407 | 3300046660 | Bacteria | 1490 |
| 436 | Ga0495659_0184561 | 3300046664 | Bacteria | 851 |
| 437 | Ga0495669_0000003 | 3300046684 | Bacteria | 267741 |
| 438 | Ga0495669_0010381 | 3300046684 | Bacteria | 3934 |
| 439 | Ga0495669_0061444 | 3300046684 | Bacteria | 1700 |
| 440 | Ga0495670_0129809 | 3300046691 | Bacteria | 1313 |
| 441 | Ga0495670_0178051 | 3300046691 | Bacteria | 1122 |
| 442 | Ga0495649_0492864 | 3300046694 | Bacteria | 610 |
| 443 | Ga0495589_0007451 | 3300046794 | Bacteria | 5734 |
| 444 | Ga0495672_0001016 | 3300047320 | Bacteria | 28910 |
| 445 | Ga0495672_0024965 | 3300047320 | Bacteria | 3837 |
| 446 | Ga0495672_0034544 | 3300047320 | Bacteria | 3123 |
| 447 | Ga0495683_0103166 | 3300047323 | Bacteria | 1369 |
| 448 | Ga0495677_0103324 | 3300047445 | Bacteria | 1080 |
| 449 | Ga0495679_016776 | 3300047446 | Bacteria | 2640 |
| 450 | Ga0495673_0000078 | 3300047469 | Bacteria | 203066 |
| 451 | Ga0495673_0000401 | 3300047469 | Bacteria | 50743 |
| 452 | Ga0495673_0004040 | 3300047469 | Bacteria | 9351 |
| 453 | Ga0495681_0037146 | 3300047470 | Bacteria | 2403 |
| 454 | Ga0495686_0000259 | 3300047472 | Bacteria | 94672 |
| 455 | Ga0495686_0022623 | 3300047472 | Bacteria | 4159 |
| 456 | Ga0495686_0104072 | 3300047472 | Bacteria | 1709 |
| 457 | Ga0495686_0400775 | 3300047472 | Bacteria | 736 |
| 458 | Ga0495602_0442144 | 3300048088 | Bacteria | 919 |
| 459 | Ga0495615_0012594 | 3300048090 | Bacteria | 1747 |
| 460 | Ga0496100_0127129 | 3300048903 | Bacteria | 1790 |
| 461 | Ga0496101_0033852 | 3300048904 | Bacteria | 3607 |
| 462 | Ga0496101_0091493 | 3300048904 | Bacteria | 2264 |
| 463 | Ga0496102_0030313 | 3300048905 | Bacteria | 4841 |
| 464 | Ga0496102_0072338 | 3300048905 | Bacteria | 3168 |
| 465 | Ga0496102_0602355 | 3300048905 | Bacteria | 1022 |
| 466 | Ga0496102_0622804 | 3300048905 | Bacteria | 1002 |
| 467 | Ga0496103_0277331 | 3300048906 | Bacteria | 1078 |
| 468 | Ga0496106_0003278 | 3300048909 | Bacteria | 12096 |
| 469 | Ga0496107_0000851 | 3300048910 | Bacteria | 17893 |
| 470 | Ga0496107_0014019 | 3300048910 | Bacteria | 5611 |
| 471 | Ga0496107_0336502 | 3300048910 | Bacteria | 1123 |
| 472 | Ga0496108_0063699 | 3300048911 | Bacteria | 3105 |
| 473 | Ga0496109_0002851 | 3300048912 | Bacteria | 14465 |
| 474 | Ga0496110_0281583 | 3300048913 | Bacteria | 1514 |
| 475 | Ga0496110_0624083 | 3300048913 | Bacteria | 977 |
| 476 | Ga0496112_0339576 | 3300048915 | Bacteria | 1445 |
| 477 | Ga0496112_1083391 | 3300048915 | Bacteria | 720 |
| 478 | Ga0496115_0002173 | 3300048918 | Bacteria | 14034 |
| 479 | Ga0496115_0002548 | 3300048918 | Bacteria | 13093 |
| 480 | Ga0496115_0007602 | 3300048918 | Bacteria | 7983 |
| 481 | Ga0496115_0038843 | 3300048918 | Bacteria | 3780 |
| 482 | Ga0496116_0045237 | 3300048919 | Bacteria | 2982 |
| 483 | Ga0496117_0005253 | 3300048920 | Bacteria | 13741 |
| 484 | Ga0496118_0005535 | 3300048921 | Bacteria | 14332 |
| 485 | Ga0496119_0139078 | 3300048922 | Bacteria | 1313 |
| 486 | Ga0496120_0217912 | 3300048923 | Bacteria | 914 |
| 487 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 488 | Ga0496121_0001613 | 3300048924 | Bacteria | 37440 |
| 489 | Ga0496123_0197473 | 3300048926 | Bacteria | 1035 |
| 490 | Ga0496124_0033194 | 3300048927 | Bacteria | 4543 |
| 491 | Ga0496125_0019090 | 3300048928 | Bacteria | 6484 |
| 492 | Ga0496126_0005746 | 3300048929 | Bacteria | 14039 |
| 493 | Ga0496126_0167670 | 3300048929 | Bacteria | 1873 |
| 494 | Ga0495678_001694 | 3300049459 | Bacteria | 16655 |
| 495 | Ga0495682_0191850 | 3300049460 | Bacteria | 725 |
| 496 | Ga0501033_0008404 | 3300049570 | Bacteria | 7996 |
| 497 | Ga0501037_0059766 | 3300049573 | Bacteria | 2780 |
| 498 | Ga0501037_0065489 | 3300049573 | Bacteria | 2647 |
| 499 | Ga0501047_0020196 | 3300049581 | Bacteria | 6396 |
| 500 | Ga0501047_0095613 | 3300049581 | Bacteria | 2850 |
| 501 | Ga0501047_0113667 | 3300049581 | Bacteria | 2590 |
| 502 | Ga0501047_0216722 | 3300049581 | Bacteria | 1771 |
| 503 | Ga0501047_0502390 | 3300049581 | Bacteria | 1039 |
| 504 | Ga0501047_0883778 | 3300049581 | Bacteria | 707 |
| 505 | Ga0501047_1030469 | 3300049581 | Bacteria | 636 |
| 506 | Ga0501067_0021611 | 3300049583 | Bacteria | 3561 |
| 507 | Ga0501072_0055826 | 3300049588 | Bacteria | 3112 |
| 508 | Ga0501073_0007054 | 3300049589 | Bacteria | 8370 |
| 509 | Ga0501074_0379791 | 3300049590 | Bacteria | 1002 |
| 510 | Ga0501238_003056 | 3300049671 | Bacteria | 2043 |
| 511 | Ga0501251_079925 | 3300049681 | Bacteria | 572 |
| 512 | Ga0501257_002177 | 3300049686 | Bacteria | 4106 |
| 513 | Ga0501080_0012907 | 3300049742 | Bacteria | 7667 |
| 514 | Ga0501080_0786091 | 3300049742 | Bacteria | 835 |
| 515 | Ga0501083_0014643 | 3300049744 | Bacteria | 5482 |
| 516 | Ga0501241_026953 | 3300049758 | Bacteria | 1074 |
| 517 | Ga0501035_0262587 | 3300049822 | Bacteria | 1463 |
| 518 | Ga0501044_0000504 | 3300049823 | Bacteria | 47543 |
| 519 | Ga0501044_0010085 | 3300049823 | Bacteria | 10265 |
| 520 | Ga0501044_0383176 | 3300049823 | Bacteria | 1321 |
| 521 | Ga0501044_0565992 | 3300049823 | Bacteria | 1032 |
| 522 | nmdc:mga03683_90583_c1 | 3300050489 | Bacteria | 1333 |
| 523 | nmdc:mga03n38_380141_c1 | 3300050490 | Bacteria | 774 |
| 524 | nmdc:mga03n38_40649_c1 | 3300050490 | Bacteria | 2022 |
| 525 | nmdc:mga0k408_10134_c1 | 3300050493 | Bacteria | 5092 |
| 526 | nmdc:mga0k408_125345_c1 | 3300050493 | Bacteria | 1523 |
| 527 | nmdc:mga04h51_73822_c1 | 3300050495 | Bacteria | 1197 |
| 528 | nmdc:mga07m45_14110_c1 | 3300050496 | Bacteria | 4251 |
| 529 | nmdc:mga07m45_184801_c1 | 3300050496 | Bacteria | 1212 |
| 530 | nmdc:mga07m45_232853_c1 | 3300050496 | Bacteria | 1072 |
| 531 | nmdc:mga07m45_79587_c1 | 3300050496 | Bacteria | 1871 |
| 532 | nmdc:mga0sz30_29728_c1 | 3300050516 | Bacteria | 2254 |
| 533 | Ga0500635_0000228 | 3300053080 | Bacteria | 24908 |
| 534 | Ga0500578_0000420 | 3300053086 | Bacteria | 51926 |
| 535 | Ga0500643_005954 | 3300053087 | Bacteria | 5168 |
| 536 | Ga0500643_011284 | 3300053087 | Bacteria | 3267 |
| 537 | Ga0500643_039219 | 3300053087 | Bacteria | 1400 |
| 538 | Ga0500644_0001153 | 3300053088 | Bacteria | 7664 |
| 539 | Ga0500646_0003762 | 3300053090 | Bacteria | 3881 |
| 540 | Ga0500646_0008178 | 3300053090 | Bacteria | 2675 |
| 541 | Ga0500583_0034722 | 3300053092 | Bacteria | 2244 |
| 542 | Ga0500566_0074713 | 3300053094 | Bacteria | 1897 |
| 543 | Ga0500641_0001139 | 3300053096 | Bacteria | 9447 |
| 544 | Ga0500641_0015768 | 3300053096 | Bacteria | 2809 |
| 545 | Ga0500554_001349 | 3300053102 | Bacteria | 4746 |
| 546 | Ga0500556_0011034 | 3300053104 | Bacteria | 2666 |
| 547 | Ga0500556_0011180 | 3300053104 | Bacteria | 2653 |
| 548 | Ga0500556_0143772 | 3300053104 | Bacteria | 938 |
| 549 | Ga0500556_0174822 | 3300053104 | Bacteria | 848 |
| 550 | Ga0500562_013138 | 3300053108 | Bacteria | 2110 |
| 551 | Ga0500562_025024 | 3300053108 | Bacteria | 1561 |
| 552 | Ga0500569_011335 | 3300053109 | Bacteria | 2126 |
| 553 | Ga0500572_002871 | 3300053111 | Bacteria | 4048 |
| 554 | Ga0500594_0000212 | 3300053118 | Bacteria | 14226 |
| 555 | Ga0500594_0031058 | 3300053118 | Bacteria | 1407 |
| 556 | Ga0500595_002687 | 3300053119 | Bacteria | 8632 |
| 557 | Ga0500595_009124 | 3300053119 | Bacteria | 4020 |
| 558 | Ga0500597_256103 | 3300053120 | Bacteria | 714 |
| 559 | Ga0500608_000059 | 3300053122 | Bacteria | 48253 |
| 560 | Ga0500608_032146 | 3300053122 | Bacteria | 2492 |
| 561 | Ga0500614_003176 | 3300053123 | Bacteria | 3565 |
| 562 | Ga0500614_004047 | 3300053123 | Bacteria | 3121 |
| 563 | Ga0500618_002667 | 3300053125 | Bacteria | 6549 |
| 564 | Ga0500642_0341253 | 3300053130 | Bacteria | 667 |
| 565 | Ga0500658_0004419 | 3300053134 | Bacteria | 5262 |
| 566 | Ga0500658_0072909 | 3300053134 | Bacteria | 1453 |
| 567 | Ga0500559_0000077 | 3300053136 | Bacteria | 76287 |
| 568 | Ga0500559_0000111 | 3300053136 | Bacteria | 64064 |
| 569 | Ga0500559_0020710 | 3300053136 | Bacteria | 2782 |
| 570 | Ga0500559_0021293 | 3300053136 | Bacteria | 2747 |
| 571 | Ga0500559_0021419 | 3300053136 | Bacteria | 2739 |
| 572 | Ga0500564_000021 | 3300053138 | Bacteria | 47765 |
| 573 | Ga0500577_0001426 | 3300053142 | Bacteria | 6118 |
| 574 | Ga0500588_0061576 | 3300053146 | Bacteria | 1204 |
| 575 | Ga0500590_013948 | 3300053148 | Bacteria | 4134 |
| 576 | Ga0500604_0338976 | 3300053151 | Bacteria | 522 |
| 577 | Ga0500616_0015967 | 3300053153 | Bacteria | 4284 |
| 578 | Ga0500616_0018780 | 3300053153 | Bacteria | 3905 |
| 579 | Ga0500616_0020742 | 3300053153 | Bacteria | 3690 |
| 580 | Ga0500616_0047953 | 3300053153 | Bacteria | 2266 |
| 581 | Ga0500616_0051933 | 3300053153 | Bacteria | 2158 |
| 582 | Ga0500622_0000526 | 3300053156 | Bacteria | 35500 |
| 583 | Ga0500622_0008486 | 3300053156 | Bacteria | 5743 |
| 584 | Ga0500622_0014867 | 3300053156 | Bacteria | 4173 |
| 585 | Ga0500622_0023470 | 3300053156 | Bacteria | 3267 |
| 586 | Ga0500622_0058402 | 3300053156 | Bacteria | 1971 |
| 587 | Ga0500627_0022301 | 3300053158 | Bacteria | 2566 |
| 588 | Ga0500638_088613 | 3300053162 | Bacteria | 1460 |
| 589 | Ga0500639_179950 | 3300053163 | Bacteria | 936 |
| 590 | Ga0500636_0028477 | 3300053177 | Bacteria | 3299 |
| 591 | Ga0500636_0116303 | 3300053177 | Bacteria | 1505 |
| 592 | Ga0500636_0199075 | 3300053177 | Bacteria | 1061 |
| 593 | Ga0500637_0023362 | 3300053178 | Bacteria | 3380 |
| 594 | Ga0500637_0068739 | 3300053178 | Bacteria | 2035 |
| 595 | Ga0500576_104458 | 3300053725 | Bacteria | 1149 |
| 596 | Ga0500611_001826 | 3300053727 | Bacteria | 2433 |
| 597 | Ga0500625_093384 | 3300053729 | Bacteria | 1281 |
| 598 | Ga0500645_000649 | 3300053730 | Bacteria | 21995 |
| 599 | Ga0500645_002967 | 3300053730 | Bacteria | 7199 |
| 600 | Ga0500645_003640 | 3300053730 | Bacteria | 6166 |
| 601 | Ga0500645_004869 | 3300053730 | Bacteria | 5058 |
| 602 | Ga0500645_039749 | 3300053730 | Bacteria | 1393 |
| 603 | Ga0500645_039982 | 3300053730 | Bacteria | 1389 |
| 604 | Ga0500645_074393 | 3300053730 | Bacteria | 973 |
| 605 | Ga0500609_000612 | 3300053731 | Bacteria | 5437 |
| 606 | Ga0500552_057734 | 3300053733 | Bacteria | 672 |
| 607 | Ga0500596_000416 | 3300053735 | Bacteria | 7824 |
| 608 | Ga0500661_048586 | 3300055283 | Bacteria | 756 |
| 609 | Ga0500661_070376 | 3300055283 | Bacteria | 639 |
| 610 | Ga0501082_0051849 | 3300060353 | Bacteria | 3536 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053096 | Ga0500641_0001139 | Ga0500641_0001139_8441_8911 | 151 |
| 2 | 3300053104 | Ga0500556_0011034 | Ga0500556_0011034_539_1009 | 151 |
| 3 | 3300053104 | Ga0500556_0174822 | Ga0500556_0174822_200_670 | 151 |
| 4 | 3300053153 | Ga0500616_0018780 | Ga0500616_0018780_2210_2680 | 151 |
| 5 | 3300053153 | Ga0500616_0020742 | Ga0500616_0020742_1508_1978 | 151 |
| 6 | 3300053730 | Ga0500645_000649 | Ga0500645_000649_9321_9791 | 151 |
| 7 | 3300053730 | Ga0500645_004869 | Ga0500645_004869_2993_3463 | 151 |
| 8 | 3300044842 | Ga0466957_0884232 | Ga0466957_0884232_87_563 | 152 |
| 9 | 3300013306 | Ga0163162_10680000 | Ga0163162_106800002 | 153 |
| 10 | 3300005444 | Ga0070694_100535307 | Ga0070694_1005353072 | 154 |
| 11 | iso_pu_bacteria | 2643221661 | 2644342535 | 154 |
| 12 | iso_pu_bacteria | 2643221666 | 2644365835 | 154 |
| 13 | 3300005563 | Ga0068855_100815869 | Ga0068855_1008158692 | 155 |
| 14 | 3300009176 | Ga0105242_10514307 | Ga0105242_105143072 | 155 |
| 15 | 3300013100 | Ga0157373_10001429 | Ga0157373_1000142916 | 155 |
| 16 | 3300013307 | Ga0157372_11992119 | Ga0157372_119921192 | 155 |
| 17 | 3300014969 | Ga0157376_10815033 | Ga0157376_108150332 | 155 |
| 18 | 3300025949 | Ga0207667_11724275 | Ga0207667_117242752 | 155 |
| 19 | 3300028379 | Ga0268266_10285797 | Ga0268266_102857972 | 155 |
| 20 | 3300028577 | Ga0265318_10180781 | Ga0265318_101807812 | 155 |
| 21 | 3300028800 | Ga0265338_10010137 | Ga0265338_100101374 | 155 |
| 22 | 3300031251 | Ga0265327_10001180 | Ga0265327_100011806 | 155 |
| 23 | 3300031251 | Ga0265327_10268247 | Ga0265327_102682472 | 155 |
| 24 | 3300031711 | Ga0265314_10105552 | Ga0265314_101055522 | 155 |
| 25 | 3300033180 | Ga0307510_10084254 | Ga0307510_100842543 | 155 |
| 26 | 3300037418 | Ga0395900_0167427 | Ga0395900_0167427_1743_2213 | 155 |
| 27 | 3300037418 | Ga0395900_0205994 | Ga0395900_0205994_1411_1881 | 155 |
| 28 | 3300037471 | Ga0395905_0034223 | Ga0395905_0034223_969_1439 | 155 |
| 29 | 3300038443 | Ga0395901_0064787 | Ga0395901_0064787_162_632 | 155 |
| 30 | 3300046536 | Ga0495587_0380999 | Ga0495587_0380999_279_749 | 155 |
| 31 | 3300049823 | Ga0501044_0383176 | Ga0501044_0383176_513_983 | 155 |
| 32 | 3300053090 | Ga0500646_0008178 | Ga0500646_0008178_1387_1857 | 155 |
| 33 | 3300053111 | Ga0500572_002871 | Ga0500572_002871_785_1255 | 155 |
| 34 | 3300053119 | Ga0500595_009124 | Ga0500595_009124_633_1103 | 155 |
| 35 | 3300053156 | Ga0500622_0008486 | Ga0500622_0008486_1335_1805 | 155 |
| 36 | 3300003791 | Ga0055530_10000685 | Ga0055530_100006854 | 156 |
| 37 | 3300003794 | Ga0055531_10001281 | Ga0055531_1000128117 | 156 |
| 38 | 3300003794 | Ga0055531_10002834 | Ga0055531_100028347 | 156 |
| 39 | 3300003794 | Ga0055531_10075680 | Ga0055531_100756802 | 156 |
| 40 | 3300005262 | Ga0065165_1000552 | Ga0065165_100055223 | 156 |
| 41 | 3300005262 | Ga0065165_1012666 | Ga0065165_10126663 | 156 |
| 42 | 3300005327 | Ga0070658_10820665 | Ga0070658_108206652 | 156 |
| 43 | 3300005331 | Ga0070670_100000037 | Ga0070670_10000003752 | 156 |
| 44 | 3300005335 | Ga0070666_10049818 | Ga0070666_100498184 | 156 |
| 45 | 3300005344 | Ga0070661_100760126 | Ga0070661_1007601261 | 156 |
| 46 | 3300005347 | Ga0070668_100000489 | Ga0070668_10000048912 | 156 |
| 47 | 3300005347 | Ga0070668_100000745 | Ga0070668_10000074510 | 156 |
| 48 | 3300005355 | Ga0070671_100779205 | Ga0070671_1007792052 | 156 |
| 49 | 3300005367 | Ga0070667_100000083 | Ga0070667_10000008352 | 156 |
| 50 | 3300005367 | Ga0070667_100046160 | Ga0070667_1000461604 | 156 |
| 51 | 3300005455 | Ga0070663_100303780 | Ga0070663_1003037802 | 156 |
| 52 | 3300005458 | Ga0070681_10112147 | Ga0070681_101121472 | 156 |
| 53 | 3300005530 | Ga0070679_101320624 | Ga0070679_1013206241 | 156 |
| 54 | 3300005539 | Ga0068853_101562841 | Ga0068853_1015628411 | 156 |
| 55 | 3300005548 | Ga0070665_100000483 | Ga0070665_10000048343 | 156 |
| 56 | 3300005548 | Ga0070665_100001929 | Ga0070665_1000019299 | 156 |
| 57 | 3300005563 | Ga0068855_100194919 | Ga0068855_1001949192 | 156 |
| 58 | 3300005563 | Ga0068855_100526393 | Ga0068855_1005263932 | 156 |
| 59 | 3300005577 | Ga0068857_101007591 | Ga0068857_1010075912 | 156 |
| 60 | 3300005616 | Ga0068852_100688351 | Ga0068852_1006883512 | 156 |
| 61 | 3300005618 | Ga0068864_100000116 | Ga0068864_10000011614 | 156 |
| 62 | 3300005841 | Ga0068863_100001697 | Ga0068863_1000016972 | 156 |
| 63 | 3300005842 | Ga0068858_100003203 | Ga0068858_1000032036 | 156 |
| 64 | 3300005843 | Ga0068860_100000348 | Ga0068860_1000003488 | 156 |
| 65 | 3300005843 | Ga0068860_100093290 | Ga0068860_1000932904 | 156 |
| 66 | 3300005844 | Ga0068862_100000235 | Ga0068862_10000023513 | 156 |
| 67 | 3300005844 | Ga0068862_100593761 | Ga0068862_1005937611 | 156 |
| 68 | 3300006028 | Ga0070717_10061730 | Ga0070717_100617303 | 156 |
| 69 | 3300006177 | Ga0075362_10014998 | Ga0075362_100149982 | 156 |
| 70 | 3300009093 | Ga0105240_10013651 | Ga0105240_100136517 | 156 |
| 71 | 3300009093 | Ga0105240_10018121 | Ga0105240_100181212 | 156 |
| 72 | 3300009093 | Ga0105240_10586305 | Ga0105240_105863052 | 156 |
| 73 | 3300009177 | Ga0105248_10000438 | Ga0105248_1000043836 | 156 |
| 74 | 3300009177 | Ga0105248_10047938 | Ga0105248_100479383 | 156 |
| 75 | 3300009177 | Ga0105248_11859839 | Ga0105248_118598392 | 156 |
| 76 | 3300009545 | Ga0105237_10940924 | Ga0105237_109409241 | 156 |
| 77 | 3300009551 | Ga0105238_10079328 | Ga0105238_100793282 | 156 |
| 78 | 3300009553 | Ga0105249_10003334 | Ga0105249_100033345 | 156 |
| 79 | 3300010375 | Ga0105239_10192236 | Ga0105239_101922362 | 156 |
| 80 | 3300010375 | Ga0105239_10262352 | Ga0105239_102623522 | 156 |
| 81 | 3300010375 | Ga0105239_11736346 | Ga0105239_117363462 | 156 |
| 82 | 3300013100 | Ga0157373_10004486 | Ga0157373_100044869 | 156 |
| 83 | 3300013104 | Ga0157370_10115622 | Ga0157370_101156223 | 156 |
| 84 | 3300013105 | Ga0157369_10123007 | Ga0157369_101230072 | 156 |
| 85 | 3300013307 | Ga0157372_10067297 | Ga0157372_100672973 | 156 |
| 86 | 3300014325 | Ga0163163_10255190 | Ga0163163_102551903 | 156 |
| 87 | 3300014325 | Ga0163163_10709862 | Ga0163163_107098622 | 156 |
| 88 | 3300014325 | Ga0163163_10798594 | Ga0163163_107985942 | 156 |
| 89 | 3300014325 | Ga0163163_10831066 | Ga0163163_108310661 | 156 |
| 90 | 3300014968 | Ga0157379_10003351 | Ga0157379_100033514 | 156 |
| 91 | 3300025250 | Ga0209026_1000864 | Ga0209026_10008646 | 156 |
| 92 | 3300025298 | Ga0209050_1000101 | Ga0209050_1000101198 | 156 |
| 93 | 3300025304 | Ga0209257_1000221 | Ga0209257_10002214 | 156 |
| 94 | 3300025304 | Ga0209257_1015174 | Ga0209257_10151743 | 156 |
| 95 | 3300025909 | Ga0207705_10054342 | Ga0207705_100543424 | 156 |
| 96 | 3300025909 | Ga0207705_10518484 | Ga0207705_105184842 | 156 |
| 97 | 3300025909 | Ga0207705_10651536 | Ga0207705_106515362 | 156 |
| 98 | 3300025911 | Ga0207654_10401657 | Ga0207654_104016572 | 156 |
| 99 | 3300025913 | Ga0207695_10007605 | Ga0207695_100076057 | 156 |
| 100 | 3300025913 | Ga0207695_10686598 | Ga0207695_106865982 | 156 |
| 101 | 3300025914 | Ga0207671_11069794 | Ga0207671_110697942 | 156 |
| 102 | 3300025921 | Ga0207652_10417649 | Ga0207652_104176492 | 156 |
| 103 | 3300025921 | Ga0207652_11079446 | Ga0207652_110794462 | 156 |
| 104 | 3300025924 | Ga0207694_10043685 | Ga0207694_100436853 | 156 |
| 105 | 3300025924 | Ga0207694_10103724 | Ga0207694_101037243 | 156 |
| 106 | 3300025925 | Ga0207650_10000062 | Ga0207650_1000006238 | 156 |
| 107 | 3300025925 | Ga0207650_11292430 | Ga0207650_112924301 | 156 |
| 108 | 3300025935 | Ga0207709_10547950 | Ga0207709_105479502 | 156 |
| 109 | 3300025938 | Ga0207704_10006201 | Ga0207704_100062015 | 156 |
| 110 | 3300025938 | Ga0207704_11093831 | Ga0207704_110938312 | 156 |
| 111 | 3300025941 | Ga0207711_10000962 | Ga0207711_1000096221 | 156 |
| 112 | 3300025941 | Ga0207711_10152261 | Ga0207711_101522611 | 156 |
| 113 | 3300025949 | Ga0207667_10039889 | Ga0207667_100398893 | 156 |
| 114 | 3300025949 | Ga0207667_10526318 | Ga0207667_105263182 | 156 |
| 115 | 3300025949 | Ga0207667_10651059 | Ga0207667_106510592 | 156 |
| 116 | 3300025961 | Ga0207712_10038925 | Ga0207712_100389254 | 156 |
| 117 | 3300025972 | Ga0207668_10000028 | Ga0207668_1000002891 | 156 |
| 118 | 3300025972 | Ga0207668_10000130 | Ga0207668_1000013040 | 156 |
| 119 | 3300025981 | Ga0207640_10763102 | Ga0207640_107631022 | 156 |
| 120 | 3300025986 | Ga0207658_10005685 | Ga0207658_100056855 | 156 |
| 121 | 3300025986 | Ga0207658_10006804 | Ga0207658_100068044 | 156 |
| 122 | 3300026023 | Ga0207677_10531733 | Ga0207677_105317332 | 156 |
| 123 | 3300026035 | Ga0207703_10000843 | Ga0207703_1000084316 | 156 |
| 124 | 3300026041 | Ga0207639_10569721 | Ga0207639_105697212 | 156 |
| 125 | 3300026067 | Ga0207678_10070628 | Ga0207678_100706284 | 156 |
| 126 | 3300026088 | Ga0207641_10028888 | Ga0207641_100288882 | 156 |
| 127 | 3300026095 | Ga0207676_10000716 | Ga0207676_1000071613 | 156 |
| 128 | 3300026116 | Ga0207674_10943839 | Ga0207674_109438392 | 156 |
| 129 | 3300026142 | Ga0207698_10714161 | Ga0207698_107141612 | 156 |
| 130 | 3300026142 | Ga0207698_10838715 | Ga0207698_108387152 | 156 |
| 131 | 3300027378 | Ga0209981_1000636 | Ga0209981_10006363 | 156 |
| 132 | 3300027543 | Ga0209999_1004727 | Ga0209999_10047274 | 156 |
| 133 | 3300027665 | Ga0209983_1005703 | Ga0209983_10057033 | 156 |
| 134 | 3300028379 | Ga0268266_10000792 | Ga0268266_100007929 | 156 |
| 135 | 3300028379 | Ga0268266_10062910 | Ga0268266_100629102 | 156 |
| 136 | 3300028380 | Ga0268265_10001998 | Ga0268265_100019988 | 156 |
| 137 | 3300028380 | Ga0268265_10029963 | Ga0268265_100299633 | 156 |
| 138 | 3300028381 | Ga0268264_10000059 | Ga0268264_10000059257 | 156 |
| 139 | 3300028381 | Ga0268264_10115851 | Ga0268264_101158514 | 156 |
| 140 | 3300030521 | Ga0307511_10038070 | Ga0307511_100380702 | 156 |
| 141 | 3300031903 | Ga0307407_10136819 | Ga0307407_101368192 | 156 |
| 142 | 3300031995 | Ga0307409_100528901 | Ga0307409_1005289012 | 156 |
| 143 | 3300032002 | Ga0307416_101235706 | Ga0307416_1012357062 | 156 |
| 144 | 3300032004 | Ga0307414_10132552 | Ga0307414_101325522 | 156 |
| 145 | 3300032005 | Ga0307411_10105354 | Ga0307411_101053542 | 156 |
| 146 | 3300032005 | Ga0307411_10180674 | Ga0307411_101806742 | 156 |
| 147 | 3300035170 | Ga0373943_0375079 | Ga0373943_0375079_56_526 | 156 |
| 148 | 3300035692 | Ga0373935_1162688 | Ga0373935_1162688_94_564 | 156 |
| 149 | 3300035695 | Ga0373927_0000526 | Ga0373927_0000526_28088_28558 | 156 |
| 150 | 3300037068 | Ga0373925_0000061 | Ga0373925_0000061_28636_29106 | 156 |
| 151 | 3300037418 | Ga0395900_0954187 | Ga0395900_0954187_22_492 | 156 |
| 152 | 3300037466 | Ga0395898_1663451 | Ga0395898_1663451_74_544 | 156 |
| 153 | 3300037471 | Ga0395905_0106788 | Ga0395905_0106788_849_1319 | 156 |
| 154 | 3300037471 | Ga0395905_0997886 | Ga0395905_0997886_249_719 | 156 |
| 155 | 3300037471 | Ga0395905_1246178 | Ga0395905_1246178_93_563 | 156 |
| 156 | 3300039437 | Ga0436365_1676837 | Ga0436365_1676837_831_1301 | 156 |
| 157 | 3300042127 | Ga0450890_010669 | Ga0450890_010669_298_768 | 156 |
| 158 | 3300044694 | Ga0466963_0437910 | Ga0466963_0437910_38_508 | 156 |
| 159 | 3300044842 | Ga0466957_0690272 | Ga0466957_0690272_208_678 | 156 |
| 160 | 3300044901 | Ga0466960_0272354 | Ga0466960_0272354_397_867 | 156 |
| 161 | 3300046529 | Ga0495652_0577262 | Ga0495652_0577262_286_756 | 156 |
| 162 | 3300046543 | Ga0495645_0024641 | Ga0495645_0024641_1397_1867 | 156 |
| 163 | 3300046664 | Ga0495659_0184561 | Ga0495659_0184561_89_559 | 156 |
| 164 | 3300046684 | Ga0495669_0010381 | Ga0495669_0010381_2952_3422 | 156 |
| 165 | 3300046694 | Ga0495649_0492864 | Ga0495649_0492864_65_535 | 156 |
| 166 | 3300047472 | Ga0495686_0022623 | Ga0495686_0022623_2794_3264 | 156 |
| 167 | 3300048905 | Ga0496102_0030313 | Ga0496102_0030313_1813_2283 | 156 |
| 168 | 3300048913 | Ga0496110_0624083 | Ga0496110_0624083_344_814 | 156 |
| 169 | 3300048915 | Ga0496112_1083391 | Ga0496112_1083391_127_597 | 156 |
| 170 | 3300049573 | Ga0501037_0059766 | Ga0501037_0059766_762_1232 | 156 |
| 171 | 3300049581 | Ga0501047_0095613 | Ga0501047_0095613_252_722 | 156 |
| 172 | 3300049581 | Ga0501047_0113667 | Ga0501047_0113667_538_1008 | 156 |
| 173 | 3300049581 | Ga0501047_0502390 | Ga0501047_0502390_400_870 | 156 |
| 174 | 3300049581 | Ga0501047_0883778 | Ga0501047_0883778_67_537 | 156 |
| 175 | 3300049581 | Ga0501047_1030469 | Ga0501047_1030469_88_558 | 156 |
| 176 | 3300049583 | Ga0501067_0021611 | Ga0501067_0021611_2139_2618 | 156 |
| 177 | 3300049588 | Ga0501072_0055826 | Ga0501072_0055826_275_754 | 156 |
| 178 | 3300049589 | Ga0501073_0007054 | Ga0501073_0007054_6113_6592 | 156 |
| 179 | 3300049590 | Ga0501074_0379791 | Ga0501074_0379791_47_526 | 156 |
| 180 | 3300049681 | Ga0501251_079925 | Ga0501251_079925_86_556 | 156 |
| 181 | 3300049742 | Ga0501080_0012907 | Ga0501080_0012907_2965_3444 | 156 |
| 182 | 3300049744 | Ga0501083_0014643 | Ga0501083_0014643_3793_4272 | 156 |
| 183 | 3300049822 | Ga0501035_0262587 | Ga0501035_0262587_152_622 | 156 |
| 184 | 3300049823 | Ga0501044_0010085 | Ga0501044_0010085_1514_1984 | 156 |
| 185 | 3300049823 | Ga0501044_0565992 | Ga0501044_0565992_173_643 | 156 |
| 186 | 3300050489 | nmdc:mga03683_90583_c1 | nmdc:mga03683_90583_c1_613_1083 | 156 |
| 187 | 3300050490 | nmdc:mga03n38_40649_c1 | nmdc:mga03n38_40649_c1_1352_1822 | 156 |
| 188 | 3300053087 | Ga0500643_005954 | Ga0500643_005954_1968_2438 | 156 |
| 189 | 3300053090 | Ga0500646_0003762 | Ga0500646_0003762_1817_2287 | 156 |
| 190 | 3300053108 | Ga0500562_013138 | Ga0500562_013138_650_1120 | 156 |
| 191 | 3300053730 | Ga0500645_002967 | Ga0500645_002967_4345_4815 | 156 |
| 192 | 3300060353 | Ga0501082_0051849 | Ga0501082_0051849_553_1032 | 156 |
| 193 | iso_pu_bacteria | 2510917020 | 2511125379 | 156 |
| 194 | iso_pu_bacteria | 2582581280 | 2585153129 | 156 |
| 195 | iso_pu_bacteria | 2582581293 | 2585196690 | 156 |
| 196 | iso_pu_bacteria | 2643221583 | 2643923519 | 156 |
| 197 | 3300005327 | Ga0070658_10959006 | Ga0070658_109590061 | 157 |
| 198 | 3300005334 | Ga0068869_100022583 | Ga0068869_1000225832 | 157 |
| 199 | 3300005335 | Ga0070666_10450255 | Ga0070666_104502551 | 157 |
| 200 | 3300005336 | Ga0070680_100034575 | Ga0070680_1000345752 | 157 |
| 201 | 3300005339 | Ga0070660_100017823 | Ga0070660_1000178234 | 157 |
| 202 | 3300005339 | Ga0070660_100019403 | Ga0070660_1000194034 | 157 |
| 203 | 3300005339 | Ga0070660_100064682 | Ga0070660_1000646821 | 157 |
| 204 | 3300005339 | Ga0070660_100898354 | Ga0070660_1008983541 | 157 |
| 205 | 3300005341 | Ga0070691_10007536 | Ga0070691_100075363 | 157 |
| 206 | 3300005344 | Ga0070661_100129853 | Ga0070661_1001298532 | 157 |
| 207 | 3300005347 | Ga0070668_100003730 | Ga0070668_1000037308 | 157 |
| 208 | 3300005347 | Ga0070668_100032745 | Ga0070668_1000327454 | 157 |
| 209 | 3300005355 | Ga0070671_100028062 | Ga0070671_1000280624 | 157 |
| 210 | 3300005364 | Ga0070673_100236321 | Ga0070673_1002363212 | 157 |
| 211 | 3300005366 | Ga0070659_100001077 | Ga0070659_1000010774 | 157 |
| 212 | 3300005366 | Ga0070659_100035777 | Ga0070659_1000357771 | 157 |
| 213 | 3300005366 | Ga0070659_100896069 | Ga0070659_1008960691 | 157 |
| 214 | 3300005367 | Ga0070667_100002362 | Ga0070667_10000236211 | 157 |
| 215 | 3300005457 | Ga0070662_100125186 | Ga0070662_1001251863 | 157 |
| 216 | 3300005458 | Ga0070681_10014098 | Ga0070681_100140985 | 157 |
| 217 | 3300005458 | Ga0070681_10072032 | Ga0070681_100720324 | 157 |
| 218 | 3300005530 | Ga0070679_100154113 | Ga0070679_1001541132 | 157 |
| 219 | 3300005530 | Ga0070679_100175111 | Ga0070679_1001751112 | 157 |
| 220 | 3300005539 | Ga0068853_100377820 | Ga0068853_1003778202 | 157 |
| 221 | 3300005539 | Ga0068853_100524092 | Ga0068853_1005240922 | 157 |
| 222 | 3300005539 | Ga0068853_100902226 | Ga0068853_1009022262 | 157 |
| 223 | 3300005548 | Ga0070665_100000116 | Ga0070665_10000011694 | 157 |
| 224 | 3300005548 | Ga0070665_100026394 | Ga0070665_1000263945 | 157 |
| 225 | 3300005563 | Ga0068855_100010398 | Ga0068855_1000103983 | 157 |
| 226 | 3300005577 | Ga0068857_101229175 | Ga0068857_1012291752 | 157 |
| 227 | 3300005614 | Ga0068856_100079161 | Ga0068856_1000791614 | 157 |
| 228 | 3300005616 | Ga0068852_101163455 | Ga0068852_1011634552 | 157 |
| 229 | 3300005617 | Ga0068859_100012422 | Ga0068859_1000124225 | 157 |
| 230 | 3300005618 | Ga0068864_100002763 | Ga0068864_1000027635 | 157 |
| 231 | 3300005618 | Ga0068864_100005899 | Ga0068864_1000058993 | 157 |
| 232 | 3300005719 | Ga0068861_100024886 | Ga0068861_1000248863 | 157 |
| 233 | 3300005841 | Ga0068863_100000007 | Ga0068863_100000007179 | 157 |
| 234 | 3300005841 | Ga0068863_100048943 | Ga0068863_1000489432 | 157 |
| 235 | 3300005841 | Ga0068863_100124748 | Ga0068863_1001247483 | 157 |
| 236 | 3300005841 | Ga0068863_100295107 | Ga0068863_1002951072 | 157 |
| 237 | 3300005842 | Ga0068858_100000031 | Ga0068858_100000031119 | 157 |
| 238 | 3300005842 | Ga0068858_100221704 | Ga0068858_1002217043 | 157 |
| 239 | 3300005843 | Ga0068860_100000145 | Ga0068860_100000145111 | 157 |
| 240 | 3300005843 | Ga0068860_100019387 | Ga0068860_1000193874 | 157 |
| 241 | 3300005844 | Ga0068862_100006869 | Ga0068862_1000068692 | 157 |
| 242 | 3300005844 | Ga0068862_100019209 | Ga0068862_1000192094 | 157 |
| 243 | 3300006237 | Ga0097621_100366203 | Ga0097621_1003662032 | 157 |
| 244 | 3300006881 | Ga0068865_100971690 | Ga0068865_1009716902 | 157 |
| 245 | 3300006931 | Ga0097620_100012422 | Ga0097620_1000124225 | 157 |
| 246 | 3300009092 | Ga0105250_10016054 | Ga0105250_100160544 | 157 |
| 247 | 3300009093 | Ga0105240_10048116 | Ga0105240_100481164 | 157 |
| 248 | 3300009093 | Ga0105240_10176905 | Ga0105240_101769054 | 157 |
| 249 | 3300009093 | Ga0105240_10181325 | Ga0105240_101813252 | 157 |
| 250 | 3300009093 | Ga0105240_10424124 | Ga0105240_104241242 | 157 |
| 251 | 3300009098 | Ga0105245_11657758 | Ga0105245_116577581 | 157 |
| 252 | 3300009177 | Ga0105248_10207564 | Ga0105248_102075643 | 157 |
| 253 | 3300009177 | Ga0105248_10428707 | Ga0105248_104287072 | 157 |
| 254 | 3300009551 | Ga0105238_10054654 | Ga0105238_100546542 | 157 |
| 255 | 3300009551 | Ga0105238_10127960 | Ga0105238_101279603 | 157 |
| 256 | 3300009551 | Ga0105238_10270096 | Ga0105238_102700962 | 157 |
| 257 | 3300009553 | Ga0105249_10138547 | Ga0105249_101385473 | 157 |
| 258 | 3300010375 | Ga0105239_10394213 | Ga0105239_103942132 | 157 |
| 259 | 3300010375 | Ga0105239_11949111 | Ga0105239_119491112 | 157 |
| 260 | 3300010375 | Ga0105239_12280600 | Ga0105239_122806001 | 157 |
| 261 | 3300013306 | Ga0163162_10839660 | Ga0163162_108396602 | 157 |
| 262 | 3300013308 | Ga0157375_10057082 | Ga0157375_100570822 | 157 |
| 263 | 3300013308 | Ga0157375_13442027 | Ga0157375_134420271 | 157 |
| 264 | 3300014325 | Ga0163163_10023583 | Ga0163163_100235833 | 157 |
| 265 | 3300014325 | Ga0163163_10028528 | Ga0163163_100285284 | 157 |
| 266 | 3300014326 | Ga0157380_10133222 | Ga0157380_101332223 | 157 |
| 267 | 3300014745 | Ga0157377_10338831 | Ga0157377_103388312 | 157 |
| 268 | 3300014968 | Ga0157379_10009938 | Ga0157379_100099384 | 157 |
| 269 | 3300014968 | Ga0157379_10437717 | Ga0157379_104377172 | 157 |
| 270 | 3300025903 | Ga0207680_10550769 | Ga0207680_105507692 | 157 |
| 271 | 3300025909 | Ga0207705_10001576 | Ga0207705_100015768 | 157 |
| 272 | 3300025909 | Ga0207705_10057508 | Ga0207705_100575084 | 157 |
| 273 | 3300025912 | Ga0207707_10018184 | Ga0207707_100181842 | 157 |
| 274 | 3300025912 | Ga0207707_10038477 | Ga0207707_100384773 | 157 |
| 275 | 3300025913 | Ga0207695_10001229 | Ga0207695_1000122922 | 157 |
| 276 | 3300025913 | Ga0207695_10094918 | Ga0207695_100949185 | 157 |
| 277 | 3300025913 | Ga0207695_10095316 | Ga0207695_100953164 | 157 |
| 278 | 3300025913 | Ga0207695_10451602 | Ga0207695_104516022 | 157 |
| 279 | 3300025917 | Ga0207660_10003244 | Ga0207660_1000324411 | 157 |
| 280 | 3300025917 | Ga0207660_10953358 | Ga0207660_109533582 | 157 |
| 281 | 3300025919 | Ga0207657_10024382 | Ga0207657_100243822 | 157 |
| 282 | 3300025919 | Ga0207657_10028952 | Ga0207657_100289524 | 157 |
| 283 | 3300025919 | Ga0207657_10103078 | Ga0207657_101030783 | 157 |
| 284 | 3300025919 | Ga0207657_11171149 | Ga0207657_111711491 | 157 |
| 285 | 3300025921 | Ga0207652_10904957 | Ga0207652_109049572 | 157 |
| 286 | 3300025924 | Ga0207694_10070172 | Ga0207694_100701724 | 157 |
| 287 | 3300025924 | Ga0207694_10185509 | Ga0207694_101855093 | 157 |
| 288 | 3300025924 | Ga0207694_10282104 | Ga0207694_102821042 | 157 |
| 289 | 3300025925 | Ga0207650_10039689 | Ga0207650_100396894 | 157 |
| 290 | 3300025925 | Ga0207650_10133319 | Ga0207650_101333192 | 157 |
| 291 | 3300025925 | Ga0207650_10159401 | Ga0207650_101594012 | 157 |
| 292 | 3300025925 | Ga0207650_10395314 | Ga0207650_103953141 | 157 |
| 293 | 3300025931 | Ga0207644_10002801 | Ga0207644_100028011 | 157 |
| 294 | 3300025931 | Ga0207644_10024374 | Ga0207644_100243744 | 157 |
| 295 | 3300025932 | Ga0207690_10000129 | Ga0207690_100001292 | 157 |
| 296 | 3300025932 | Ga0207690_10018962 | Ga0207690_100189623 | 157 |
| 297 | 3300025933 | Ga0207706_10155536 | Ga0207706_101555362 | 157 |
| 298 | 3300025938 | Ga0207704_10906187 | Ga0207704_109061872 | 157 |
| 299 | 3300025941 | Ga0207711_10103528 | Ga0207711_101035283 | 157 |
| 300 | 3300025941 | Ga0207711_10152804 | Ga0207711_101528041 | 157 |
| 301 | 3300025942 | Ga0207689_10076301 | Ga0207689_100763014 | 157 |
| 302 | 3300025945 | Ga0207679_10946062 | Ga0207679_109460622 | 157 |
| 303 | 3300025949 | Ga0207667_10005781 | Ga0207667_1000578114 | 157 |
| 304 | 3300025949 | Ga0207667_10158435 | Ga0207667_101584352 | 157 |
| 305 | 3300025960 | Ga0207651_10127749 | Ga0207651_101277492 | 157 |
| 306 | 3300025961 | Ga0207712_10583230 | Ga0207712_105832302 | 157 |
| 307 | 3300025972 | Ga0207668_10001036 | Ga0207668_1000103615 | 157 |
| 308 | 3300025972 | Ga0207668_10005134 | Ga0207668_100051342 | 157 |
| 309 | 3300025972 | Ga0207668_10015874 | Ga0207668_100158744 | 157 |
| 310 | 3300025986 | Ga0207658_10006459 | Ga0207658_100064594 | 157 |
| 311 | 3300026035 | Ga0207703_10000038 | Ga0207703_1000003869 | 157 |
| 312 | 3300026035 | Ga0207703_10020047 | Ga0207703_100200474 | 157 |
| 313 | 3300026041 | Ga0207639_10113304 | Ga0207639_101133043 | 157 |
| 314 | 3300026041 | Ga0207639_10549174 | Ga0207639_105491742 | 157 |
| 315 | 3300026041 | Ga0207639_11052841 | Ga0207639_110528411 | 157 |
| 316 | 3300026078 | Ga0207702_10428784 | Ga0207702_104287842 | 157 |
| 317 | 3300026088 | Ga0207641_10000012 | Ga0207641_10000012130 | 157 |
| 318 | 3300026088 | Ga0207641_10074873 | Ga0207641_100748734 | 157 |
| 319 | 3300026088 | Ga0207641_10143210 | Ga0207641_101432103 | 157 |
| 320 | 3300026088 | Ga0207641_10192384 | Ga0207641_101923842 | 157 |
| 321 | 3300026095 | Ga0207676_10000179 | Ga0207676_1000017951 | 157 |
| 322 | 3300026095 | Ga0207676_10002829 | Ga0207676_100028297 | 157 |
| 323 | 3300026095 | Ga0207676_10200930 | Ga0207676_102009302 | 157 |
| 324 | 3300026095 | Ga0207676_10469426 | Ga0207676_104694262 | 157 |
| 325 | 3300026116 | Ga0207674_10153517 | Ga0207674_101535173 | 157 |
| 326 | 3300026118 | Ga0207675_100016217 | Ga0207675_1000162174 | 157 |
| 327 | 3300026118 | Ga0207675_100661465 | Ga0207675_1006614652 | 157 |
| 328 | 3300028379 | Ga0268266_10000064 | Ga0268266_10000064200 | 157 |
| 329 | 3300028379 | Ga0268266_10529634 | Ga0268266_105296342 | 157 |
| 330 | 3300028380 | Ga0268265_10002126 | Ga0268265_1000212614 | 157 |
| 331 | 3300028381 | Ga0268264_10000046 | Ga0268264_10000046160 | 157 |
| 332 | 3300028786 | Ga0307517_10000497 | Ga0307517_1000049745 | 157 |
| 333 | 3300028786 | Ga0307517_10108076 | Ga0307517_101080762 | 157 |
| 334 | 3300031456 | Ga0307513_10000448 | Ga0307513_1000044842 | 157 |
| 335 | 3300031456 | Ga0307513_10002007 | Ga0307513_1000200719 | 157 |
| 336 | 3300031456 | Ga0307513_10004437 | Ga0307513_1000443713 | 157 |
| 337 | 3300031456 | Ga0307513_10005088 | Ga0307513_100050884 | 157 |
| 338 | 3300033180 | Ga0307510_10011693 | Ga0307510_100116932 | 157 |
| 339 | 3300037312 | Ga0395899_0055404 | Ga0395899_0055404_1062_1535 | 157 |
| 340 | 3300037312 | Ga0395899_0116012 | Ga0395899_0116012_1236_1709 | 157 |
| 341 | 3300037418 | Ga0395900_0531966 | Ga0395900_0531966_210_683 | 157 |
| 342 | 3300037418 | Ga0395900_0586300 | Ga0395900_0586300_569_1042 | 157 |
| 343 | 3300037466 | Ga0395898_0126913 | Ga0395898_0126913_1596_2069 | 157 |
| 344 | 3300037466 | Ga0395898_0174058 | Ga0395898_0174058_213_686 | 157 |
| 345 | 3300037471 | Ga0395905_0025239 | Ga0395905_0025239_1364_1837 | 157 |
| 346 | 3300037471 | Ga0395905_0169966 | Ga0395905_0169966_1463_1936 | 157 |
| 347 | 3300038443 | Ga0395901_0826394 | Ga0395901_0826394_154_627 | 157 |
| 348 | 3300039450 | Ga0436363_0474361 | Ga0436363_0474361_738_1226 | 157 |
| 349 | 3300046524 | Ga0495648_0386109 | Ga0495648_0386109_125_598 | 157 |
| 350 | 3300046528 | Ga0495642_0001981 | Ga0495642_0001981_1794_2267 | 157 |
| 351 | 3300046616 | Ga0495668_0000092 | Ga0495668_0000092_89168_89644 | 157 |
| 352 | 3300046660 | Ga0495625_0025295 | Ga0495625_0025295_3345_3818 | 157 |
| 353 | 3300046660 | Ga0495625_0096626 | Ga0495625_0096626_511_984 | 157 |
| 354 | 3300046684 | Ga0495669_0000003 | Ga0495669_0000003_260755_261228 | 157 |
| 355 | 3300046684 | Ga0495669_0061444 | Ga0495669_0061444_660_1133 | 157 |
| 356 | 3300047320 | Ga0495672_0024965 | Ga0495672_0024965_1179_1652 | 157 |
| 357 | 3300047320 | Ga0495672_0034544 | Ga0495672_0034544_2577_3053 | 157 |
| 358 | 3300047445 | Ga0495677_0103324 | Ga0495677_0103324_445_918 | 157 |
| 359 | 3300048903 | Ga0496100_0127129 | Ga0496100_0127129_977_1450 | 157 |
| 360 | 3300048904 | Ga0496101_0091493 | Ga0496101_0091493_714_1187 | 157 |
| 361 | 3300048905 | Ga0496102_0072338 | Ga0496102_0072338_2473_2946 | 157 |
| 362 | 3300048905 | Ga0496102_0622804 | Ga0496102_0622804_460_933 | 157 |
| 363 | 3300048906 | Ga0496103_0277331 | Ga0496103_0277331_550_1023 | 157 |
| 364 | 3300048910 | Ga0496107_0014019 | Ga0496107_0014019_428_901 | 157 |
| 365 | 3300048910 | Ga0496107_0336502 | Ga0496107_0336502_514_987 | 157 |
| 366 | 3300048911 | Ga0496108_0063699 | Ga0496108_0063699_503_976 | 157 |
| 367 | 3300048912 | Ga0496109_0002851 | Ga0496109_0002851_3522_3995 | 157 |
| 368 | 3300048913 | Ga0496110_0281583 | Ga0496110_0281583_510_983 | 157 |
| 369 | 3300048915 | Ga0496112_0339576 | Ga0496112_0339576_508_981 | 157 |
| 370 | 3300048918 | Ga0496115_0002173 | Ga0496115_0002173_3634_4107 | 157 |
| 371 | 3300048918 | Ga0496115_0007602 | Ga0496115_0007602_3301_3774 | 157 |
| 372 | 3300048918 | Ga0496115_0038843 | Ga0496115_0038843_924_1397 | 157 |
| 373 | 3300048919 | Ga0496116_0045237 | Ga0496116_0045237_1836_2309 | 157 |
| 374 | 3300048920 | Ga0496117_0005253 | Ga0496117_0005253_7835_8308 | 157 |
| 375 | 3300048921 | Ga0496118_0005535 | Ga0496118_0005535_10311_10784 | 157 |
| 376 | 3300048922 | Ga0496119_0139078 | Ga0496119_0139078_66_539 | 157 |
| 377 | 3300048923 | Ga0496120_0217912 | Ga0496120_0217912_408_881 | 157 |
| 378 | 3300048924 | Ga0496121_0000009 | Ga0496121_0000009_654625_655098 | 157 |
| 379 | 3300049581 | Ga0501047_0020196 | Ga0501047_0020196_2211_2684 | 157 |
| 380 | 3300049686 | Ga0501257_002177 | Ga0501257_002177_1492_1965 | 157 |
| 381 | 3300049742 | Ga0501080_0786091 | Ga0501080_0786091_108_581 | 157 |
| 382 | 3300053096 | Ga0500641_0015768 | Ga0500641_0015768_1680_2153 | 157 |
| 383 | 3300053108 | Ga0500562_025024 | Ga0500562_025024_447_920 | 157 |
| 384 | 3300053118 | Ga0500594_0031058 | Ga0500594_0031058_632_1105 | 157 |
| 385 | 3300053153 | Ga0500616_0051933 | Ga0500616_0051933_774_1253 | 157 |
| 386 | 3300053730 | Ga0500645_039982 | Ga0500645_039982_855_1334 | 157 |
| 387 | 3300003775 | Ga0055524_1070227 | Ga0055524_10702272 | 158 |
| 388 | 3300003781 | Ga0055536_1004962 | Ga0055536_10049627 | 158 |
| 389 | 3300003791 | Ga0055530_10005956 | Ga0055530_100059565 | 158 |
| 390 | 3300003791 | Ga0055530_10020668 | Ga0055530_100206682 | 158 |
| 391 | 3300003792 | Ga0055540_1008688 | Ga0055540_10086884 | 158 |
| 392 | 3300003794 | Ga0055531_10005104 | Ga0055531_100051047 | 158 |
| 393 | 3300003794 | Ga0055531_10019911 | Ga0055531_100199113 | 158 |
| 394 | 3300005262 | Ga0065165_1001772 | Ga0065165_100177210 | 158 |
| 395 | 3300005347 | Ga0070668_100009254 | Ga0070668_1000092545 | 158 |
| 396 | 3300005353 | Ga0070669_100056933 | Ga0070669_1000569334 | 158 |
| 397 | 3300005355 | Ga0070671_100009285 | Ga0070671_1000092856 | 158 |
| 398 | 3300005367 | Ga0070667_100027061 | Ga0070667_1000270614 | 158 |
| 399 | 3300005466 | Ga0070685_11312247 | Ga0070685_113122471 | 158 |
| 400 | 3300005617 | Ga0068859_100000391 | Ga0068859_10000039119 | 158 |
| 401 | 3300005719 | Ga0068861_100072964 | Ga0068861_1000729644 | 158 |
| 402 | 3300005841 | Ga0068863_100003293 | Ga0068863_1000032939 | 158 |
| 403 | 3300005842 | Ga0068858_100023945 | Ga0068858_1000239454 | 158 |
| 404 | 3300005843 | Ga0068860_100052579 | Ga0068860_1000525793 | 158 |
| 405 | 3300005844 | Ga0068862_100139359 | Ga0068862_1001393591 | 158 |
| 406 | 3300006042 | Ga0075368_10126982 | Ga0075368_101269822 | 158 |
| 407 | 3300006048 | Ga0075363_100047280 | Ga0075363_1000472802 | 158 |
| 408 | 3300006178 | Ga0075367_10000827 | Ga0075367_100008277 | 158 |
| 409 | 3300006195 | Ga0075366_10066173 | Ga0075366_100661733 | 158 |
| 410 | 3300006195 | Ga0075366_10162413 | Ga0075366_101624132 | 158 |
| 411 | 3300006195 | Ga0075366_10171330 | Ga0075366_101713302 | 158 |
| 412 | 3300006353 | Ga0075370_10111103 | Ga0075370_101111031 | 158 |
| 413 | 3300006353 | Ga0075370_10272980 | Ga0075370_102729802 | 158 |
| 414 | 3300006931 | Ga0097620_100000391 | Ga0097620_10000039119 | 158 |
| 415 | 3300009177 | Ga0105248_10008920 | Ga0105248_1000892010 | 158 |
| 416 | 3300012485 | Ga0157325_1001950 | Ga0157325_10019501 | 158 |
| 417 | 3300014325 | Ga0163163_10022137 | Ga0163163_100221374 | 158 |
| 418 | 3300014968 | Ga0157379_10003384 | Ga0157379_100033845 | 158 |
| 419 | 3300025292 | Ga0209676_1000327 | Ga0209676_100032755 | 158 |
| 420 | 3300025292 | Ga0209676_1000409 | Ga0209676_100040938 | 158 |
| 421 | 3300025292 | Ga0209676_1087652 | Ga0209676_10876521 | 158 |
| 422 | 3300025295 | Ga0209564_1003781 | Ga0209564_10037814 | 158 |
| 423 | 3300025298 | Ga0209050_1001254 | Ga0209050_100125422 | 158 |
| 424 | 3300025298 | Ga0209050_1002240 | Ga0209050_100224012 | 158 |
| 425 | 3300025299 | Ga0209256_1010099 | Ga0209256_10100992 | 158 |
| 426 | 3300025299 | Ga0209256_1030703 | Ga0209256_10307032 | 158 |
| 427 | 3300025303 | Ga0209051_1000338 | Ga0209051_100033837 | 158 |
| 428 | 3300025304 | Ga0209257_1000386 | Ga0209257_10003861 | 158 |
| 429 | 3300025304 | Ga0209257_1001334 | Ga0209257_10013347 | 158 |
| 430 | 3300025304 | Ga0209257_1009760 | Ga0209257_10097604 | 158 |
| 431 | 3300025923 | Ga0207681_10319977 | Ga0207681_103199772 | 158 |
| 432 | 3300025931 | Ga0207644_10005572 | Ga0207644_100055726 | 158 |
| 433 | 3300025941 | Ga0207711_10009637 | Ga0207711_100096373 | 158 |
| 434 | 3300025972 | Ga0207668_10000879 | Ga0207668_100008799 | 158 |
| 435 | 3300025986 | Ga0207658_10008544 | Ga0207658_100085445 | 158 |
| 436 | 3300026035 | Ga0207703_10009331 | Ga0207703_100093316 | 158 |
| 437 | 3300026088 | Ga0207641_10020343 | Ga0207641_100203434 | 158 |
| 438 | 3300026118 | Ga0207675_100095867 | Ga0207675_1000958672 | 158 |
| 439 | 3300027866 | Ga0209813_10061786 | Ga0209813_100617862 | 158 |
| 440 | 3300028379 | Ga0268266_10038612 | Ga0268266_100386124 | 158 |
| 441 | 3300028380 | Ga0268265_10703683 | Ga0268265_107036831 | 158 |
| 442 | 3300031456 | Ga0307513_10901491 | Ga0307513_109014911 | 158 |
| 443 | 3300031616 | Ga0307508_10738071 | Ga0307508_107380711 | 158 |
| 444 | 3300031730 | Ga0307516_10000004 | Ga0307516_10000004364 | 158 |
| 445 | 3300037418 | Ga0395900_0109974 | Ga0395900_0109974_43_519 | 158 |
| 446 | 3300037466 | Ga0395898_0016546 | Ga0395898_0016546_726_1202 | 158 |
| 447 | 3300037471 | Ga0395905_0093793 | Ga0395905_0093793_309_785 | 158 |
| 448 | 3300038443 | Ga0395901_0046843 | Ga0395901_0046843_809_1285 | 158 |
| 449 | 3300038443 | Ga0395901_0105946 | Ga0395901_0105946_1500_1976 | 158 |
| 450 | 3300041452 | Ga0451793_0195077 | Ga0451793_0195077_99_575 | 158 |
| 451 | 3300041505 | Ga0451849_0975671 | Ga0451849_0975671_25_504 | 158 |
| 452 | 3300042001 | Ga0439441_178905 | Ga0439441_178905_23_499 | 158 |
| 453 | 3300042436 | Ga0439435_0028353 | Ga0439435_0028353_897_1373 | 158 |
| 454 | 3300042438 | Ga0439459_0039880 | Ga0439459_0039880_360_836 | 158 |
| 455 | 3300044683 | Ga0466965_0074640 | Ga0466965_0074640_18_593 | 158 |
| 456 | 3300046457 | Ga0495590_0001954 | Ga0495590_0001954_3770_4246 | 158 |
| 457 | 3300046460 | Ga0495638_0000701 | Ga0495638_0000701_9424_9900 | 158 |
| 458 | 3300046460 | Ga0495638_0001931 | Ga0495638_0001931_11603_12079 | 158 |
| 459 | 3300046460 | Ga0495638_0002456 | Ga0495638_0002456_5096_5572 | 158 |
| 460 | 3300046460 | Ga0495638_0002536 | Ga0495638_0002536_7351_7827 | 158 |
| 461 | 3300046460 | Ga0495638_0119425 | Ga0495638_0119425_402_881 | 158 |
| 462 | 3300046471 | Ga0495650_0000017 | Ga0495650_0000017_110271_110747 | 158 |
| 463 | 3300046506 | Ga0495583_0000020 | Ga0495583_0000020_155869_156345 | 158 |
| 464 | 3300046507 | Ga0495606_0012983 | Ga0495606_0012983_1840_2319 | 158 |
| 465 | 3300046512 | Ga0495610_0006241 | Ga0495610_0006241_3811_4287 | 158 |
| 466 | 3300046513 | Ga0495616_0189287 | Ga0495616_0189287_52_528 | 158 |
| 467 | 3300046515 | Ga0495620_0016467 | Ga0495620_0016467_1427_1903 | 158 |
| 468 | 3300046518 | Ga0495631_0009992 | Ga0495631_0009992_3361_3837 | 158 |
| 469 | 3300046518 | Ga0495631_0128938 | Ga0495631_0128938_86_562 | 158 |
| 470 | 3300046519 | Ga0495632_0143785 | Ga0495632_0143785_470_946 | 158 |
| 471 | 3300046520 | Ga0495637_0005524 | Ga0495637_0005524_5640_6116 | 158 |
| 472 | 3300046525 | Ga0495663_0023177 | Ga0495663_0023177_936_1412 | 158 |
| 473 | 3300046530 | Ga0495654_0000750 | Ga0495654_0000750_6940_7416 | 158 |
| 474 | 3300046542 | Ga0495597_0042638 | Ga0495597_0042638_113_592 | 158 |
| 475 | 3300046616 | Ga0495668_0003409 | Ga0495668_0003409_10414_10890 | 158 |
| 476 | 3300046616 | Ga0495668_0041050 | Ga0495668_0041050_1845_2324 | 158 |
| 477 | 3300046660 | Ga0495625_0004098 | Ga0495625_0004098_9344_9820 | 158 |
| 478 | 3300046660 | Ga0495625_0016645 | Ga0495625_0016645_3492_3971 | 158 |
| 479 | 3300046660 | Ga0495625_0020347 | Ga0495625_0020347_2458_2934 | 158 |
| 480 | 3300046660 | Ga0495625_0031934 | Ga0495625_0031934_2458_2934 | 158 |
| 481 | 3300046660 | Ga0495625_0064135 | Ga0495625_0064135_1808_2284 | 158 |
| 482 | 3300046660 | Ga0495625_0133394 | Ga0495625_0133394_700_1176 | 158 |
| 483 | 3300046794 | Ga0495589_0007451 | Ga0495589_0007451_4350_4826 | 158 |
| 484 | 3300047320 | Ga0495672_0001016 | Ga0495672_0001016_18121_18597 | 158 |
| 485 | 3300047446 | Ga0495679_016776 | Ga0495679_016776_1733_2209 | 158 |
| 486 | 3300047469 | Ga0495673_0004040 | Ga0495673_0004040_3236_3712 | 158 |
| 487 | 3300047470 | Ga0495681_0037146 | Ga0495681_0037146_1057_1533 | 158 |
| 488 | 3300047472 | Ga0495686_0000259 | Ga0495686_0000259_93237_93713 | 158 |
| 489 | 3300047472 | Ga0495686_0104072 | Ga0495686_0104072_183_659 | 158 |
| 490 | 3300047472 | Ga0495686_0400775 | Ga0495686_0400775_25_501 | 158 |
| 491 | 3300048090 | Ga0495615_0012594 | Ga0495615_0012594_578_1054 | 158 |
| 492 | 3300048904 | Ga0496101_0033852 | Ga0496101_0033852_1320_1796 | 158 |
| 493 | 3300048905 | Ga0496102_0602355 | Ga0496102_0602355_56_532 | 158 |
| 494 | 3300048909 | Ga0496106_0003278 | Ga0496106_0003278_8610_9086 | 158 |
| 495 | 3300048910 | Ga0496107_0000851 | Ga0496107_0000851_16622_17098 | 158 |
| 496 | 3300048924 | Ga0496121_0001613 | Ga0496121_0001613_28290_28766 | 158 |
| 497 | 3300048926 | Ga0496123_0197473 | Ga0496123_0197473_85_561 | 158 |
| 498 | 3300048927 | Ga0496124_0033194 | Ga0496124_0033194_56_631 | 158 |
| 499 | 3300048928 | Ga0496125_0019090 | Ga0496125_0019090_4137_4616 | 158 |
| 500 | 3300048929 | Ga0496126_0005746 | Ga0496126_0005746_8516_8995 | 158 |
| 501 | 3300048929 | Ga0496126_0167670 | Ga0496126_0167670_877_1353 | 158 |
| 502 | 3300049459 | Ga0495678_001694 | Ga0495678_001694_15247_15723 | 158 |
| 503 | 3300049581 | Ga0501047_0216722 | Ga0501047_0216722_834_1310 | 158 |
| 504 | 3300049758 | Ga0501241_026953 | Ga0501241_026953_537_1016 | 158 |
| 505 | 3300050490 | nmdc:mga03n38_380141_c1 | nmdc:mga03n38_380141_c1_70_546 | 158 |
| 506 | 3300050493 | nmdc:mga0k408_10134_c1 | nmdc:mga0k408_10134_c1_563_1039 | 158 |
| 507 | 3300050493 | nmdc:mga0k408_125345_c1 | nmdc:mga0k408_125345_c1_212_688 | 158 |
| 508 | 3300050495 | nmdc:mga04h51_73822_c1 | nmdc:mga04h51_73822_c1_223_699 | 158 |
| 509 | 3300050496 | nmdc:mga07m45_14110_c1 | nmdc:mga07m45_14110_c1_846_1322 | 158 |
| 510 | 3300050496 | nmdc:mga07m45_184801_c1 | nmdc:mga07m45_184801_c1_369_848 | 158 |
| 511 | 3300050496 | nmdc:mga07m45_232853_c1 | nmdc:mga07m45_232853_c1_18_497 | 158 |
| 512 | 3300050496 | nmdc:mga07m45_79587_c1 | nmdc:mga07m45_79587_c1_748_1224 | 158 |
| 513 | 3300050516 | nmdc:mga0sz30_29728_c1 | nmdc:mga0sz30_29728_c1_1011_1490 | 158 |
| 514 | 3300053086 | Ga0500578_0000420 | Ga0500578_0000420_44711_45187 | 158 |
| 515 | 3300053102 | Ga0500554_001349 | Ga0500554_001349_1260_1736 | 158 |
| 516 | 3300053104 | Ga0500556_0011180 | Ga0500556_0011180_1097_1573 | 158 |
| 517 | 3300053104 | Ga0500556_0143772 | Ga0500556_0143772_305_781 | 158 |
| 518 | 3300053118 | Ga0500594_0000212 | Ga0500594_0000212_1022_1498 | 158 |
| 519 | 3300053120 | Ga0500597_256103 | Ga0500597_256103_207_683 | 158 |
| 520 | 3300053122 | Ga0500608_000059 | Ga0500608_000059_10678_11157 | 158 |
| 521 | 3300053123 | Ga0500614_003176 | Ga0500614_003176_566_1042 | 158 |
| 522 | 3300053125 | Ga0500618_002667 | Ga0500618_002667_1064_1540 | 158 |
| 523 | 3300053136 | Ga0500559_0000077 | Ga0500559_0000077_52722_53198 | 158 |
| 524 | 3300053136 | Ga0500559_0000111 | Ga0500559_0000111_58593_59069 | 158 |
| 525 | 3300053136 | Ga0500559_0021293 | Ga0500559_0021293_1468_1947 | 158 |
| 526 | 3300053142 | Ga0500577_0001426 | Ga0500577_0001426_607_1083 | 158 |
| 527 | 3300053146 | Ga0500588_0061576 | Ga0500588_0061576_151_627 | 158 |
| 528 | 3300053153 | Ga0500616_0015967 | Ga0500616_0015967_558_1034 | 158 |
| 529 | 3300053156 | Ga0500622_0000526 | Ga0500622_0000526_3947_4423 | 158 |
| 530 | 3300053156 | Ga0500622_0014867 | Ga0500622_0014867_673_1152 | 158 |
| 531 | 3300053156 | Ga0500622_0058402 | Ga0500622_0058402_408_887 | 158 |
| 532 | 3300053158 | Ga0500627_0022301 | Ga0500627_0022301_1316_1792 | 158 |
| 533 | 3300053163 | Ga0500639_179950 | Ga0500639_179950_309_785 | 158 |
| 534 | 3300053177 | Ga0500636_0028477 | Ga0500636_0028477_487_963 | 158 |
| 535 | 3300053727 | Ga0500611_001826 | Ga0500611_001826_1397_1873 | 158 |
| 536 | 3300053730 | Ga0500645_074393 | Ga0500645_074393_89_661 | 158 |
| 537 | 3300053733 | Ga0500552_057734 | Ga0500552_057734_12_491 | 158 |
| 538 | iso_pu_bacteria | 2928531327 | 2928535360 | 158 |
| 539 | 3300046459 | Ga0495629_0018656 | Ga0495629_0018656_1912_2391 | 159 |
| 540 | 3300046524 | Ga0495648_0006618 | Ga0495648_0006618_7837_8316 | 159 |
| 541 | 3300046542 | Ga0495597_0001428 | Ga0495597_0001428_11941_12420 | 159 |
| 542 | 3300046616 | Ga0495668_0122382 | Ga0495668_0122382_878_1357 | 159 |
| 543 | 3300046660 | Ga0495625_0163407 | Ga0495625_0163407_669_1148 | 159 |
| 544 | 3300047469 | Ga0495673_0000401 | Ga0495673_0000401_34522_35001 | 159 |
| 545 | 3300048088 | Ga0495602_0442144 | Ga0495602_0442144_425_904 | 159 |
| 546 | 3300049460 | Ga0495682_0191850 | Ga0495682_0191850_188_667 | 159 |
| 547 | 3300049570 | Ga0501033_0008404 | Ga0501033_0008404_3998_4483 | 159 |
| 548 | 3300049573 | Ga0501037_0065489 | Ga0501037_0065489_1458_1943 | 159 |
| 549 | 3300049823 | Ga0501044_0000504 | Ga0501044_0000504_40523_41008 | 159 |
| 550 | 3300053080 | Ga0500635_0000228 | Ga0500635_0000228_4020_4499 | 159 |
| 551 | 3300053087 | Ga0500643_011284 | Ga0500643_011284_621_1100 | 159 |
| 552 | 3300053088 | Ga0500644_0001153 | Ga0500644_0001153_2174_2653 | 159 |
| 553 | 3300053092 | Ga0500583_0034722 | Ga0500583_0034722_1475_1954 | 159 |
| 554 | 3300053094 | Ga0500566_0074713 | Ga0500566_0074713_343_822 | 159 |
| 555 | 3300053109 | Ga0500569_011335 | Ga0500569_011335_704_1183 | 159 |
| 556 | 3300053119 | Ga0500595_002687 | Ga0500595_002687_47_526 | 159 |
| 557 | 3300053122 | Ga0500608_032146 | Ga0500608_032146_1310_1789 | 159 |
| 558 | 3300053123 | Ga0500614_004047 | Ga0500614_004047_2080_2559 | 159 |
| 559 | 3300053130 | Ga0500642_0341253 | Ga0500642_0341253_95_574 | 159 |
| 560 | 3300053134 | Ga0500658_0072909 | Ga0500658_0072909_776_1255 | 159 |
| 561 | 3300053136 | Ga0500559_0021419 | Ga0500559_0021419_1006_1485 | 159 |
| 562 | 3300053138 | Ga0500564_000021 | Ga0500564_000021_15900_16379 | 159 |
| 563 | 3300053148 | Ga0500590_013948 | Ga0500590_013948_46_525 | 159 |
| 564 | 3300053162 | Ga0500638_088613 | Ga0500638_088613_400_879 | 159 |
| 565 | 3300053177 | Ga0500636_0116303 | Ga0500636_0116303_318_797 | 159 |
| 566 | 3300053177 | Ga0500636_0199075 | Ga0500636_0199075_180_659 | 159 |
| 567 | 3300053178 | Ga0500637_0023362 | Ga0500637_0023362_2577_3056 | 159 |
| 568 | 3300053178 | Ga0500637_0068739 | Ga0500637_0068739_569_1048 | 159 |
| 569 | 3300053725 | Ga0500576_104458 | Ga0500576_104458_305_784 | 159 |
| 570 | 3300053729 | Ga0500625_093384 | Ga0500625_093384_732_1211 | 159 |
| 571 | 3300053730 | Ga0500645_039749 | Ga0500645_039749_101_580 | 159 |
| 572 | 3300053735 | Ga0500596_000416 | Ga0500596_000416_6162_6641 | 159 |
| 573 | 3300055283 | Ga0500661_048586 | Ga0500661_048586_84_563 | 159 |
| 574 | 3300055283 | Ga0500661_070376 | Ga0500661_070376_10_489 | 159 |
| 575 | 3300003215 | JGI25153J46596_10049192 | JGI25153J46596_100491922 | 160 |
| 576 | 3300003771 | Ga0055526_1036615 | Ga0055526_10366151 | 160 |
| 577 | 3300003773 | Ga0055537_1002539 | Ga0055537_10025394 | 160 |
| 578 | 3300003775 | Ga0055524_1013139 | Ga0055524_10131393 | 160 |
| 579 | 3300003790 | Ga0055528_1036149 | Ga0055528_10361492 | 160 |
| 580 | 3300025263 | Ga0209565_1000332 | Ga0209565_10003328 | 160 |
| 581 | 3300025273 | Ga0209673_1000523 | Ga0209673_100052331 | 160 |
| 582 | 3300025291 | Ga0209675_1016141 | Ga0209675_10161412 | 160 |
| 583 | 3300025295 | Ga0209564_1032654 | Ga0209564_10326542 | 160 |
| 584 | 3300025297 | Ga0209758_1002471 | Ga0209758_100247117 | 160 |
| 585 | 3300025297 | Ga0209758_1002872 | Ga0209758_10028728 | 160 |
| 586 | 3300025299 | Ga0209256_1003815 | Ga0209256_10038154 | 160 |
| 587 | 3300028794 | Ga0307515_10050621 | Ga0307515_100506215 | 160 |
| 588 | 3300046453 | Ga0495627_000443 | Ga0495627_000443_8681_9172 | 160 |
| 589 | 3300046460 | Ga0495638_0015888 | Ga0495638_0015888_3373_3864 | 160 |
| 590 | 3300046501 | Ga0495607_0036504 | Ga0495607_0036504_1781_2272 | 160 |
| 591 | 3300046507 | Ga0495606_0007343 | Ga0495606_0007343_1157_1648 | 160 |
| 592 | 3300046512 | Ga0495610_0000535 | Ga0495610_0000535_11712_12203 | 160 |
| 593 | 3300046512 | Ga0495610_0023019 | Ga0495610_0023019_775_1266 | 160 |
| 594 | 3300046513 | Ga0495616_0000375 | Ga0495616_0000375_11639_12130 | 160 |
| 595 | 3300046513 | Ga0495616_0215052 | Ga0495616_0215052_16_603 | 160 |
| 596 | 3300046519 | Ga0495632_0002115 | Ga0495632_0002115_2965_3456 | 160 |
| 597 | 3300046520 | Ga0495637_0019459 | Ga0495637_0019459_980_1471 | 160 |
| 598 | 3300046522 | Ga0495643_0059246 | Ga0495643_0059246_132_623 | 160 |
| 599 | 3300046524 | Ga0495648_0092740 | Ga0495648_0092740_669_1160 | 160 |
| 600 | 3300046524 | Ga0495648_0319462 | Ga0495648_0319462_73_564 | 160 |
| 601 | 3300046616 | Ga0495668_0038062 | Ga0495668_0038062_396_887 | 160 |
| 602 | 3300046660 | Ga0495625_0000865 | Ga0495625_0000865_11448_11939 | 160 |
| 603 | 3300046660 | Ga0495625_0006433 | Ga0495625_0006433_4087_4578 | 160 |
| 604 | 3300046691 | Ga0495670_0129809 | Ga0495670_0129809_714_1205 | 160 |
| 605 | 3300046691 | Ga0495670_0178051 | Ga0495670_0178051_502_1089 | 160 |
| 606 | 3300047323 | Ga0495683_0103166 | Ga0495683_0103166_289_780 | 160 |
| 607 | 3300047469 | Ga0495673_0000078 | Ga0495673_0000078_168947_169438 | 160 |
| 608 | 3300048918 | Ga0496115_0002548 | Ga0496115_0002548_7056_7538 | 160 |
| 609 | 3300049671 | Ga0501238_003056 | Ga0501238_003056_932_1423 | 160 |
| 610 | 3300053087 | Ga0500643_039219 | Ga0500643_039219_397_888 | 160 |
| 611 | 3300053134 | Ga0500658_0004419 | Ga0500658_0004419_4466_4957 | 160 |
| 612 | 3300053136 | Ga0500559_0020710 | Ga0500559_0020710_13_504 | 160 |
| 613 | 3300053151 | Ga0500604_0338976 | Ga0500604_0338976_18_509 | 160 |
| 614 | 3300053153 | Ga0500616_0047953 | Ga0500616_0047953_1680_2171 | 160 |
| 615 | 3300053156 | Ga0500622_0023470 | Ga0500622_0023470_1249_1740 | 160 |
| 616 | 3300053730 | Ga0500645_003640 | Ga0500645_003640_1569_2060 | 160 |
| 617 | 3300053731 | Ga0500609_000612 | Ga0500609_000612_3225_3716 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d6x-assembly1.cif.gz_A | crystal structure of campylobacter jejuni fabz | 0.9646 | 15 | 155 |
| 3d6x-assembly1.cif.gz_F | crystal structure of campylobacter jejuni fabz | 0.956 | 15 | 155 |
| 3d6x-assembly1.cif.gz_B | crystal structure of campylobacter jejuni fabz | 0.9549 | 15 | 156 |
| 3d6x-assembly1.cif.gz_A | crystal structure of campylobacter jejuni fabz | 0.951 | 15 | 155 |
| 4zw0-assembly1.cif.gz_C | crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from candidatus asiaticum | 0.9497 | 14 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3d6xF00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9537 | 15 | 155 | 3.10.129.10 |
| 2gllA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9485 | 13 | 158 | 3.10.129.10 |
| 4zw0B00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9467 | 14 | 153 | 3.10.129.10 |
| 3d6xF00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9467 | 15 | 155 | 3.10.129.10 |
| af_Q2FWF5_1_146_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9291 | 16 | 158 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y8SSH0-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) | 0.9698 | 10 | 158 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0019171 |
| AF-A0A4P1K7R3-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) | 0.9697 | 10 | 160 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0019171 |
| AF-A0A4Y9RBG6-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) | 0.9684 | 10 | 159 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0019171 |
| AF-A0A1G9VA18-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) | 0.9664 | 14 | 156 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0019171 |
| AF-A0A7L5Z9R0-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (EC 4.2.1.59) ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase) ((3R)-hydroxymyristoyl-ACP dehydrase) (Beta-hydroxyacyl-ACP dehydratase) | 0.966 | 11 | 160 |
GO:0005737
GO:0006633 GO:0009245 GO:0016020 GO:0019171 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar