F469651
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 617 | 303 | 617 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300035083|Ga0373926_0003468|Ga0373926_0003468_2312_2797 |
| Length | 161 |
| Sequence | LNDKLSEIPTKPYLLRALFEWCVDNGYTPHLAVKVDSRTQVPLEYVKNGEITLNISPNAVHKLQMGNELIEFSARFGGVARQLAVPINNVYALYARETGHGMTFDVDGPKAGVQAKAESEPVREPKHPAIKPPAQLPVPAATSPEPPKKPSGGKPTLRRIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 79 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 159 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 160 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 161 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 162 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 163 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 164 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 165 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 166 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 167 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 172 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 175 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 181 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 185 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 189 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 191 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 194 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 195 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 196 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 198 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 199 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 200 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 201 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 202 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 203 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 204 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 205 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 206 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 207 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 208 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 209 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 210 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 211 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 212 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 255 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 256 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 279 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 280 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 287 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 288 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 302 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 0 |
| Rhizoplane | 0.32 |
| Rhizosphere | 97.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARCol0yngRDRAFT_1004317 | 3300000652 | Bacteria | 1033 |
| 2 | Ga0065707_10010183 | 3300005295 | Bacteria | 2445 |
| 3 | Ga0065707_10217684 | 3300005295 | Bacteria | 1238 |
| 4 | Ga0070676_10166220 | 3300005328 | Bacteria | 1424 |
| 5 | Ga0070676_10638324 | 3300005328 | Bacteria | 772 |
| 6 | Ga0070690_100016772 | 3300005330 | Bacteria | 4395 |
| 7 | Ga0070690_100154001 | 3300005330 | Bacteria | 1570 |
| 8 | Ga0070690_100259709 | 3300005330 | Bacteria | 1232 |
| 9 | Ga0070670_101746788 | 3300005331 | Bacteria | 573 |
| 10 | Ga0070677_10164066 | 3300005333 | Bacteria | 1045 |
| 11 | Ga0068869_100000139 | 3300005334 | Bacteria | 35367 |
| 12 | Ga0068869_100152276 | 3300005334 | Bacteria | 1794 |
| 13 | Ga0070680_100000688 | 3300005336 | Bacteria | 23463 |
| 14 | Ga0070680_100163787 | 3300005336 | Bacteria | 1869 |
| 15 | Ga0070680_100468454 | 3300005336 | Bacteria | 1076 |
| 16 | Ga0070680_100669191 | 3300005336 | Bacteria | 893 |
| 17 | Ga0070680_101174924 | 3300005336 | Bacteria | 663 |
| 18 | Ga0070682_100393712 | 3300005337 | Bacteria | 1046 |
| 19 | Ga0068868_100000115 | 3300005338 | Bacteria | 50197 |
| 20 | Ga0068868_101461470 | 3300005338 | Bacteria | 639 |
| 21 | Ga0070689_100049842 | 3300005340 | Bacteria | 3233 |
| 22 | Ga0070689_100076770 | 3300005340 | Bacteria | 2617 |
| 23 | Ga0070689_101317879 | 3300005340 | Bacteria | 651 |
| 24 | Ga0070687_100000091 | 3300005343 | Bacteria | 29810 |
| 25 | Ga0070692_10000335 | 3300005345 | Bacteria | 13622 |
| 26 | Ga0070692_10061598 | 3300005345 | Bacteria | 1978 |
| 27 | Ga0070692_10271833 | 3300005345 | Bacteria | 1023 |
| 28 | Ga0070692_10760541 | 3300005345 | Bacteria | 658 |
| 29 | Ga0070668_100043358 | 3300005347 | Bacteria | 3450 |
| 30 | Ga0070669_100009032 | 3300005353 | Bacteria | 7107 |
| 31 | Ga0070669_100409604 | 3300005353 | Bacteria | 1111 |
| 32 | Ga0070669_100932223 | 3300005353 | Bacteria | 743 |
| 33 | Ga0070675_100052444 | 3300005354 | Bacteria | 3353 |
| 34 | Ga0070675_100646824 | 3300005354 | Bacteria | 961 |
| 35 | Ga0070671_100229083 | 3300005355 | Bacteria | 1577 |
| 36 | Ga0070671_100511204 | 3300005355 | Bacteria | 1034 |
| 37 | Ga0070673_100638566 | 3300005364 | Bacteria | 974 |
| 38 | Ga0070673_100831722 | 3300005364 | Bacteria | 854 |
| 39 | Ga0070688_100108394 | 3300005365 | Bacteria | 1843 |
| 40 | Ga0070703_10113264 | 3300005406 | Bacteria | 973 |
| 41 | Ga0070709_11251110 | 3300005434 | Bacteria | 598 |
| 42 | Ga0070714_100040727 | 3300005435 | Bacteria | 3917 |
| 43 | Ga0070710_10152857 | 3300005437 | Bacteria | 1425 |
| 44 | Ga0070701_10002057 | 3300005438 | Bacteria | 7646 |
| 45 | Ga0070701_10871295 | 3300005438 | Bacteria | 620 |
| 46 | Ga0070711_100325245 | 3300005439 | Bacteria | 1230 |
| 47 | Ga0070711_100498237 | 3300005439 | Bacteria | 1004 |
| 48 | Ga0070711_101445914 | 3300005439 | Bacteria | 599 |
| 49 | Ga0070705_100001761 | 3300005440 | Bacteria | 11227 |
| 50 | Ga0070705_100002781 | 3300005440 | Bacteria | 8720 |
| 51 | Ga0070705_100647351 | 3300005440 | Bacteria | 823 |
| 52 | Ga0070705_100720626 | 3300005440 | Bacteria | 786 |
| 53 | Ga0070705_100856111 | 3300005440 | Bacteria | 728 |
| 54 | Ga0070705_101022743 | 3300005440 | Bacteria | 672 |
| 55 | Ga0070700_100008537 | 3300005441 | Bacteria | 5577 |
| 56 | Ga0070700_100165485 | 3300005441 | Bacteria | 1526 |
| 57 | Ga0070694_100000133 | 3300005444 | Bacteria | 37050 |
| 58 | Ga0070694_100081232 | 3300005444 | Bacteria | 2255 |
| 59 | Ga0070694_100100526 | 3300005444 | Bacteria | 2045 |
| 60 | Ga0070694_100242314 | 3300005444 | Bacteria | 1360 |
| 61 | Ga0070694_101051162 | 3300005444 | Bacteria | 678 |
| 62 | Ga0070708_100139710 | 3300005445 | Bacteria | 2246 |
| 63 | Ga0070681_10000081 | 3300005458 | Bacteria | 71809 |
| 64 | Ga0070681_10145543 | 3300005458 | Bacteria | 2299 |
| 65 | Ga0070681_10277248 | 3300005458 | Bacteria | 1588 |
| 66 | Ga0068867_100000084 | 3300005459 | Bacteria | 58558 |
| 67 | Ga0068867_100000755 | 3300005459 | Bacteria | 21746 |
| 68 | Ga0070685_10219953 | 3300005466 | Bacteria | 1244 |
| 69 | Ga0070706_100429431 | 3300005467 | Bacteria | 1229 |
| 70 | Ga0070699_100008554 | 3300005518 | Bacteria | 8868 |
| 71 | Ga0070699_100080666 | 3300005518 | Bacteria | 2836 |
| 72 | Ga0070699_100356165 | 3300005518 | Bacteria | 1319 |
| 73 | Ga0070679_100003611 | 3300005530 | Bacteria | 14138 |
| 74 | Ga0070684_100100681 | 3300005535 | Bacteria | 2581 |
| 75 | Ga0070697_100000299 | 3300005536 | Bacteria | 39638 |
| 76 | Ga0070697_100001557 | 3300005536 | Bacteria | 17448 |
| 77 | Ga0068853_100199450 | 3300005539 | Bacteria | 1821 |
| 78 | Ga0070672_100199866 | 3300005543 | Bacteria | 1671 |
| 79 | Ga0070672_100320379 | 3300005543 | Bacteria | 1318 |
| 80 | Ga0070686_100000193 | 3300005544 | Bacteria | 42276 |
| 81 | Ga0070686_100004514 | 3300005544 | Bacteria | 7674 |
| 82 | Ga0070686_100189360 | 3300005544 | Bacteria | 1467 |
| 83 | Ga0070686_101331524 | 3300005544 | Bacteria | 601 |
| 84 | Ga0070695_100000303 | 3300005545 | Bacteria | 24889 |
| 85 | Ga0070695_100001505 | 3300005545 | Bacteria | 12926 |
| 86 | Ga0070695_100125662 | 3300005545 | Bacteria | 1761 |
| 87 | Ga0070695_100897377 | 3300005545 | Bacteria | 716 |
| 88 | Ga0070696_100000284 | 3300005546 | Bacteria | 30526 |
| 89 | Ga0070696_100005214 | 3300005546 | Bacteria | 8687 |
| 90 | Ga0070696_100133174 | 3300005546 | Bacteria | 1811 |
| 91 | Ga0070696_100493894 | 3300005546 | Bacteria | 973 |
| 92 | Ga0070696_100508102 | 3300005546 | Bacteria | 960 |
| 93 | Ga0070693_100000111 | 3300005547 | Bacteria | 36381 |
| 94 | Ga0070693_100292019 | 3300005547 | Bacteria | 1096 |
| 95 | Ga0070693_100360433 | 3300005547 | Bacteria | 998 |
| 96 | Ga0070704_100000008 | 3300005549 | Bacteria | 71641 |
| 97 | Ga0070704_100064757 | 3300005549 | Bacteria | 2628 |
| 98 | Ga0068855_100000242 | 3300005563 | Bacteria | 68674 |
| 99 | Ga0070664_101542457 | 3300005564 | Bacteria | 629 |
| 100 | Ga0068857_100870631 | 3300005577 | Bacteria | 863 |
| 101 | Ga0068857_102149844 | 3300005577 | Bacteria | 548 |
| 102 | Ga0068854_100045331 | 3300005578 | Bacteria | 3126 |
| 103 | Ga0068856_100010173 | 3300005614 | Bacteria | 9143 |
| 104 | Ga0070702_100000012 | 3300005615 | Bacteria | 58298 |
| 105 | Ga0070702_100851299 | 3300005615 | Bacteria | 710 |
| 106 | Ga0068852_100176407 | 3300005616 | Bacteria | 2007 |
| 107 | Ga0068859_100005212 | 3300005617 | Bacteria | 13208 |
| 108 | Ga0068864_100412279 | 3300005618 | Bacteria | 1286 |
| 109 | Ga0068866_10000109 | 3300005718 | Bacteria | 35401 |
| 110 | Ga0068866_10044301 | 3300005718 | Bacteria | 2225 |
| 111 | Ga0068861_100016620 | 3300005719 | Bacteria | 5210 |
| 112 | Ga0068861_100140675 | 3300005719 | Bacteria | 1969 |
| 113 | Ga0068861_100345438 | 3300005719 | Bacteria | 1303 |
| 114 | Ga0068861_101306134 | 3300005719 | Bacteria | 705 |
| 115 | Ga0068870_11301106 | 3300005840 | Bacteria | 530 |
| 116 | Ga0068863_100583404 | 3300005841 | Bacteria | 1106 |
| 117 | Ga0068858_100287149 | 3300005842 | Bacteria | 1567 |
| 118 | Ga0068858_100561221 | 3300005842 | Bacteria | 1106 |
| 119 | Ga0068860_100005589 | 3300005843 | Bacteria | 12708 |
| 120 | Ga0068862_100002876 | 3300005844 | Bacteria | 15079 |
| 121 | Ga0068862_100247792 | 3300005844 | Bacteria | 1622 |
| 122 | Ga0068862_100722720 | 3300005844 | Bacteria | 966 |
| 123 | Ga0068862_101050474 | 3300005844 | Bacteria | 808 |
| 124 | Ga0081539_10005168 | 3300005985 | Bacteria | 13568 |
| 125 | Ga0075364_10012099 | 3300006051 | Bacteria | 5267 |
| 126 | Ga0070715_10147971 | 3300006163 | Bacteria | 1148 |
| 127 | Ga0070716_100337509 | 3300006173 | Bacteria | 1062 |
| 128 | Ga0070712_100220327 | 3300006175 | Bacteria | 1502 |
| 129 | Ga0070712_100484186 | 3300006175 | Bacteria | 1035 |
| 130 | Ga0097621_100000756 | 3300006237 | Bacteria | 22691 |
| 131 | Ga0097621_100040927 | 3300006237 | Bacteria | 3727 |
| 132 | Ga0068871_100000559 | 3300006358 | Bacteria | 25362 |
| 133 | Ga0068871_100000588 | 3300006358 | Bacteria | 24949 |
| 134 | Ga0068871_100411112 | 3300006358 | Bacteria | 1206 |
| 135 | Ga0075428_100000183 | 3300006844 | Bacteria | 58831 |
| 136 | Ga0075428_100116077 | 3300006844 | Bacteria | 2916 |
| 137 | Ga0075428_100195195 | 3300006844 | Bacteria | 2189 |
| 138 | Ga0075428_100257457 | 3300006844 | Bacteria | 1880 |
| 139 | Ga0075428_100578279 | 3300006844 | Bacteria | 1200 |
| 140 | Ga0075430_100120254 | 3300006846 | Bacteria | 2189 |
| 141 | Ga0075430_100149148 | 3300006846 | Bacteria | 1947 |
| 142 | Ga0075431_100024403 | 3300006847 | Bacteria | 6196 |
| 143 | Ga0075431_100353244 | 3300006847 | Bacteria | 1477 |
| 144 | Ga0075431_100359887 | 3300006847 | Bacteria | 1462 |
| 145 | Ga0075431_100481072 | 3300006847 | Bacteria | 1234 |
| 146 | Ga0075433_10000480 | 3300006852 | Bacteria | 26041 |
| 147 | Ga0075433_10456184 | 3300006852 | Bacteria | 1126 |
| 148 | Ga0075433_10539614 | 3300006852 | Bacteria | 1026 |
| 149 | Ga0075433_10680256 | 3300006852 | Bacteria | 902 |
| 150 | Ga0075434_100000079 | 3300006871 | Bacteria | 52051 |
| 151 | Ga0075434_100001287 | 3300006871 | Bacteria | 20920 |
| 152 | Ga0075434_100027998 | 3300006871 | Bacteria | 5533 |
| 153 | Ga0075434_100172686 | 3300006871 | Bacteria | 2182 |
| 154 | Ga0075434_100460018 | 3300006871 | Bacteria | 1294 |
| 155 | Ga0075434_100897053 | 3300006871 | Bacteria | 901 |
| 156 | Ga0075429_100000891 | 3300006880 | Bacteria | 23613 |
| 157 | Ga0075429_100039432 | 3300006880 | Bacteria | 4110 |
| 158 | Ga0068865_100001481 | 3300006881 | Bacteria | 13669 |
| 159 | Ga0068865_100028296 | 3300006881 | Bacteria | 3709 |
| 160 | Ga0068865_102026390 | 3300006881 | Bacteria | 523 |
| 161 | Ga0075436_100000529 | 3300006914 | Bacteria | 24848 |
| 162 | Ga0075436_100005350 | 3300006914 | Bacteria | 8832 |
| 163 | Ga0075436_100034418 | 3300006914 | Bacteria | 3493 |
| 164 | Ga0075436_100060029 | 3300006914 | Bacteria | 2627 |
| 165 | Ga0075436_100076432 | 3300006914 | Bacteria | 2319 |
| 166 | Ga0075436_100094639 | 3300006914 | Bacteria | 2077 |
| 167 | Ga0075436_100125923 | 3300006914 | Bacteria | 1795 |
| 168 | Ga0097620_100005212 | 3300006931 | Bacteria | 13208 |
| 169 | Ga0075435_100027298 | 3300007076 | Bacteria | 4464 |
| 170 | Ga0075435_100078504 | 3300007076 | Bacteria | 2707 |
| 171 | Ga0075435_100199926 | 3300007076 | Bacteria | 1693 |
| 172 | Ga0075435_100294934 | 3300007076 | Bacteria | 1386 |
| 173 | Ga0099794_10190473 | 3300007265 | Bacteria | 1049 |
| 174 | Ga0099794_10244627 | 3300007265 | Bacteria | 924 |
| 175 | Ga0099794_10305082 | 3300007265 | Bacteria | 825 |
| 176 | Ga0099795_10026232 | 3300007788 | Bacteria | 1961 |
| 177 | Ga0111539_10059022 | 3300009094 | Bacteria | 4551 |
| 178 | Ga0111539_10180623 | 3300009094 | Bacteria | 2464 |
| 179 | Ga0111539_10286237 | 3300009094 | Bacteria | 1918 |
| 180 | Ga0111539_10448554 | 3300009094 | Bacteria | 1502 |
| 181 | Ga0111539_10512605 | 3300009094 | Bacteria | 1397 |
| 182 | Ga0111539_11541672 | 3300009094 | Bacteria | 771 |
| 183 | Ga0105245_10000245 | 3300009098 | Bacteria | 51952 |
| 184 | Ga0105245_11129038 | 3300009098 | Bacteria | 830 |
| 185 | Ga0105245_11328017 | 3300009098 | Bacteria | 768 |
| 186 | Ga0105247_11393726 | 3300009101 | Unclassified | 567 |
| 187 | Ga0114129_10000219 | 3300009147 | Bacteria | 63579 |
| 188 | Ga0114129_10053431 | 3300009147 | Bacteria | 5665 |
| 189 | Ga0114129_12491464 | 3300009147 | Bacteria | 619 |
| 190 | Ga0105243_10000279 | 3300009148 | Bacteria | 56997 |
| 191 | Ga0105243_10035369 | 3300009148 | Bacteria | 3872 |
| 192 | Ga0105243_11684111 | 3300009148 | Bacteria | 663 |
| 193 | Ga0105241_10029972 | 3300009174 | Bacteria | 4064 |
| 194 | Ga0105242_10000480 | 3300009176 | Bacteria | 31755 |
| 195 | Ga0105248_10139905 | 3300009177 | Bacteria | 2730 |
| 196 | Ga0105248_10388289 | 3300009177 | Bacteria | 1572 |
| 197 | Ga0105237_11258178 | 3300009545 | Bacteria | 746 |
| 198 | Ga0105249_10001388 | 3300009553 | Bacteria | 21206 |
| 199 | Ga0105249_10003616 | 3300009553 | Bacteria | 13369 |
| 200 | Ga0105239_10284425 | 3300010375 | Bacteria | 1862 |
| 201 | Ga0157345_1010036 | 3300012498 | Bacteria | 818 |
| 202 | Ga0157369_10731336 | 3300013105 | Bacteria | 1018 |
| 203 | Ga0157378_10000294 | 3300013297 | Bacteria | 48405 |
| 204 | Ga0163162_10218721 | 3300013306 | Bacteria | 2035 |
| 205 | Ga0163162_10270340 | 3300013306 | Bacteria | 1831 |
| 206 | Ga0157372_10204428 | 3300013307 | Bacteria | 2288 |
| 207 | Ga0157375_10567393 | 3300013308 | Bacteria | 1296 |
| 208 | Ga0157380_10061130 | 3300014326 | Bacteria | 3013 |
| 209 | Ga0157380_13441885 | 3300014326 | Bacteria | 507 |
| 210 | Ga0157377_10247375 | 3300014745 | Bacteria | 1154 |
| 211 | Ga0207653_10011595 | 3300025885 | Bacteria | 2749 |
| 212 | Ga0207692_10006506 | 3300025898 | Bacteria | 4742 |
| 213 | Ga0207642_10000913 | 3300025899 | Bacteria | 9234 |
| 214 | Ga0207688_10020516 | 3300025901 | Bacteria | 3608 |
| 215 | Ga0207688_10190654 | 3300025901 | Bacteria | 1226 |
| 216 | Ga0207647_10037052 | 3300025904 | Bacteria | 3095 |
| 217 | Ga0207685_10114128 | 3300025905 | Bacteria | 1176 |
| 218 | Ga0207645_10253509 | 3300025907 | Bacteria | 1165 |
| 219 | Ga0207645_10456069 | 3300025907 | Bacteria | 863 |
| 220 | Ga0207643_10038216 | 3300025908 | Bacteria | 2696 |
| 221 | Ga0207643_10134949 | 3300025908 | Bacteria | 1471 |
| 222 | Ga0207684_10570821 | 3300025910 | Bacteria | 967 |
| 223 | Ga0207654_10010311 | 3300025911 | Bacteria | 4756 |
| 224 | Ga0207707_10002239 | 3300025912 | Bacteria | 17488 |
| 225 | Ga0207707_10205636 | 3300025912 | Bacteria | 1716 |
| 226 | Ga0207707_10288502 | 3300025912 | Bacteria | 1420 |
| 227 | Ga0207663_10352943 | 3300025916 | Bacteria | 1114 |
| 228 | Ga0207663_11117569 | 3300025916 | Bacteria | 634 |
| 229 | Ga0207660_10004569 | 3300025917 | Bacteria | 9015 |
| 230 | Ga0207660_10245533 | 3300025917 | Bacteria | 1412 |
| 231 | Ga0207660_10318649 | 3300025917 | Bacteria | 1241 |
| 232 | Ga0207660_10328845 | 3300025917 | Bacteria | 1222 |
| 233 | Ga0207662_10000285 | 3300025918 | Bacteria | 23452 |
| 234 | Ga0207662_10138015 | 3300025918 | Bacteria | 1542 |
| 235 | Ga0207662_10188327 | 3300025918 | Bacteria | 1331 |
| 236 | Ga0207662_10269198 | 3300025918 | Bacteria | 1124 |
| 237 | Ga0207662_10626435 | 3300025918 | Bacteria | 750 |
| 238 | Ga0207652_10029970 | 3300025921 | Bacteria | 4554 |
| 239 | Ga0207646_10785687 | 3300025922 | Bacteria | 848 |
| 240 | Ga0207681_10296737 | 3300025923 | Bacteria | 1277 |
| 241 | Ga0207659_10030671 | 3300025926 | Bacteria | 3675 |
| 242 | Ga0207687_10001352 | 3300025927 | Bacteria | 16793 |
| 243 | Ga0207700_10363290 | 3300025928 | Bacteria | 1263 |
| 244 | Ga0207664_10171573 | 3300025929 | Bacteria | 1857 |
| 245 | Ga0207706_10435461 | 3300025933 | Bacteria | 1135 |
| 246 | Ga0207686_10001979 | 3300025934 | Bacteria | 11292 |
| 247 | Ga0207709_10000549 | 3300025935 | Bacteria | 32146 |
| 248 | Ga0207709_10002601 | 3300025935 | Bacteria | 11247 |
| 249 | Ga0207670_10003216 | 3300025936 | Bacteria | 8653 |
| 250 | Ga0207670_10497576 | 3300025936 | Bacteria | 989 |
| 251 | Ga0207669_10025345 | 3300025937 | Bacteria | 3204 |
| 252 | Ga0207704_10007942 | 3300025938 | Bacteria | 5045 |
| 253 | Ga0207704_10252977 | 3300025938 | Bacteria | 1324 |
| 254 | Ga0207665_10501953 | 3300025939 | Bacteria | 937 |
| 255 | Ga0207665_10895233 | 3300025939 | Bacteria | 704 |
| 256 | Ga0207691_10027511 | 3300025940 | Bacteria | 5330 |
| 257 | Ga0207691_10144443 | 3300025940 | Bacteria | 2095 |
| 258 | Ga0207711_10220115 | 3300025941 | Bacteria | 1736 |
| 259 | Ga0207689_10000293 | 3300025942 | Bacteria | 45522 |
| 260 | Ga0207689_10028985 | 3300025942 | Bacteria | 4628 |
| 261 | Ga0207689_10970247 | 3300025942 | Bacteria | 717 |
| 262 | Ga0207667_10002578 | 3300025949 | Bacteria | 22517 |
| 263 | Ga0207651_10563432 | 3300025960 | Bacteria | 992 |
| 264 | Ga0207712_10000959 | 3300025961 | Bacteria | 20778 |
| 265 | Ga0207712_10001259 | 3300025961 | Bacteria | 17480 |
| 266 | Ga0207640_10003141 | 3300025981 | Bacteria | 8893 |
| 267 | Ga0207658_10906090 | 3300025986 | Bacteria | 803 |
| 268 | Ga0207677_10000669 | 3300026023 | Bacteria | 20376 |
| 269 | Ga0207703_10048738 | 3300026035 | Bacteria | 3421 |
| 270 | Ga0207639_10050576 | 3300026041 | Bacteria | 3157 |
| 271 | Ga0207708_10019059 | 3300026075 | Bacteria | 5167 |
| 272 | Ga0207708_10093936 | 3300026075 | Bacteria | 2315 |
| 273 | Ga0207702_10006239 | 3300026078 | Bacteria | 10305 |
| 274 | Ga0207648_10000185 | 3300026089 | Bacteria | 65925 |
| 275 | Ga0207648_10086304 | 3300026089 | Bacteria | 2738 |
| 276 | Ga0207674_10635153 | 3300026116 | Bacteria | 1031 |
| 277 | Ga0207675_100000150 | 3300026118 | Bacteria | 61064 |
| 278 | Ga0207675_100000812 | 3300026118 | Bacteria | 31052 |
| 279 | Ga0207698_10167404 | 3300026142 | Bacteria | 1931 |
| 280 | Ga0209967_1003247 | 3300027364 | Bacteria | 2140 |
| 281 | Ga0209981_1000782 | 3300027378 | Bacteria | 4014 |
| 282 | Ga0210000_1002477 | 3300027462 | Bacteria | 2628 |
| 283 | Ga0209588_1032497 | 3300027671 | Bacteria | 1672 |
| 284 | Ga0209588_1055415 | 3300027671 | Bacteria | 1281 |
| 285 | Ga0207428_10000290 | 3300027907 | Bacteria | 67367 |
| 286 | Ga0207428_10148564 | 3300027907 | Bacteria | 1785 |
| 287 | Ga0207428_10260527 | 3300027907 | Bacteria | 1292 |
| 288 | Ga0268265_10001010 | 3300028380 | Bacteria | 25458 |
| 289 | Ga0268265_10031660 | 3300028380 | Bacteria | 3821 |
| 290 | Ga0268265_11619770 | 3300028380 | Bacteria | 652 |
| 291 | Ga0268264_10000580 | 3300028381 | Bacteria | 44357 |
| 292 | Ga0265316_10018991 | 3300031344 | Bacteria | 5897 |
| 293 | Ga0265316_10374881 | 3300031344 | Bacteria | 1027 |
| 294 | Ga0307509_10866651 | 3300031507 | Bacteria | 568 |
| 295 | Ga0307408_100567135 | 3300031548 | Bacteria | 1004 |
| 296 | Ga0307408_100614634 | 3300031548 | Bacteria | 967 |
| 297 | Ga0307413_10565819 | 3300031824 | Bacteria | 925 |
| 298 | Ga0307412_10036695 | 3300031911 | Bacteria | 3143 |
| 299 | Ga0307412_10451548 | 3300031911 | Bacteria | 1059 |
| 300 | Ga0307412_10811776 | 3300031911 | Bacteria | 813 |
| 301 | Ga0307409_101501168 | 3300031995 | Bacteria | 701 |
| 302 | Ga0307416_100056591 | 3300032002 | Bacteria | 3166 |
| 303 | Ga0307416_100124639 | 3300032002 | Bacteria | 2305 |
| 304 | Ga0307416_100480552 | 3300032002 | Bacteria | 1302 |
| 305 | Ga0307416_100618117 | 3300032002 | Bacteria | 1165 |
| 306 | Ga0307416_100994916 | 3300032002 | Bacteria | 941 |
| 307 | Ga0307416_101135522 | 3300032002 | Bacteria | 886 |
| 308 | Ga0307416_102252803 | 3300032002 | Bacteria | 646 |
| 309 | Ga0307411_10118852 | 3300032005 | Bacteria | 1908 |
| 310 | Ga0307411_10487864 | 3300032005 | Bacteria | 1039 |
| 311 | Ga0307411_10818454 | 3300032005 | Bacteria | 821 |
| 312 | Ga0307415_100558325 | 3300032126 | Bacteria | 1012 |
| 313 | Ga0307415_100965244 | 3300032126 | Bacteria | 790 |
| 314 | Ga0307415_101285716 | 3300032126 | Bacteria | 692 |
| 315 | Ga0373930_0005659 | 3300034816 | Bacteria | 2085 |
| 316 | Ga0373950_0060394 | 3300034818 | Bacteria | 760 |
| 317 | Ga0373958_0064377 | 3300034819 | Bacteria | 801 |
| 318 | Ga0373938_0064950 | 3300034957 | Bacteria | 861 |
| 319 | Ga0373926_0003468 | 3300035083 | Bacteria | 5092 |
| 320 | Ga0373928_0162206 | 3300035084 | Bacteria | 625 |
| 321 | Ga0373929_0034185 | 3300035085 | Bacteria | 1101 |
| 322 | Ga0373934_0043110 | 3300035086 | Bacteria | 1783 |
| 323 | Ga0373940_0355254 | 3300035088 | Bacteria | 515 |
| 324 | Ga0373944_0051715 | 3300035089 | Bacteria | 1296 |
| 325 | Ga0373949_0042848 | 3300035090 | Bacteria | 1118 |
| 326 | Ga0373952_0001581 | 3300035092 | Bacteria | 4154 |
| 327 | Ga0373952_0019919 | 3300035092 | Bacteria | 1401 |
| 328 | Ga0373952_0022032 | 3300035092 | Bacteria | 1350 |
| 329 | Ga0373952_0024547 | 3300035092 | Bacteria | 1295 |
| 330 | Ga0373932_0005643 | 3300035112 | Bacteria | 2943 |
| 331 | Ga0373932_0125834 | 3300035112 | Bacteria | 859 |
| 332 | Ga0373932_0144706 | 3300035112 | Bacteria | 811 |
| 333 | Ga0373936_0006530 | 3300035113 | Bacteria | 4393 |
| 334 | Ga0373939_0054963 | 3300035114 | Bacteria | 1248 |
| 335 | Ga0373939_0255362 | 3300035114 | Bacteria | 684 |
| 336 | Ga0373941_0023589 | 3300035115 | Bacteria | 1758 |
| 337 | Ga0373941_0024345 | 3300035115 | Bacteria | 1738 |
| 338 | Ga0373941_0041270 | 3300035115 | Bacteria | 1427 |
| 339 | Ga0373945_0001983 | 3300035116 | Bacteria | 6358 |
| 340 | Ga0373953_0037524 | 3300035117 | Bacteria | 1912 |
| 341 | Ga0373953_0118763 | 3300035117 | Bacteria | 1122 |
| 342 | Ga0373954_0001511 | 3300035118 | Bacteria | 9463 |
| 343 | Ga0373956_0076665 | 3300035119 | Bacteria | 1530 |
| 344 | Ga0373957_0077834 | 3300035120 | Bacteria | 1305 |
| 345 | Ga0373955_0015830 | 3300035172 | Bacteria | 3699 |
| 346 | Ga0373942_0076624 | 3300035207 | Bacteria | 986 |
| 347 | Ga0373942_0248958 | 3300035207 | Bacteria | 603 |
| 348 | Ga0373961_0049213 | 3300035241 | Bacteria | 1245 |
| 349 | Ga0373962_0006941 | 3300035242 | Bacteria | 2759 |
| 350 | Ga0373962_0086573 | 3300035242 | Bacteria | 959 |
| 351 | Ga0373924_0015301 | 3300035410 | Bacteria | 2915 |
| 352 | Ga0373931_0001802 | 3300035691 | Bacteria | 9317 |
| 353 | Ga0373931_0037732 | 3300035691 | Bacteria | 2523 |
| 354 | Ga0373935_0195970 | 3300035692 | Bacteria | 1394 |
| 355 | Ga0373935_0363644 | 3300035692 | Bacteria | 1033 |
| 356 | Ga0373935_0766290 | 3300035692 | Bacteria | 711 |
| 357 | Ga0373927_0084775 | 3300035695 | Bacteria | 2055 |
| 358 | Ga0373927_0647041 | 3300035695 | Bacteria | 699 |
| 359 | Ga0373933_0006341 | 3300035724 | Bacteria | 6436 |
| 360 | Ga0373933_0028698 | 3300035724 | Bacteria | 3211 |
| 361 | Ga0373933_0299227 | 3300035724 | Bacteria | 1041 |
| 362 | Ga0373933_0635445 | 3300035724 | Bacteria | 701 |
| 363 | Ga0373947_0097992 | 3300035725 | Bacteria | 1838 |
| 364 | Ga0373937_0038399 | 3300036401 | Bacteria | 4362 |
| 365 | Ga0373937_0047453 | 3300036401 | Bacteria | 3929 |
| 366 | Ga0373937_0066894 | 3300036401 | Bacteria | 3310 |
| 367 | Ga0373937_0117705 | 3300036401 | Bacteria | 2475 |
| 368 | Ga0373937_2111944 | 3300036401 | Bacteria | 509 |
| 369 | Ga0373925_0029441 | 3300037068 | Bacteria | 4029 |
| 370 | Ga0373925_0169885 | 3300037068 | Bacteria | 1721 |
| 371 | Ga0373925_0504189 | 3300037068 | Bacteria | 994 |
| 372 | Ga0436365_1860246 | 3300039437 | Bacteria | 627 |
| 373 | Ga0436360_0435182 | 3300039438 | Bacteria | 859 |
| 374 | Ga0436363_0132198 | 3300039450 | Bacteria | 883 |
| 375 | Ga0436363_0210243 | 3300039450 | Bacteria | 727 |
| 376 | Ga0451807_1150880 | 3300041486 | Bacteria | 1010 |
| 377 | Ga0451839_0100477 | 3300041496 | Bacteria | 842 |
| 378 | Ga0451839_0404989 | 3300041496 | Bacteria | 817 |
| 379 | Ga0451839_0760959 | 3300041496 | Bacteria | 1052 |
| 380 | Ga0451849_1032019 | 3300041505 | Bacteria | 716 |
| 381 | Ga0451843_1223335 | 3300041509 | Bacteria | 1150 |
| 382 | Ga0439431_0044157 | 3300041997 | Bacteria | 1142 |
| 383 | Ga0439441_009068 | 3300042001 | Bacteria | 1639 |
| 384 | Ga0439446_0086173 | 3300042156 | Bacteria | 978 |
| 385 | Ga0439434_0046342 | 3300042435 | Bacteria | 1342 |
| 386 | Ga0439434_0047796 | 3300042435 | Bacteria | 1322 |
| 387 | Ga0439435_0009935 | 3300042436 | Bacteria | 2245 |
| 388 | Ga0439444_0004549 | 3300042437 | Bacteria | 2022 |
| 389 | Ga0439464_0128884 | 3300042439 | Bacteria | 783 |
| 390 | Ga0451577_0104973 | 3300042876 | Bacteria | 2525 |
| 391 | Ga0466965_0443298 | 3300044683 | Bacteria | 722 |
| 392 | Ga0466964_0157565 | 3300044706 | Bacteria | 1058 |
| 393 | Ga0453684_0005767 | 3300044712 | Bacteria | 24180 |
| 394 | Ga0453684_2150294 | 3300044712 | Bacteria | 558 |
| 395 | Ga0466971_0345568 | 3300044719 | Bacteria | 719 |
| 396 | Ga0466960_0203021 | 3300044901 | Bacteria | 1084 |
| 397 | Ga0451576_0001107 | 3300045051 | Bacteria | 49185 |
| 398 | Ga0451576_0053818 | 3300045051 | Bacteria | 4214 |
| 399 | Ga0451576_0330463 | 3300045051 | Bacteria | 1595 |
| 400 | Ga0451576_0425970 | 3300045051 | Bacteria | 1392 |
| 401 | Ga0451576_0493615 | 3300045051 | Bacteria | 1286 |
| 402 | Ga0495592_0283137 | 3300046454 | Bacteria | 1084 |
| 403 | Ga0495603_0023231 | 3300046455 | Bacteria | 3754 |
| 404 | Ga0495603_0165540 | 3300046455 | Bacteria | 1282 |
| 405 | Ga0495629_0227091 | 3300046459 | Bacteria | 1287 |
| 406 | Ga0495653_0361940 | 3300046463 | Bacteria | 931 |
| 407 | Ga0495580_0005567 | 3300046472 | Bacteria | 10387 |
| 408 | Ga0495582_0073235 | 3300046473 | Bacteria | 1896 |
| 409 | Ga0495639_0035947 | 3300046475 | Bacteria | 2217 |
| 410 | Ga0495662_0013878 | 3300046476 | Bacteria | 3921 |
| 411 | Ga0495608_0000767 | 3300046511 | Bacteria | 22475 |
| 412 | Ga0495608_0547506 | 3300046511 | Bacteria | 697 |
| 413 | Ga0495618_0009252 | 3300046514 | Bacteria | 5945 |
| 414 | Ga0495618_0441998 | 3300046514 | Bacteria | 790 |
| 415 | Ga0495628_0001090 | 3300046516 | Bacteria | 24809 |
| 416 | Ga0495630_0001546 | 3300046517 | Bacteria | 15988 |
| 417 | Ga0495630_0078786 | 3300046517 | Bacteria | 2485 |
| 418 | Ga0495630_0143014 | 3300046517 | Bacteria | 1819 |
| 419 | Ga0495630_0259875 | 3300046517 | Bacteria | 1326 |
| 420 | Ga0495666_0034170 | 3300046526 | Bacteria | 2481 |
| 421 | Ga0495652_0044840 | 3300046529 | Bacteria | 3806 |
| 422 | Ga0495652_0052673 | 3300046529 | Bacteria | 3470 |
| 423 | Ga0495665_0093296 | 3300046531 | Bacteria | 1582 |
| 424 | Ga0495640_0005052 | 3300046533 | Bacteria | 10476 |
| 425 | Ga0495640_0231639 | 3300046533 | Bacteria | 1161 |
| 426 | Ga0495586_0000790 | 3300046535 | Bacteria | 18209 |
| 427 | Ga0495587_0026751 | 3300046536 | Bacteria | 3514 |
| 428 | Ga0495598_0243269 | 3300046537 | Bacteria | 664 |
| 429 | Ga0495645_0408147 | 3300046543 | Bacteria | 864 |
| 430 | Ga0495667_0000941 | 3300046559 | Bacteria | 18791 |
| 431 | Ga0495634_0000957 | 3300046642 | Bacteria | 27315 |
| 432 | Ga0495635_0025694 | 3300046663 | Bacteria | 4103 |
| 433 | Ga0495635_0380217 | 3300046663 | Bacteria | 940 |
| 434 | Ga0495659_0013310 | 3300046664 | Bacteria | 2679 |
| 435 | Ga0495657_0117720 | 3300046675 | Bacteria | 1676 |
| 436 | Ga0495599_0057194 | 3300046678 | Bacteria | 2440 |
| 437 | Ga0495647_0000304 | 3300046681 | Bacteria | 13816 |
| 438 | Ga0495658_0014094 | 3300046683 | Bacteria | 4076 |
| 439 | Ga0495658_0048489 | 3300046683 | Bacteria | 2395 |
| 440 | Ga0495669_0010927 | 3300046684 | Bacteria | 3842 |
| 441 | Ga0495669_0250381 | 3300046684 | Bacteria | 851 |
| 442 | Ga0495624_0080945 | 3300046690 | Bacteria | 2012 |
| 443 | Ga0495624_0182826 | 3300046690 | Bacteria | 1277 |
| 444 | Ga0495624_0262093 | 3300046690 | Bacteria | 1044 |
| 445 | Ga0495670_0368472 | 3300046691 | Bacteria | 774 |
| 446 | Ga0495600_0013997 | 3300046809 | Bacteria | 5055 |
| 447 | Ga0495581_0100413 | 3300047315 | Bacteria | 1681 |
| 448 | Ga0495581_0245736 | 3300047315 | Bacteria | 1046 |
| 449 | Ga0495604_0007822 | 3300047317 | Bacteria | 8463 |
| 450 | Ga0495604_0133473 | 3300047317 | Bacteria | 1782 |
| 451 | Ga0495636_0250262 | 3300047318 | Bacteria | 819 |
| 452 | Ga0495676_0036800 | 3300047321 | Bacteria | 4082 |
| 453 | Ga0495680_0002465 | 3300047322 | Bacteria | 18939 |
| 454 | Ga0495680_0104671 | 3300047322 | Bacteria | 2105 |
| 455 | Ga0495677_0174578 | 3300047445 | Bacteria | 832 |
| 456 | Ga0495684_0399302 | 3300047471 | Bacteria | 965 |
| 457 | Ga0496109_0707805 | 3300048912 | Bacteria | 945 |
| 458 | Ga0501291_004472 | 3300049514 | Bacteria | 1788 |
| 459 | Ga0501297_018511 | 3300049520 | Bacteria | 855 |
| 460 | Ga0501031_0175943 | 3300049568 | Bacteria | 1398 |
| 461 | Ga0501031_0275344 | 3300049568 | Bacteria | 1092 |
| 462 | Ga0501031_0727779 | 3300049568 | Bacteria | 637 |
| 463 | Ga0501032_0255336 | 3300049569 | Bacteria | 1137 |
| 464 | Ga0501034_0946447 | 3300049571 | Bacteria | 747 |
| 465 | Ga0501036_0013192 | 3300049572 | Bacteria | 6863 |
| 466 | Ga0501036_0082064 | 3300049572 | Bacteria | 2725 |
| 467 | Ga0501036_0353614 | 3300049572 | Bacteria | 1227 |
| 468 | Ga0501037_0161709 | 3300049573 | Bacteria | 1596 |
| 469 | Ga0501037_0194123 | 3300049573 | Bacteria | 1437 |
| 470 | Ga0501038_0007492 | 3300049574 | Bacteria | 10065 |
| 471 | Ga0501038_0150351 | 3300049574 | Bacteria | 1899 |
| 472 | Ga0501038_0173450 | 3300049574 | Bacteria | 1744 |
| 473 | Ga0501038_1327321 | 3300049574 | Unclassified | 519 |
| 474 | Ga0501039_0039139 | 3300049575 | Bacteria | 3662 |
| 475 | Ga0501039_0046020 | 3300049575 | Bacteria | 3371 |
| 476 | Ga0501039_0106931 | 3300049575 | Bacteria | 2185 |
| 477 | Ga0501039_0405570 | 3300049575 | Bacteria | 1070 |
| 478 | Ga0501040_0030621 | 3300049576 | Bacteria | 3635 |
| 479 | Ga0501040_0205115 | 3300049576 | Bacteria | 1400 |
| 480 | Ga0501040_0609479 | 3300049576 | Bacteria | 789 |
| 481 | Ga0501040_0725776 | 3300049576 | Bacteria | 719 |
| 482 | Ga0501041_0002591 | 3300049577 | Bacteria | 10314 |
| 483 | Ga0501041_0143185 | 3300049577 | Bacteria | 1491 |
| 484 | Ga0501041_0269754 | 3300049577 | Bacteria | 1070 |
| 485 | Ga0501042_0199581 | 3300049578 | Bacteria | 1442 |
| 486 | Ga0501042_0282669 | 3300049578 | Bacteria | 1198 |
| 487 | Ga0501042_0354323 | 3300049578 | Bacteria | 1062 |
| 488 | Ga0501042_0509277 | 3300049578 | Bacteria | 874 |
| 489 | Ga0501042_0999069 | 3300049578 | Bacteria | 610 |
| 490 | Ga0501043_0214531 | 3300049579 | Bacteria | 1491 |
| 491 | Ga0501043_0728548 | 3300049579 | Bacteria | 722 |
| 492 | Ga0501046_0111666 | 3300049580 | Bacteria | 2087 |
| 493 | Ga0501046_0176322 | 3300049580 | Bacteria | 1601 |
| 494 | Ga0501048_0020297 | 3300049582 | Bacteria | 4870 |
| 495 | Ga0501048_0047309 | 3300049582 | Bacteria | 3069 |
| 496 | Ga0501048_0304880 | 3300049582 | Bacteria | 1133 |
| 497 | Ga0501048_0415730 | 3300049582 | Bacteria | 962 |
| 498 | Ga0501048_0561559 | 3300049582 | Bacteria | 819 |
| 499 | Ga0501048_0603102 | 3300049582 | Bacteria | 788 |
| 500 | Ga0501048_0678153 | 3300049582 | Bacteria | 740 |
| 501 | Ga0501048_0941674 | 3300049582 | Bacteria | 621 |
| 502 | Ga0501068_0023674 | 3300049584 | Bacteria | 3601 |
| 503 | Ga0501069_0265760 | 3300049585 | Bacteria | 1002 |
| 504 | Ga0501071_0006939 | 3300049587 | Bacteria | 7390 |
| 505 | Ga0501071_0008794 | 3300049587 | Bacteria | 6691 |
| 506 | Ga0501071_0164986 | 3300049587 | Bacteria | 1657 |
| 507 | Ga0501071_0350970 | 3300049587 | Bacteria | 1123 |
| 508 | Ga0501072_0058372 | 3300049588 | Bacteria | 3042 |
| 509 | Ga0501072_0076655 | 3300049588 | Bacteria | 2645 |
| 510 | Ga0501072_0266316 | 3300049588 | Bacteria | 1363 |
| 511 | Ga0501072_0386767 | 3300049588 | Bacteria | 1110 |
| 512 | Ga0501072_1310184 | 3300049588 | Bacteria | 561 |
| 513 | Ga0501073_0223288 | 3300049589 | Bacteria | 1301 |
| 514 | Ga0501073_0360847 | 3300049589 | Bacteria | 1003 |
| 515 | Ga0501073_0609725 | 3300049589 | Bacteria | 754 |
| 516 | Ga0501073_0880149 | 3300049589 | Bacteria | 617 |
| 517 | Ga0501074_0050093 | 3300049590 | Bacteria | 3015 |
| 518 | Ga0501074_0244649 | 3300049590 | Bacteria | 1276 |
| 519 | Ga0501074_0377690 | 3300049590 | Bacteria | 1005 |
| 520 | Ga0501075_0002081 | 3300049591 | Bacteria | 13218 |
| 521 | Ga0501075_0018354 | 3300049591 | Bacteria | 5062 |
| 522 | Ga0501075_0232316 | 3300049591 | Bacteria | 1406 |
| 523 | Ga0501075_0772674 | 3300049591 | Bacteria | 731 |
| 524 | Ga0501076_0003361 | 3300049592 | Bacteria | 11230 |
| 525 | Ga0501076_0004745 | 3300049592 | Bacteria | 9700 |
| 526 | Ga0501076_0178619 | 3300049592 | Bacteria | 1730 |
| 527 | Ga0501076_0433033 | 3300049592 | Bacteria | 1082 |
| 528 | Ga0501076_0922662 | 3300049592 | Bacteria | 720 |
| 529 | Ga0501077_0039802 | 3300049593 | Bacteria | 2994 |
| 530 | Ga0501077_0316384 | 3300049593 | Bacteria | 995 |
| 531 | Ga0501253_216035 | 3300049683 | Bacteria | 512 |
| 532 | Ga0501257_123734 | 3300049686 | Bacteria | 695 |
| 533 | Ga0501079_0025100 | 3300049741 | Bacteria | 4572 |
| 534 | Ga0501079_0193061 | 3300049741 | Bacteria | 1590 |
| 535 | Ga0501079_0321155 | 3300049741 | Bacteria | 1212 |
| 536 | Ga0501079_0350600 | 3300049741 | Bacteria | 1156 |
| 537 | Ga0501080_0000502 | 3300049742 | Bacteria | 30705 |
| 538 | Ga0501080_0023192 | 3300049742 | Bacteria | 5755 |
| 539 | Ga0501080_0115785 | 3300049742 | Bacteria | 2485 |
| 540 | Ga0501080_0644027 | 3300049742 | Bacteria | 938 |
| 541 | Ga0501081_0018316 | 3300049743 | Bacteria | 4648 |
| 542 | Ga0501081_0021954 | 3300049743 | Bacteria | 4265 |
| 543 | Ga0501081_0179698 | 3300049743 | Bacteria | 1530 |
| 544 | Ga0501081_0235188 | 3300049743 | Bacteria | 1335 |
| 545 | Ga0501081_0395352 | 3300049743 | Bacteria | 1023 |
| 546 | Ga0501083_0225342 | 3300049744 | Bacteria | 1221 |
| 547 | Ga0501083_0381419 | 3300049744 | Bacteria | 917 |
| 548 | Ga0501035_0407409 | 3300049822 | Bacteria | 1130 |
| 549 | Ga0501035_1389779 | 3300049822 | Bacteria | 538 |
| 550 | Ga0501045_0004712 | 3300049824 | Bacteria | 9418 |
| 551 | Ga0501045_0028922 | 3300049824 | Bacteria | 4000 |
| 552 | Ga0501045_0035938 | 3300049824 | Bacteria | 3597 |
| 553 | Ga0501045_1106240 | 3300049824 | Bacteria | 579 |
| 554 | Ga0501204_088375 | 3300049850 | Bacteria | 537 |
| 555 | nmdc:mga00v17_35964_c1 | 3300050491 | Bacteria | 2950 |
| 556 | nmdc:mga05p37_389_c1 | 3300050507 | Bacteria | 47594 |
| 557 | nmdc:mga05p37_45015_c1 | 3300050507 | Bacteria | 5429 |
| 558 | nmdc:mga09592_304370_c1 | 3300050508 | Bacteria | 1382 |
| 559 | nmdc:mga09592_34542_c1 | 3300050508 | Bacteria | 4227 |
| 560 | nmdc:mga09592_542054_c1 | 3300050508 | Bacteria | 1000 |
| 561 | nmdc:mga09592_82027_c1 | 3300050508 | Bacteria | 2748 |
| 562 | nmdc:mga0qj67_307700_c1 | 3300050509 | Bacteria | 1284 |
| 563 | nmdc:mga0qj67_79719_c1 | 3300050509 | Bacteria | 2623 |
| 564 | nmdc:mga06r32_1020465_c1 | 3300050510 | Bacteria | 779 |
| 565 | nmdc:mga06r32_1092963_c1 | 3300050510 | Bacteria | 747 |
| 566 | nmdc:mga06r32_1321144_c1 | 3300050510 | Bacteria | 665 |
| 567 | nmdc:mga06r32_822135_c1 | 3300050510 | Bacteria | 889 |
| 568 | nmdc:mga08y16_1010092_c1 | 3300050511 | Bacteria | 811 |
| 569 | nmdc:mga08y16_115995_c1 | 3300050511 | Bacteria | 2788 |
| 570 | nmdc:mga08y16_198287_c1 | 3300050511 | Bacteria | 2081 |
| 571 | nmdc:mga08y16_5420_c1 | 3300050511 | Bacteria | 13338 |
| 572 | nmdc:mga08y16_686592_c1 | 3300050511 | Bacteria | 1025 |
| 573 | nmdc:mga08y16_721077_c1 | 3300050511 | Bacteria | 995 |
| 574 | nmdc:mga0n895_1129388_c1 | 3300050512 | Bacteria | 760 |
| 575 | nmdc:mga0n895_1165355_c1 | 3300050512 | Bacteria | 746 |
| 576 | nmdc:mga0n895_166929_c1 | 3300050512 | Bacteria | 2233 |
| 577 | nmdc:mga0n895_189176_c1 | 3300050512 | Bacteria | 2090 |
| 578 | nmdc:mga0n895_42017_c1 | 3300050512 | Bacteria | 4447 |
| 579 | nmdc:mga0n895_734_c1 | 3300050512 | Bacteria | 23141 |
| 580 | nmdc:mga0n895_807251_c1 | 3300050512 | Bacteria | 928 |
| 581 | nmdc:mga0n895_81695_c1 | 3300050512 | Bacteria | 3221 |
| 582 | nmdc:mga0rr50_193612_c1 | 3300050513 | Bacteria | 1667 |
| 583 | nmdc:mga0rr50_228516_c1 | 3300050513 | Bacteria | 1539 |
| 584 | nmdc:mga0rr50_27655_c1 | 3300050513 | Bacteria | 3975 |
| 585 | nmdc:mga0rr50_316265_c1 | 3300050513 | Bacteria | 1308 |
| 586 | nmdc:mga0rr50_4968_c1 | 3300050513 | Bacteria | 7875 |
| 587 | nmdc:mga0rr50_7917_c1 | 3300050513 | Bacteria | 6593 |
| 588 | nmdc:mga0rr50_91960_c1 | 3300050513 | Bacteria | 2364 |
| 589 | nmdc:mga08x19_113031_c1 | 3300050514 | Bacteria | 1813 |
| 590 | nmdc:mga08x19_21818_c1 | 3300050514 | Bacteria | 3957 |
| 591 | nmdc:mga08x19_23320_c1 | 3300050514 | Bacteria | 3839 |
| 592 | nmdc:mga08x19_258_c1 | 3300050514 | Bacteria | 28365 |
| 593 | nmdc:mga08x19_381080_c1 | 3300050514 | Bacteria | 988 |
| 594 | nmdc:mga08x19_66083_c1 | 3300050514 | Bacteria | 2350 |
| 595 | nmdc:mga08x19_66559_c1 | 3300050514 | Bacteria | 2342 |
| 596 | nmdc:mga08x19_84428_c1 | 3300050514 | Bacteria | 2089 |
| 597 | nmdc:mga0a205_137_c1 | 3300050515 | Bacteria | 46112 |
| 598 | nmdc:mga0a205_377092_c1 | 3300050515 | Bacteria | 1284 |
| 599 | nmdc:mga0a205_44949_c1 | 3300050515 | Bacteria | 4259 |
| 600 | nmdc:mga0a205_545975_c1 | 3300050515 | Bacteria | 1014 |
| 601 | Ga0495601_0192052 | 3300053077 | Bacteria | 1334 |
| 602 | Ga0495595_0368492 | 3300053084 | Bacteria | 726 |
| 603 | Ga0495619_0188567 | 3300053085 | Bacteria | 1427 |
| 604 | Ga0501084_0033552 | 3300054114 | Bacteria | 4294 |
| 605 | Ga0501084_0037733 | 3300054114 | Bacteria | 4038 |
| 606 | Ga0501084_0078625 | 3300054114 | Bacteria | 2765 |
| 607 | Ga0501084_0123263 | 3300054114 | Bacteria | 2180 |
| 608 | Ga0501084_0623812 | 3300054114 | Bacteria | 911 |
| 609 | Ga0501084_1332512 | 3300054114 | Bacteria | 601 |
| 610 | Ga0501084_1434633 | 3300054114 | Bacteria | 578 |
| 611 | Ga0590071_063953 | 3300059421 | Bacteria | 902 |
| 612 | Ga0501082_0048685 | 3300060353 | Bacteria | 3653 |
| 613 | Ga0501082_0082355 | 3300060353 | Bacteria | 2777 |
| 614 | Ga0501082_0324336 | 3300060353 | Bacteria | 1342 |
| 615 | Ga0530510_0014387 | 3300061734 | Bacteria | 5579 |
| 616 | Ga0530510_0418221 | 3300061734 | Bacteria | 1011 |
| 617 | Ga0530510_0457034 | 3300061734 | Bacteria | 966 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041496 | Ga0451839_0100477 | Ga0451839_0100477_426_818 | 111 |
| 2 | 3300031344 | Ga0265316_10018991 | Ga0265316_100189918 | 116 |
| 3 | 3300044712 | Ga0453684_2150294 | Ga0453684_2150294_20_451 | 124 |
| 4 | 3300005440 | Ga0070705_100720626 | Ga0070705_1007206262 | 128 |
| 5 | 3300005546 | Ga0070696_100493894 | Ga0070696_1004938943 | 128 |
| 6 | 3300005719 | Ga0068861_100345438 | Ga0068861_1003454383 | 128 |
| 7 | 3300031507 | Ga0307509_10866651 | Ga0307509_108666511 | 128 |
| 8 | 3300036401 | Ga0373937_0066894 | Ga0373937_0066894_1189_1632 | 128 |
| 9 | 3300041509 | Ga0451843_1223335 | Ga0451843_1223335_184_618 | 128 |
| 10 | 3300046463 | Ga0495653_0361940 | Ga0495653_0361940_88_531 | 128 |
| 11 | 3300046511 | Ga0495608_0000767 | Ga0495608_0000767_13811_14254 | 128 |
| 12 | 3300046514 | Ga0495618_0009252 | Ga0495618_0009252_3763_4206 | 128 |
| 13 | 3300046516 | Ga0495628_0001090 | Ga0495628_0001090_23353_23796 | 128 |
| 14 | 3300046517 | Ga0495630_0001546 | Ga0495630_0001546_15392_15835 | 128 |
| 15 | 3300046529 | Ga0495652_0052673 | Ga0495652_0052673_1527_1970 | 128 |
| 16 | 3300046533 | Ga0495640_0005052 | Ga0495640_0005052_1812_2255 | 128 |
| 17 | 3300046535 | Ga0495586_0000790 | Ga0495586_0000790_16546_16989 | 128 |
| 18 | 3300046536 | Ga0495587_0026751 | Ga0495587_0026751_1387_1830 | 128 |
| 19 | 3300046559 | Ga0495667_0000941 | Ga0495667_0000941_16586_17029 | 128 |
| 20 | 3300046642 | Ga0495634_0000957 | Ga0495634_0000957_4674_5117 | 128 |
| 21 | 3300046678 | Ga0495599_0057194 | Ga0495599_0057194_1230_1673 | 128 |
| 22 | 3300046683 | Ga0495658_0048489 | Ga0495658_0048489_570_1013 | 128 |
| 23 | 3300046690 | Ga0495624_0080945 | Ga0495624_0080945_601_1044 | 128 |
| 24 | 3300046809 | Ga0495600_0013997 | Ga0495600_0013997_2106_2549 | 128 |
| 25 | 3300047317 | Ga0495604_0007822 | Ga0495604_0007822_3678_4121 | 128 |
| 26 | 3300047322 | Ga0495680_0002465 | Ga0495680_0002465_4918_5361 | 128 |
| 27 | 3300047471 | Ga0495684_0399302 | Ga0495684_0399302_72_515 | 128 |
| 28 | 3300049575 | Ga0501039_0405570 | Ga0501039_0405570_412_840 | 128 |
| 29 | 3300049576 | Ga0501040_0609479 | Ga0501040_0609479_195_623 | 128 |
| 30 | 3300049582 | Ga0501048_0561559 | Ga0501048_0561559_253_681 | 128 |
| 31 | 3300049588 | Ga0501072_0386767 | Ga0501072_0386767_530_958 | 128 |
| 32 | 3300049591 | Ga0501075_0232316 | Ga0501075_0232316_388_816 | 128 |
| 33 | 3300049592 | Ga0501076_0003361 | Ga0501076_0003361_633_1061 | 128 |
| 34 | 3300049743 | Ga0501081_0179698 | Ga0501081_0179698_677_1105 | 128 |
| 35 | 3300053077 | Ga0495601_0192052 | Ga0495601_0192052_133_576 | 128 |
| 36 | 3300053084 | Ga0495595_0368492 | Ga0495595_0368492_202_645 | 128 |
| 37 | 3300053085 | Ga0495619_0188567 | Ga0495619_0188567_923_1366 | 128 |
| 38 | 3300054114 | Ga0501084_1332512 | Ga0501084_1332512_14_442 | 128 |
| 39 | 3300005444 | Ga0070694_100100526 | Ga0070694_1001005263 | 129 |
| 40 | 3300005546 | Ga0070696_100508102 | Ga0070696_1005081022 | 129 |
| 41 | 3300005549 | Ga0070704_100064757 | Ga0070704_1000647574 | 129 |
| 42 | 3300005844 | Ga0068862_101050474 | Ga0068862_1010504742 | 129 |
| 43 | 3300025922 | Ga0207646_10785687 | Ga0207646_107856872 | 129 |
| 44 | 3300035242 | Ga0373962_0086573 | Ga0373962_0086573_551_940 | 129 |
| 45 | 3300036401 | Ga0373937_2111944 | Ga0373937_2111944_93_485 | 129 |
| 46 | 3300049824 | Ga0501045_1106240 | Ga0501045_1106240_101_529 | 129 |
| 47 | 3300005458 | Ga0070681_10145543 | Ga0070681_101455432 | 130 |
| 48 | 3300006852 | Ga0075433_10539614 | Ga0075433_105396142 | 130 |
| 49 | 3300006871 | Ga0075434_100000079 | Ga0075434_10000007938 | 130 |
| 50 | 3300006914 | Ga0075436_100076432 | Ga0075436_1000764322 | 130 |
| 51 | 3300007076 | Ga0075435_100027298 | Ga0075435_1000272982 | 130 |
| 52 | 3300013307 | Ga0157372_10204428 | Ga0157372_102044282 | 130 |
| 53 | 3300025912 | Ga0207707_10288502 | Ga0207707_102885023 | 130 |
| 54 | 3300035724 | Ga0373933_0299227 | Ga0373933_0299227_481_933 | 130 |
| 55 | 3300036401 | Ga0373937_0117705 | Ga0373937_0117705_220_672 | 130 |
| 56 | 3300042001 | Ga0439441_009068 | Ga0439441_009068_629_1114 | 130 |
| 57 | 3300050512 | nmdc:mga0n895_734_c1 | nmdc:mga0n895_734_c1_14891_15346 | 130 |
| 58 | 3300050513 | nmdc:mga0rr50_4968_c1 | nmdc:mga0rr50_4968_c1_4248_4703 | 130 |
| 59 | 3300050514 | nmdc:mga08x19_66083_c1 | nmdc:mga08x19_66083_c1_377_832 | 130 |
| 60 | 3300007265 | Ga0099794_10244627 | Ga0099794_102446272 | 131 |
| 61 | 3300027671 | Ga0209588_1055415 | Ga0209588_10554152 | 131 |
| 62 | 3300039438 | Ga0436360_0435182 | Ga0436360_0435182_228_677 | 131 |
| 63 | 3300005440 | Ga0070705_100002781 | Ga0070705_10000278111 | 132 |
| 64 | 3300005444 | Ga0070694_100081232 | Ga0070694_1000812323 | 132 |
| 65 | 3300005467 | Ga0070706_100429431 | Ga0070706_1004294311 | 132 |
| 66 | 3300005518 | Ga0070699_100008554 | Ga0070699_1000085542 | 132 |
| 67 | 3300005536 | Ga0070697_100001557 | Ga0070697_10000155711 | 132 |
| 68 | 3300005545 | Ga0070695_100001505 | Ga0070695_1000015055 | 132 |
| 69 | 3300005546 | Ga0070696_100005214 | Ga0070696_1000052146 | 132 |
| 70 | 3300006051 | Ga0075364_10012099 | Ga0075364_100120994 | 132 |
| 71 | 3300006871 | Ga0075434_100027998 | Ga0075434_1000279984 | 132 |
| 72 | 3300006914 | Ga0075436_100034418 | Ga0075436_1000344185 | 132 |
| 73 | 3300025910 | Ga0207684_10570821 | Ga0207684_105708213 | 132 |
| 74 | 3300039450 | Ga0436363_0210243 | Ga0436363_0210243_169_633 | 132 |
| 75 | 3300044712 | Ga0453684_0005767 | Ga0453684_0005767_17613_18047 | 132 |
| 76 | 3300049585 | Ga0501069_0265760 | Ga0501069_0265760_263_718 | 132 |
| 77 | 3300049593 | Ga0501077_0316384 | Ga0501077_0316384_74_538 | 132 |
| 78 | 3300050491 | nmdc:mga00v17_35964_c1 | nmdc:mga00v17_35964_c1_2115_2624 | 132 |
| 79 | 3300050512 | nmdc:mga0n895_42017_c1 | nmdc:mga0n895_42017_c1_3829_4275 | 132 |
| 80 | 3300050514 | nmdc:mga08x19_84428_c1 | nmdc:mga08x19_84428_c1_99_554 | 132 |
| 81 | 3300005330 | Ga0070690_100016772 | Ga0070690_1000167724 | 133 |
| 82 | 3300005535 | Ga0070684_100100681 | Ga0070684_1001006813 | 133 |
| 83 | 3300005544 | Ga0070686_100004514 | Ga0070686_1000045146 | 133 |
| 84 | 3300005547 | Ga0070693_100360433 | Ga0070693_1003604331 | 133 |
| 85 | 3300005615 | Ga0070702_100851299 | Ga0070702_1008512992 | 133 |
| 86 | 3300005842 | Ga0068858_100561221 | Ga0068858_1005612213 | 133 |
| 87 | 3300006237 | Ga0097621_100000756 | Ga0097621_10000075617 | 133 |
| 88 | 3300006358 | Ga0068871_100000588 | Ga0068871_10000058819 | 133 |
| 89 | 3300006844 | Ga0075428_100257457 | Ga0075428_1002574572 | 133 |
| 90 | 3300009101 | Ga0105247_11393726 | Ga0105247_113937261 | 133 |
| 91 | 3300009147 | Ga0114129_12491464 | Ga0114129_124914641 | 133 |
| 92 | 3300009177 | Ga0105248_10388289 | Ga0105248_103882892 | 133 |
| 93 | 3300025918 | Ga0207662_10138015 | Ga0207662_101380153 | 133 |
| 94 | 3300035092 | Ga0373952_0022032 | Ga0373952_0022032_321_770 | 133 |
| 95 | 3300035115 | Ga0373941_0041270 | Ga0373941_0041270_891_1340 | 133 |
| 96 | 3300035241 | Ga0373961_0049213 | Ga0373961_0049213_306_755 | 133 |
| 97 | 3300049578 | Ga0501042_0999069 | Ga0501042_0999069_16_420 | 133 |
| 98 | 3300050512 | nmdc:mga0n895_166929_c1 | nmdc:mga0n895_166929_c1_1697_2146 | 133 |
| 99 | 3300035724 | Ga0373933_0635445 | Ga0373933_0635445_138_584 | 134 |
| 100 | 3300046517 | Ga0495630_0143014 | Ga0495630_0143014_992_1438 | 134 |
| 101 | 3300046529 | Ga0495652_0044840 | Ga0495652_0044840_1361_1807 | 134 |
| 102 | 3300046663 | Ga0495635_0380217 | Ga0495635_0380217_467_913 | 134 |
| 103 | 3300046684 | Ga0495669_0250381 | Ga0495669_0250381_324_779 | 134 |
| 104 | 3300054114 | Ga0501084_1434633 | Ga0501084_1434633_60_512 | 134 |
| 105 | 3300005345 | Ga0070692_10760541 | Ga0070692_107605412 | 135 |
| 106 | 3300006871 | Ga0075434_100172686 | Ga0075434_1001726862 | 135 |
| 107 | 3300007076 | Ga0075435_100294934 | Ga0075435_1002949342 | 135 |
| 108 | 3300031995 | Ga0307409_101501168 | Ga0307409_1015011682 | 135 |
| 109 | 3300032126 | Ga0307415_100558325 | Ga0307415_1005583252 | 135 |
| 110 | 3300035088 | Ga0373940_0355254 | Ga0373940_0355254_51_500 | 135 |
| 111 | 3300035207 | Ga0373942_0076624 | Ga0373942_0076624_513_968 | 135 |
| 112 | 3300045051 | Ga0451576_0493615 | Ga0451576_0493615_679_1149 | 135 |
| 113 | 3300050512 | nmdc:mga0n895_807251_c1 | nmdc:mga0n895_807251_c1_430_867 | 135 |
| 114 | 3300050513 | nmdc:mga0rr50_193612_c1 | nmdc:mga0rr50_193612_c1_865_1302 | 135 |
| 115 | 3300005355 | Ga0070671_100229083 | Ga0070671_1002290832 | 136 |
| 116 | 3300009094 | Ga0111539_11541672 | Ga0111539_115416723 | 136 |
| 117 | 3300035207 | Ga0373942_0248958 | Ga0373942_0248958_53_514 | 136 |
| 118 | 3300044706 | Ga0466964_0157565 | Ga0466964_0157565_434_892 | 136 |
| 119 | 3300044719 | Ga0466971_0345568 | Ga0466971_0345568_193_651 | 136 |
| 120 | 3300049573 | Ga0501037_0194123 | Ga0501037_0194123_328_780 | 136 |
| 121 | 3300049574 | Ga0501038_0173450 | Ga0501038_0173450_951_1403 | 136 |
| 122 | 3300049575 | Ga0501039_0039139 | Ga0501039_0039139_1772_2224 | 136 |
| 123 | 3300049582 | Ga0501048_0304880 | Ga0501048_0304880_221_673 | 136 |
| 124 | 3300049584 | Ga0501068_0023674 | Ga0501068_0023674_97_549 | 136 |
| 125 | 3300049587 | Ga0501071_0006939 | Ga0501071_0006939_5359_5811 | 136 |
| 126 | 3300049588 | Ga0501072_0076655 | Ga0501072_0076655_1277_1729 | 136 |
| 127 | 3300049589 | Ga0501073_0223288 | Ga0501073_0223288_529_981 | 136 |
| 128 | 3300049590 | Ga0501074_0377690 | Ga0501074_0377690_373_825 | 136 |
| 129 | 3300049591 | Ga0501075_0018354 | Ga0501075_0018354_1424_1876 | 136 |
| 130 | 3300049592 | Ga0501076_0178619 | Ga0501076_0178619_219_671 | 136 |
| 131 | 3300049741 | Ga0501079_0025100 | Ga0501079_0025100_2571_3023 | 136 |
| 132 | 3300049742 | Ga0501080_0000502 | Ga0501080_0000502_24492_24944 | 136 |
| 133 | 3300049743 | Ga0501081_0018316 | Ga0501081_0018316_1900_2352 | 136 |
| 134 | 3300050511 | nmdc:mga08y16_1010092_c1 | nmdc:mga08y16_1010092_c1_221_724 | 136 |
| 135 | 3300054114 | Ga0501084_0078625 | Ga0501084_0078625_2115_2567 | 136 |
| 136 | 3300061734 | Ga0530510_0457034 | Ga0530510_0457034_328_780 | 136 |
| 137 | 3300005437 | Ga0070710_10152857 | Ga0070710_101528572 | 137 |
| 138 | 3300025898 | Ga0207692_10006506 | Ga0207692_100065066 | 137 |
| 139 | 3300035117 | Ga0373953_0037524 | Ga0373953_0037524_365_826 | 137 |
| 140 | 3300035119 | Ga0373956_0076665 | Ga0373956_0076665_663_1124 | 137 |
| 141 | 3300035120 | Ga0373957_0077834 | Ga0373957_0077834_216_677 | 137 |
| 142 | 3300035172 | Ga0373955_0015830 | Ga0373955_0015830_1954_2415 | 137 |
| 143 | 3300035410 | Ga0373924_0015301 | Ga0373924_0015301_673_1134 | 137 |
| 144 | 3300035692 | Ga0373935_0195970 | Ga0373935_0195970_792_1241 | 137 |
| 145 | 3300035724 | Ga0373933_0006341 | Ga0373933_0006341_2367_2828 | 137 |
| 146 | 3300036401 | Ga0373937_0038399 | Ga0373937_0038399_1087_1548 | 137 |
| 147 | 3300037068 | Ga0373925_0169885 | Ga0373925_0169885_498_929 | 137 |
| 148 | 3300046543 | Ga0495645_0408147 | Ga0495645_0408147_303_752 | 137 |
| 149 | 3300047322 | Ga0495680_0104671 | Ga0495680_0104671_1107_1568 | 137 |
| 150 | 3300049520 | Ga0501297_018511 | Ga0501297_018511_323_790 | 137 |
| 151 | 3300049572 | Ga0501036_0082064 | Ga0501036_0082064_408_854 | 137 |
| 152 | 3300049574 | Ga0501038_0150351 | Ga0501038_0150351_495_923 | 137 |
| 153 | 3300049575 | Ga0501039_0046020 | Ga0501039_0046020_237_683 | 137 |
| 154 | 3300049577 | Ga0501041_0143185 | Ga0501041_0143185_391_837 | 137 |
| 155 | 3300049578 | Ga0501042_0282669 | Ga0501042_0282669_224_670 | 137 |
| 156 | 3300049579 | Ga0501043_0214531 | Ga0501043_0214531_845_1291 | 137 |
| 157 | 3300049580 | Ga0501046_0176322 | Ga0501046_0176322_863_1309 | 137 |
| 158 | 3300049582 | Ga0501048_0020297 | Ga0501048_0020297_632_1078 | 137 |
| 159 | 3300049587 | Ga0501071_0008794 | Ga0501071_0008794_3227_3673 | 137 |
| 160 | 3300049588 | Ga0501072_0058372 | Ga0501072_0058372_1651_2097 | 137 |
| 161 | 3300049589 | Ga0501073_0880149 | Ga0501073_0880149_84_509 | 137 |
| 162 | 3300049591 | Ga0501075_0002081 | Ga0501075_0002081_11643_12089 | 137 |
| 163 | 3300049592 | Ga0501076_0433033 | Ga0501076_0433033_415_861 | 137 |
| 164 | 3300049741 | Ga0501079_0321155 | Ga0501079_0321155_485_931 | 137 |
| 165 | 3300049742 | Ga0501080_0023192 | Ga0501080_0023192_1152_1598 | 137 |
| 166 | 3300049743 | Ga0501081_0235188 | Ga0501081_0235188_361_807 | 137 |
| 167 | 3300049744 | Ga0501083_0381419 | Ga0501083_0381419_314_760 | 137 |
| 168 | 3300049824 | Ga0501045_0004712 | Ga0501045_0004712_2317_2763 | 137 |
| 169 | 3300054114 | Ga0501084_0037733 | Ga0501084_0037733_1428_1874 | 137 |
| 170 | 3300060353 | Ga0501082_0082355 | Ga0501082_0082355_551_997 | 137 |
| 171 | 3300061734 | Ga0530510_0014387 | Ga0530510_0014387_1358_1804 | 137 |
| 172 | 3300005439 | Ga0070711_100325245 | Ga0070711_1003252451 | 139 |
| 173 | 3300006175 | Ga0070712_100484186 | Ga0070712_1004841862 | 139 |
| 174 | 3300007076 | Ga0075435_100078504 | Ga0075435_1000785045 | 139 |
| 175 | 3300025916 | Ga0207663_10352943 | Ga0207663_103529432 | 139 |
| 176 | 3300025928 | Ga0207700_10363290 | Ga0207700_103632902 | 139 |
| 177 | 3300032002 | Ga0307416_100618117 | Ga0307416_1006181173 | 139 |
| 178 | 3300050513 | nmdc:mga0rr50_27655_c1 | nmdc:mga0rr50_27655_c1_3152_3607 | 139 |
| 179 | 3300050514 | nmdc:mga08x19_21818_c1 | nmdc:mga08x19_21818_c1_2909_3364 | 139 |
| 180 | 3300005295 | Ga0065707_10010183 | Ga0065707_100101833 | 140 |
| 181 | 3300005328 | Ga0070676_10166220 | Ga0070676_101662203 | 140 |
| 182 | 3300005328 | Ga0070676_10638324 | Ga0070676_106383242 | 140 |
| 183 | 3300005331 | Ga0070670_101746788 | Ga0070670_1017467882 | 140 |
| 184 | 3300005333 | Ga0070677_10164066 | Ga0070677_101640663 | 140 |
| 185 | 3300005334 | Ga0068869_100152276 | Ga0068869_1001522765 | 140 |
| 186 | 3300005336 | Ga0070680_100163787 | Ga0070680_1001637874 | 140 |
| 187 | 3300005336 | Ga0070680_100468454 | Ga0070680_1004684542 | 140 |
| 188 | 3300005336 | Ga0070680_101174924 | Ga0070680_1011749241 | 140 |
| 189 | 3300005338 | Ga0068868_101461470 | Ga0068868_1014614701 | 140 |
| 190 | 3300005340 | Ga0070689_100076770 | Ga0070689_1000767704 | 140 |
| 191 | 3300005340 | Ga0070689_101317879 | Ga0070689_1013178791 | 140 |
| 192 | 3300005345 | Ga0070692_10061598 | Ga0070692_100615983 | 140 |
| 193 | 3300005345 | Ga0070692_10271833 | Ga0070692_102718331 | 140 |
| 194 | 3300005347 | Ga0070668_100043358 | Ga0070668_1000433585 | 140 |
| 195 | 3300005353 | Ga0070669_100009032 | Ga0070669_1000090328 | 140 |
| 196 | 3300005354 | Ga0070675_100052444 | Ga0070675_1000524445 | 140 |
| 197 | 3300005364 | Ga0070673_100638566 | Ga0070673_1006385662 | 140 |
| 198 | 3300005365 | Ga0070688_100108394 | Ga0070688_1001083941 | 140 |
| 199 | 3300005440 | Ga0070705_101022743 | Ga0070705_1010227431 | 140 |
| 200 | 3300005441 | Ga0070700_100165485 | Ga0070700_1001654856 | 140 |
| 201 | 3300005459 | Ga0068867_100000755 | Ga0068867_10000075518 | 140 |
| 202 | 3300005466 | Ga0070685_10219953 | Ga0070685_102199531 | 140 |
| 203 | 3300005543 | Ga0070672_100199866 | Ga0070672_1001998666 | 140 |
| 204 | 3300005577 | Ga0068857_102149844 | Ga0068857_1021498441 | 140 |
| 205 | 3300005718 | Ga0068866_10044301 | Ga0068866_100443015 | 140 |
| 206 | 3300005719 | Ga0068861_100016620 | Ga0068861_1000166205 | 140 |
| 207 | 3300005719 | Ga0068861_101306134 | Ga0068861_1013061341 | 140 |
| 208 | 3300005840 | Ga0068870_11301106 | Ga0068870_113011061 | 140 |
| 209 | 3300005844 | Ga0068862_100247792 | Ga0068862_1002477924 | 140 |
| 210 | 3300005844 | Ga0068862_100722720 | Ga0068862_1007227203 | 140 |
| 211 | 3300005985 | Ga0081539_10005168 | Ga0081539_1000516810 | 140 |
| 212 | 3300006844 | Ga0075428_100116077 | Ga0075428_1001160772 | 140 |
| 213 | 3300006844 | Ga0075428_100195195 | Ga0075428_1001951952 | 140 |
| 214 | 3300006844 | Ga0075428_100578279 | Ga0075428_1005782794 | 140 |
| 215 | 3300006846 | Ga0075430_100120254 | Ga0075430_1001202542 | 140 |
| 216 | 3300006847 | Ga0075431_100024403 | Ga0075431_1000244033 | 140 |
| 217 | 3300006880 | Ga0075429_100039432 | Ga0075429_1000394327 | 140 |
| 218 | 3300006881 | Ga0068865_100028296 | Ga0068865_1000282964 | 140 |
| 219 | 3300006881 | Ga0068865_102026390 | Ga0068865_1020263901 | 140 |
| 220 | 3300009094 | Ga0111539_10180623 | Ga0111539_101806235 | 140 |
| 221 | 3300009147 | Ga0114129_10053431 | Ga0114129_100534319 | 140 |
| 222 | 3300009148 | Ga0105243_10035369 | Ga0105243_100353694 | 140 |
| 223 | 3300009553 | Ga0105249_10001388 | Ga0105249_1000138815 | 140 |
| 224 | 3300013306 | Ga0163162_10270340 | Ga0163162_102703402 | 140 |
| 225 | 3300013308 | Ga0157375_10567393 | Ga0157375_105673932 | 140 |
| 226 | 3300014326 | Ga0157380_10061130 | Ga0157380_100611302 | 140 |
| 227 | 3300014326 | Ga0157380_13441885 | Ga0157380_134418851 | 140 |
| 228 | 3300014745 | Ga0157377_10247375 | Ga0157377_102473752 | 140 |
| 229 | 3300025901 | Ga0207688_10190654 | Ga0207688_101906543 | 140 |
| 230 | 3300025907 | Ga0207645_10253509 | Ga0207645_102535093 | 140 |
| 231 | 3300025907 | Ga0207645_10456069 | Ga0207645_104560692 | 140 |
| 232 | 3300025908 | Ga0207643_10038216 | Ga0207643_100382165 | 140 |
| 233 | 3300025917 | Ga0207660_10004569 | Ga0207660_100045695 | 140 |
| 234 | 3300025917 | Ga0207660_10328845 | Ga0207660_103288454 | 140 |
| 235 | 3300025923 | Ga0207681_10296737 | Ga0207681_102967374 | 140 |
| 236 | 3300025926 | Ga0207659_10030671 | Ga0207659_100306714 | 140 |
| 237 | 3300025935 | Ga0207709_10002601 | Ga0207709_100026014 | 140 |
| 238 | 3300025936 | Ga0207670_10497576 | Ga0207670_104975762 | 140 |
| 239 | 3300025937 | Ga0207669_10025345 | Ga0207669_100253453 | 140 |
| 240 | 3300025938 | Ga0207704_10252977 | Ga0207704_102529772 | 140 |
| 241 | 3300025940 | Ga0207691_10027511 | Ga0207691_100275115 | 140 |
| 242 | 3300025942 | Ga0207689_10028985 | Ga0207689_100289855 | 140 |
| 243 | 3300025942 | Ga0207689_10970247 | Ga0207689_109702472 | 140 |
| 244 | 3300025961 | Ga0207712_10001259 | Ga0207712_100012593 | 140 |
| 245 | 3300026075 | Ga0207708_10093936 | Ga0207708_100939365 | 140 |
| 246 | 3300026089 | Ga0207648_10086304 | Ga0207648_100863045 | 140 |
| 247 | 3300026116 | Ga0207674_10635153 | Ga0207674_106351531 | 140 |
| 248 | 3300026118 | Ga0207675_100000812 | Ga0207675_10000081214 | 140 |
| 249 | 3300027907 | Ga0207428_10148564 | Ga0207428_101485642 | 140 |
| 250 | 3300028380 | Ga0268265_10031660 | Ga0268265_100316605 | 140 |
| 251 | 3300028380 | Ga0268265_11619770 | Ga0268265_116197702 | 140 |
| 252 | 3300031344 | Ga0265316_10374881 | Ga0265316_103748811 | 140 |
| 253 | 3300031911 | Ga0307412_10811776 | Ga0307412_108117763 | 140 |
| 254 | 3300032002 | Ga0307416_100124639 | Ga0307416_1001246394 | 140 |
| 255 | 3300032005 | Ga0307411_10818454 | Ga0307411_108184542 | 140 |
| 256 | 3300032126 | Ga0307415_100965244 | Ga0307415_1009652442 | 140 |
| 257 | 3300041496 | Ga0451839_0760959 | Ga0451839_0760959_288_749 | 140 |
| 258 | 3300042439 | Ga0439464_0128884 | Ga0439464_0128884_161_613 | 140 |
| 259 | 3300046537 | Ga0495598_0243269 | Ga0495598_0243269_160_612 | 140 |
| 260 | 3300047445 | Ga0495677_0174578 | Ga0495677_0174578_279_731 | 140 |
| 261 | 3300049683 | Ga0501253_216035 | Ga0501253_216035_12_464 | 140 |
| 262 | 3300050507 | nmdc:mga05p37_45015_c1 | nmdc:mga05p37_45015_c1_1723_2196 | 140 |
| 263 | 3300050508 | nmdc:mga09592_304370_c1 | nmdc:mga09592_304370_c1_153_626 | 140 |
| 264 | 3300050509 | nmdc:mga0qj67_307700_c1 | nmdc:mga0qj67_307700_c1_616_1065 | 140 |
| 265 | 3300050511 | nmdc:mga08y16_198287_c1 | nmdc:mga08y16_198287_c1_993_1442 | 140 |
| 266 | 3300050511 | nmdc:mga08y16_686592_c1 | nmdc:mga08y16_686592_c1_156_605 | 140 |
| 267 | 3300005330 | Ga0070690_100259709 | Ga0070690_1002597091 | 141 |
| 268 | 3300005544 | Ga0070686_101331524 | Ga0070686_1013315241 | 141 |
| 269 | 3300009094 | Ga0111539_10448554 | Ga0111539_104485543 | 141 |
| 270 | 3300009098 | Ga0105245_11129038 | Ga0105245_111290382 | 141 |
| 271 | 3300025917 | Ga0207660_10318649 | Ga0207660_103186492 | 141 |
| 272 | 3300035092 | Ga0373952_0001581 | Ga0373952_0001581_3493_3945 | 141 |
| 273 | 3300035114 | Ga0373939_0255362 | Ga0373939_0255362_142_594 | 141 |
| 274 | 3300035115 | Ga0373941_0024345 | Ga0373941_0024345_1127_1579 | 141 |
| 275 | 3300044683 | Ga0466965_0443298 | Ga0466965_0443298_164_616 | 141 |
| 276 | 3300044901 | Ga0466960_0203021 | Ga0466960_0203021_293_745 | 141 |
| 277 | 3300049582 | Ga0501048_0415730 | Ga0501048_0415730_386_835 | 141 |
| 278 | 3300050511 | nmdc:mga08y16_721077_c1 | nmdc:mga08y16_721077_c1_481_963 | 141 |
| 279 | 3300005458 | Ga0070681_10000081 | Ga0070681_1000008139 | 142 |
| 280 | 3300006914 | Ga0075436_100060029 | Ga0075436_1000600295 | 142 |
| 281 | 3300007265 | Ga0099794_10305082 | Ga0099794_103050822 | 142 |
| 282 | 3300025912 | Ga0207707_10002239 | Ga0207707_100022395 | 142 |
| 283 | 3300031824 | Ga0307413_10565819 | Ga0307413_105658192 | 142 |
| 284 | 3300032002 | Ga0307416_101135522 | Ga0307416_1011355222 | 142 |
| 285 | 3300049589 | Ga0501073_0360847 | Ga0501073_0360847_379_867 | 142 |
| 286 | 3300049590 | Ga0501074_0244649 | Ga0501074_0244649_650_1138 | 142 |
| 287 | 3300049742 | Ga0501080_0644027 | Ga0501080_0644027_206_694 | 142 |
| 288 | 3300049850 | Ga0501204_088375 | Ga0501204_088375_14_466 | 142 |
| 289 | 3300050510 | nmdc:mga06r32_1321144_c1 | nmdc:mga06r32_1321144_c1_53_502 | 142 |
| 290 | 3300050514 | nmdc:mga08x19_66559_c1 | nmdc:mga08x19_66559_c1_1549_2007 | 142 |
| 291 | 3300054114 | Ga0501084_0623812 | Ga0501084_0623812_402_890 | 142 |
| 292 | 3300005353 | Ga0070669_100932223 | Ga0070669_1009322231 | 143 |
| 293 | 3300005544 | Ga0070686_100189360 | Ga0070686_1001893602 | 143 |
| 294 | 3300006846 | Ga0075430_100149148 | Ga0075430_1001491482 | 143 |
| 295 | 3300006847 | Ga0075431_100481072 | Ga0075431_1004810722 | 143 |
| 296 | 3300009098 | Ga0105245_11328017 | Ga0105245_113280172 | 143 |
| 297 | 3300025918 | Ga0207662_10188327 | Ga0207662_101883273 | 143 |
| 298 | 3300027364 | Ga0209967_1003247 | Ga0209967_10032473 | 143 |
| 299 | 3300031548 | Ga0307408_100614634 | Ga0307408_1006146342 | 143 |
| 300 | 3300032002 | Ga0307416_100994916 | Ga0307416_1009949162 | 143 |
| 301 | 3300035112 | Ga0373932_0125834 | Ga0373932_0125834_187_636 | 143 |
| 302 | 3300042437 | Ga0439444_0004549 | Ga0439444_0004549_37_489 | 143 |
| 303 | 3300049514 | Ga0501291_004472 | Ga0501291_004472_603_1055 | 143 |
| 304 | 3300049582 | Ga0501048_0941674 | Ga0501048_0941674_72_524 | 143 |
| 305 | 3300049592 | Ga0501076_0922662 | Ga0501076_0922662_141_593 | 143 |
| 306 | 3300049686 | Ga0501257_123734 | Ga0501257_123734_176_628 | 143 |
| 307 | 3300049568 | Ga0501031_0275344 | Ga0501031_0275344_477_932 | 144 |
| 308 | 3300049569 | Ga0501032_0255336 | Ga0501032_0255336_198_653 | 144 |
| 309 | 3300049571 | Ga0501034_0946447 | Ga0501034_0946447_253_708 | 144 |
| 310 | 3300049572 | Ga0501036_0013192 | Ga0501036_0013192_5502_5957 | 144 |
| 311 | 3300049573 | Ga0501037_0161709 | Ga0501037_0161709_606_1061 | 144 |
| 312 | 3300049574 | Ga0501038_0007492 | Ga0501038_0007492_8402_8857 | 144 |
| 313 | 3300049575 | Ga0501039_0106931 | Ga0501039_0106931_922_1377 | 144 |
| 314 | 3300049576 | Ga0501040_0030621 | Ga0501040_0030621_528_983 | 144 |
| 315 | 3300049577 | Ga0501041_0002591 | Ga0501041_0002591_2534_2989 | 144 |
| 316 | 3300049578 | Ga0501042_0199581 | Ga0501042_0199581_510_965 | 144 |
| 317 | 3300049579 | Ga0501043_0728548 | Ga0501043_0728548_103_558 | 144 |
| 318 | 3300049580 | Ga0501046_0111666 | Ga0501046_0111666_150_605 | 144 |
| 319 | 3300049582 | Ga0501048_0047309 | Ga0501048_0047309_2197_2652 | 144 |
| 320 | 3300049588 | Ga0501072_0266316 | Ga0501072_0266316_304_759 | 144 |
| 321 | 3300049589 | Ga0501073_0609725 | Ga0501073_0609725_14_469 | 144 |
| 322 | 3300049592 | Ga0501076_0004745 | Ga0501076_0004745_320_775 | 144 |
| 323 | 3300049593 | Ga0501077_0039802 | Ga0501077_0039802_304_759 | 144 |
| 324 | 3300049741 | Ga0501079_0350600 | Ga0501079_0350600_105_560 | 144 |
| 325 | 3300049742 | Ga0501080_0115785 | Ga0501080_0115785_299_754 | 144 |
| 326 | 3300049743 | Ga0501081_0021954 | Ga0501081_0021954_2888_3343 | 144 |
| 327 | 3300049744 | Ga0501083_0225342 | Ga0501083_0225342_679_1134 | 144 |
| 328 | 3300049822 | Ga0501035_0407409 | Ga0501035_0407409_37_492 | 144 |
| 329 | 3300049824 | Ga0501045_0028922 | Ga0501045_0028922_150_605 | 144 |
| 330 | 3300050509 | nmdc:mga0qj67_79719_c1 | nmdc:mga0qj67_79719_c1_1804_2256 | 144 |
| 331 | 3300050510 | nmdc:mga06r32_1020465_c1 | nmdc:mga06r32_1020465_c1_131_583 | 144 |
| 332 | 3300050513 | nmdc:mga0rr50_91960_c1 | nmdc:mga0rr50_91960_c1_925_1389 | 144 |
| 333 | 3300054114 | Ga0501084_0033552 | Ga0501084_0033552_2879_3334 | 144 |
| 334 | 3300060353 | Ga0501082_0048685 | Ga0501082_0048685_298_753 | 144 |
| 335 | 3300061734 | Ga0530510_0418221 | Ga0530510_0418221_147_602 | 144 |
| 336 | 3300005518 | Ga0070699_100080666 | Ga0070699_1000806663 | 145 |
| 337 | 3300006914 | Ga0075436_100125923 | Ga0075436_1001259232 | 145 |
| 338 | 3300013105 | Ga0157369_10731336 | Ga0157369_107313362 | 145 |
| 339 | 3300050514 | nmdc:mga08x19_113031_c1 | nmdc:mga08x19_113031_c1_449_901 | 145 |
| 340 | 3300005545 | Ga0070695_100897377 | Ga0070695_1008973772 | 146 |
| 341 | 3300005546 | Ga0070696_100133174 | Ga0070696_1001331744 | 146 |
| 342 | 3300005364 | Ga0070673_100831722 | Ga0070673_1008317222 | 147 |
| 343 | 3300005438 | Ga0070701_10871295 | Ga0070701_108712951 | 147 |
| 344 | 3300006871 | Ga0075434_100460018 | Ga0075434_1004600183 | 147 |
| 345 | 3300007265 | Ga0099794_10190473 | Ga0099794_101904732 | 147 |
| 346 | 3300009094 | Ga0111539_10286237 | Ga0111539_102862373 | 147 |
| 347 | 3300025960 | Ga0207651_10563432 | Ga0207651_105634322 | 147 |
| 348 | 3300027671 | Ga0209588_1032497 | Ga0209588_10324973 | 147 |
| 349 | 3300027907 | Ga0207428_10260527 | Ga0207428_102605272 | 147 |
| 350 | 3300041486 | Ga0451807_1150880 | Ga0451807_1150880_84_530 | 147 |
| 351 | 3300041496 | Ga0451839_0404989 | Ga0451839_0404989_312_758 | 147 |
| 352 | 3300045051 | Ga0451576_0425970 | Ga0451576_0425970_726_1172 | 147 |
| 353 | 3300046454 | Ga0495592_0283137 | Ga0495592_0283137_166_624 | 147 |
| 354 | 3300046459 | Ga0495629_0227091 | Ga0495629_0227091_329_775 | 147 |
| 355 | 3300046476 | Ga0495662_0013878 | Ga0495662_0013878_2172_2618 | 147 |
| 356 | 3300046514 | Ga0495618_0441998 | Ga0495618_0441998_94_540 | 147 |
| 357 | 3300046517 | Ga0495630_0259875 | Ga0495630_0259875_299_745 | 147 |
| 358 | 3300046533 | Ga0495640_0231639 | Ga0495640_0231639_147_593 | 147 |
| 359 | 3300046663 | Ga0495635_0025694 | Ga0495635_0025694_399_845 | 147 |
| 360 | 3300046690 | Ga0495624_0182826 | Ga0495624_0182826_333_779 | 147 |
| 361 | 3300047315 | Ga0495581_0100413 | Ga0495581_0100413_534_980 | 147 |
| 362 | 3300049568 | Ga0501031_0727779 | Ga0501031_0727779_80_571 | 147 |
| 363 | 3300050508 | nmdc:mga09592_82027_c1 | nmdc:mga09592_82027_c1_2128_2574 | 147 |
| 364 | 3300050511 | nmdc:mga08y16_115995_c1 | nmdc:mga08y16_115995_c1_1579_2025 | 147 |
| 365 | 3300050512 | nmdc:mga0n895_1165355_c1 | nmdc:mga0n895_1165355_c1_169_615 | 147 |
| 366 | 3300050513 | nmdc:mga0rr50_316265_c1 | nmdc:mga0rr50_316265_c1_618_1064 | 147 |
| 367 | 3300006358 | Ga0068871_100411112 | Ga0068871_1004111124 | 148 |
| 368 | 3300032002 | Ga0307416_102252803 | Ga0307416_1022528031 | 148 |
| 369 | 3300032005 | Ga0307411_10118852 | Ga0307411_101188523 | 148 |
| 370 | 3300032126 | Ga0307415_101285716 | Ga0307415_1012857162 | 148 |
| 371 | 3300042435 | Ga0439434_0046342 | Ga0439434_0046342_648_1097 | 148 |
| 372 | 3300046455 | Ga0495603_0165540 | Ga0495603_0165540_108_557 | 148 |
| 373 | 3300050508 | nmdc:mga09592_542054_c1 | nmdc:mga09592_542054_c1_175_624 | 148 |
| 374 | 3300006847 | Ga0075431_100353244 | Ga0075431_1003532441 | 149 |
| 375 | 3300031548 | Ga0307408_100567135 | Ga0307408_1005671352 | 149 |
| 376 | 3300031911 | Ga0307412_10451548 | Ga0307412_104515483 | 149 |
| 377 | 3300032002 | Ga0307416_100056591 | Ga0307416_1000565913 | 149 |
| 378 | 3300041505 | Ga0451849_1032019 | Ga0451849_1032019_95_547 | 149 |
| 379 | 3300049576 | Ga0501040_0725776 | Ga0501040_0725776_94_546 | 149 |
| 380 | 3300049578 | Ga0501042_0354323 | Ga0501042_0354323_139_591 | 149 |
| 381 | 3300049578 | Ga0501042_0509277 | Ga0501042_0509277_348_800 | 149 |
| 382 | 3300050510 | nmdc:mga06r32_822135_c1 | nmdc:mga06r32_822135_c1_355_807 | 149 |
| 383 | 3300035086 | Ga0373934_0043110 | Ga0373934_0043110_388_843 | 150 |
| 384 | 3300035117 | Ga0373953_0118763 | Ga0373953_0118763_111_566 | 150 |
| 385 | 3300035118 | Ga0373954_0001511 | Ga0373954_0001511_153_608 | 150 |
| 386 | 3300035724 | Ga0373933_0028698 | Ga0373933_0028698_228_683 | 150 |
| 387 | 3300036401 | Ga0373937_0047453 | Ga0373937_0047453_3239_3694 | 150 |
| 388 | 3300046511 | Ga0495608_0547506 | Ga0495608_0547506_45_500 | 150 |
| 389 | 3300046675 | Ga0495657_0117720 | Ga0495657_0117720_889_1344 | 150 |
| 390 | 3300047317 | Ga0495604_0133473 | Ga0495604_0133473_1216_1671 | 150 |
| 391 | 3300005336 | Ga0070680_100669191 | Ga0070680_1006691912 | 151 |
| 392 | 3300005434 | Ga0070709_11251110 | Ga0070709_112511101 | 151 |
| 393 | 3300005435 | Ga0070714_100040727 | Ga0070714_1000407275 | 151 |
| 394 | 3300005440 | Ga0070705_100647351 | Ga0070705_1006473513 | 151 |
| 395 | 3300005440 | Ga0070705_100856111 | Ga0070705_1008561112 | 151 |
| 396 | 3300005444 | Ga0070694_100242314 | Ga0070694_1002423142 | 151 |
| 397 | 3300005545 | Ga0070695_100125662 | Ga0070695_1001256624 | 151 |
| 398 | 3300005547 | Ga0070693_100292019 | Ga0070693_1002920192 | 151 |
| 399 | 3300006173 | Ga0070716_100337509 | Ga0070716_1003375091 | 151 |
| 400 | 3300006852 | Ga0075433_10680256 | Ga0075433_106802562 | 151 |
| 401 | 3300006914 | Ga0075436_100000529 | Ga0075436_10000052924 | 151 |
| 402 | 3300006914 | Ga0075436_100094639 | Ga0075436_1000946394 | 151 |
| 403 | 3300007076 | Ga0075435_100199926 | Ga0075435_1001999261 | 151 |
| 404 | 3300007788 | Ga0099795_10026232 | Ga0099795_100262324 | 151 |
| 405 | 3300009148 | Ga0105243_11684111 | Ga0105243_116841112 | 151 |
| 406 | 3300025916 | Ga0207663_11117569 | Ga0207663_111175691 | 151 |
| 407 | 3300025917 | Ga0207660_10245533 | Ga0207660_102455332 | 151 |
| 408 | 3300025918 | Ga0207662_10269198 | Ga0207662_102691982 | 151 |
| 409 | 3300025918 | Ga0207662_10626435 | Ga0207662_106264352 | 151 |
| 410 | 3300025929 | Ga0207664_10171573 | Ga0207664_101715733 | 151 |
| 411 | 3300027378 | Ga0209981_1000782 | Ga0209981_10007823 | 151 |
| 412 | 3300027462 | Ga0210000_1002477 | Ga0210000_10024774 | 151 |
| 413 | 3300035692 | Ga0373935_0766290 | Ga0373935_0766290_151_609 | 151 |
| 414 | 3300035695 | Ga0373927_0647041 | Ga0373927_0647041_57_515 | 151 |
| 415 | 3300037068 | Ga0373925_0504189 | Ga0373925_0504189_340_798 | 151 |
| 416 | 3300039450 | Ga0436363_0132198 | Ga0436363_0132198_64_522 | 151 |
| 417 | 3300041997 | Ga0439431_0044157 | Ga0439431_0044157_550_1014 | 151 |
| 418 | 3300042156 | Ga0439446_0086173 | Ga0439446_0086173_144_608 | 151 |
| 419 | 3300042435 | Ga0439434_0047796 | Ga0439434_0047796_502_966 | 151 |
| 420 | 3300042436 | Ga0439435_0009935 | Ga0439435_0009935_1742_2206 | 151 |
| 421 | 3300045051 | Ga0451576_0330463 | Ga0451576_0330463_722_1177 | 151 |
| 422 | 3300046684 | Ga0495669_0010927 | Ga0495669_0010927_766_1224 | 151 |
| 423 | 3300049572 | Ga0501036_0353614 | Ga0501036_0353614_49_507 | 151 |
| 424 | 3300049574 | Ga0501038_1327321 | Ga0501038_1327321_49_507 | 151 |
| 425 | 3300049576 | Ga0501040_0205115 | Ga0501040_0205115_616_1074 | 151 |
| 426 | 3300049577 | Ga0501041_0269754 | Ga0501041_0269754_376_834 | 151 |
| 427 | 3300049582 | Ga0501048_0603102 | Ga0501048_0603102_170_628 | 151 |
| 428 | 3300049587 | Ga0501071_0164986 | Ga0501071_0164986_153_611 | 151 |
| 429 | 3300049588 | Ga0501072_1310184 | Ga0501072_1310184_82_540 | 151 |
| 430 | 3300049590 | Ga0501074_0050093 | Ga0501074_0050093_2401_2865 | 151 |
| 431 | 3300049591 | Ga0501075_0772674 | Ga0501075_0772674_158_628 | 151 |
| 432 | 3300049741 | Ga0501079_0193061 | Ga0501079_0193061_519_977 | 151 |
| 433 | 3300049743 | Ga0501081_0395352 | Ga0501081_0395352_530_988 | 151 |
| 434 | 3300049824 | Ga0501045_0035938 | Ga0501045_0035938_969_1427 | 151 |
| 435 | 3300050512 | nmdc:mga0n895_81695_c1 | nmdc:mga0n895_81695_c1_1395_1853 | 151 |
| 436 | 3300050513 | nmdc:mga0rr50_228516_c1 | nmdc:mga0rr50_228516_c1_470_928 | 151 |
| 437 | 3300050514 | nmdc:mga08x19_258_c1 | nmdc:mga08x19_258_c1_23241_23696 | 151 |
| 438 | 3300050514 | nmdc:mga08x19_381080_c1 | nmdc:mga08x19_381080_c1_211_669 | 151 |
| 439 | 3300050515 | nmdc:mga0a205_44949_c1 | nmdc:mga0a205_44949_c1_155_613 | 151 |
| 440 | 3300050515 | nmdc:mga0a205_545975_c1 | nmdc:mga0a205_545975_c1_482_946 | 151 |
| 441 | 3300054114 | Ga0501084_0123263 | Ga0501084_0123263_213_671 | 151 |
| 442 | 3300059421 | Ga0590071_063953 | Ga0590071_063953_67_525 | 151 |
| 443 | 3300060353 | Ga0501082_0324336 | Ga0501082_0324336_164_622 | 151 |
| 444 | 3300039437 | Ga0436365_1860246 | Ga0436365_1860246_128_601 | 152 |
| 445 | 3300005536 | Ga0070697_100000299 | Ga0070697_1000002994 | 153 |
| 446 | 3300025939 | Ga0207665_10895233 | Ga0207665_108952333 | 153 |
| 447 | 3300031911 | Ga0307412_10036695 | Ga0307412_100366952 | 156 |
| 448 | 3300032002 | Ga0307416_100480552 | Ga0307416_1004805522 | 156 |
| 449 | 3300032005 | Ga0307411_10487864 | Ga0307411_104878641 | 156 |
| 450 | 3300000652 | ARCol0yngRDRAFT_1004317 | ARCol0yngRDRAFT_10043173 | 157 |
| 451 | 3300005295 | Ga0065707_10217684 | Ga0065707_102176843 | 157 |
| 452 | 3300005330 | Ga0070690_100154001 | Ga0070690_1001540014 | 157 |
| 453 | 3300005334 | Ga0068869_100000139 | Ga0068869_1000001394 | 157 |
| 454 | 3300005336 | Ga0070680_100000688 | Ga0070680_10000068824 | 157 |
| 455 | 3300005337 | Ga0070682_100393712 | Ga0070682_1003937122 | 157 |
| 456 | 3300005338 | Ga0068868_100000115 | Ga0068868_10000011520 | 157 |
| 457 | 3300005340 | Ga0070689_100049842 | Ga0070689_1000498426 | 157 |
| 458 | 3300005343 | Ga0070687_100000091 | Ga0070687_1000000915 | 157 |
| 459 | 3300005345 | Ga0070692_10000335 | Ga0070692_1000033512 | 157 |
| 460 | 3300005353 | Ga0070669_100409604 | Ga0070669_1004096042 | 157 |
| 461 | 3300005354 | Ga0070675_100646824 | Ga0070675_1006468242 | 157 |
| 462 | 3300005355 | Ga0070671_100511204 | Ga0070671_1005112041 | 157 |
| 463 | 3300005406 | Ga0070703_10113264 | Ga0070703_101132642 | 157 |
| 464 | 3300005438 | Ga0070701_10002057 | Ga0070701_100020572 | 157 |
| 465 | 3300005439 | Ga0070711_100498237 | Ga0070711_1004982371 | 157 |
| 466 | 3300005439 | Ga0070711_101445914 | Ga0070711_1014459141 | 157 |
| 467 | 3300005440 | Ga0070705_100001761 | Ga0070705_10000176113 | 157 |
| 468 | 3300005441 | Ga0070700_100008537 | Ga0070700_1000085376 | 157 |
| 469 | 3300005444 | Ga0070694_100000133 | Ga0070694_1000001334 | 157 |
| 470 | 3300005444 | Ga0070694_101051162 | Ga0070694_1010511621 | 157 |
| 471 | 3300005445 | Ga0070708_100139710 | Ga0070708_1001397106 | 157 |
| 472 | 3300005458 | Ga0070681_10277248 | Ga0070681_102772485 | 157 |
| 473 | 3300005459 | Ga0068867_100000084 | Ga0068867_10000008433 | 157 |
| 474 | 3300005518 | Ga0070699_100356165 | Ga0070699_1003561655 | 157 |
| 475 | 3300005530 | Ga0070679_100003611 | Ga0070679_10000361116 | 157 |
| 476 | 3300005539 | Ga0068853_100199450 | Ga0068853_1001994505 | 157 |
| 477 | 3300005543 | Ga0070672_100320379 | Ga0070672_1003203794 | 157 |
| 478 | 3300005544 | Ga0070686_100000193 | Ga0070686_10000019332 | 157 |
| 479 | 3300005545 | Ga0070695_100000303 | Ga0070695_10000030326 | 157 |
| 480 | 3300005546 | Ga0070696_100000284 | Ga0070696_10000028433 | 157 |
| 481 | 3300005547 | Ga0070693_100000111 | Ga0070693_1000001114 | 157 |
| 482 | 3300005549 | Ga0070704_100000008 | Ga0070704_10000000822 | 157 |
| 483 | 3300005563 | Ga0068855_100000242 | Ga0068855_10000024241 | 157 |
| 484 | 3300005564 | Ga0070664_101542457 | Ga0070664_1015424572 | 157 |
| 485 | 3300005577 | Ga0068857_100870631 | Ga0068857_1008706313 | 157 |
| 486 | 3300005578 | Ga0068854_100045331 | Ga0068854_1000453316 | 157 |
| 487 | 3300005614 | Ga0068856_100010173 | Ga0068856_1000101732 | 157 |
| 488 | 3300005615 | Ga0070702_100000012 | Ga0070702_10000001258 | 157 |
| 489 | 3300005616 | Ga0068852_100176407 | Ga0068852_1001764075 | 157 |
| 490 | 3300005617 | Ga0068859_100005212 | Ga0068859_1000052124 | 157 |
| 491 | 3300005618 | Ga0068864_100412279 | Ga0068864_1004122794 | 157 |
| 492 | 3300005718 | Ga0068866_10000109 | Ga0068866_1000010933 | 157 |
| 493 | 3300005719 | Ga0068861_100140675 | Ga0068861_1001406754 | 157 |
| 494 | 3300005841 | Ga0068863_100583404 | Ga0068863_1005834042 | 157 |
| 495 | 3300005842 | Ga0068858_100287149 | Ga0068858_1002871494 | 157 |
| 496 | 3300005843 | Ga0068860_100005589 | Ga0068860_1000055894 | 157 |
| 497 | 3300005844 | Ga0068862_100002876 | Ga0068862_10000287619 | 157 |
| 498 | 3300006163 | Ga0070715_10147971 | Ga0070715_101479712 | 157 |
| 499 | 3300006175 | Ga0070712_100220327 | Ga0070712_1002203272 | 157 |
| 500 | 3300006237 | Ga0097621_100040927 | Ga0097621_1000409274 | 157 |
| 501 | 3300006358 | Ga0068871_100000559 | Ga0068871_10000055926 | 157 |
| 502 | 3300006844 | Ga0075428_100000183 | Ga0075428_10000018317 | 157 |
| 503 | 3300006847 | Ga0075431_100359887 | Ga0075431_1003598873 | 157 |
| 504 | 3300006852 | Ga0075433_10000480 | Ga0075433_1000048018 | 157 |
| 505 | 3300006852 | Ga0075433_10456184 | Ga0075433_104561842 | 157 |
| 506 | 3300006871 | Ga0075434_100001287 | Ga0075434_1000012874 | 157 |
| 507 | 3300006871 | Ga0075434_100897053 | Ga0075434_1008970532 | 157 |
| 508 | 3300006880 | Ga0075429_100000891 | Ga0075429_10000089129 | 157 |
| 509 | 3300006881 | Ga0068865_100001481 | Ga0068865_1000014819 | 157 |
| 510 | 3300006914 | Ga0075436_100005350 | Ga0075436_1000053506 | 157 |
| 511 | 3300006931 | Ga0097620_100005212 | Ga0097620_10000521218 | 157 |
| 512 | 3300009094 | Ga0111539_10059022 | Ga0111539_100590224 | 157 |
| 513 | 3300009094 | Ga0111539_10512605 | Ga0111539_105126053 | 157 |
| 514 | 3300009098 | Ga0105245_10000245 | Ga0105245_1000024537 | 157 |
| 515 | 3300009147 | Ga0114129_10000219 | Ga0114129_1000021948 | 157 |
| 516 | 3300009148 | Ga0105243_10000279 | Ga0105243_1000027943 | 157 |
| 517 | 3300009174 | Ga0105241_10029972 | Ga0105241_100299726 | 157 |
| 518 | 3300009176 | Ga0105242_10000480 | Ga0105242_1000048035 | 157 |
| 519 | 3300009177 | Ga0105248_10139905 | Ga0105248_101399056 | 157 |
| 520 | 3300009545 | Ga0105237_11258178 | Ga0105237_112581782 | 157 |
| 521 | 3300009553 | Ga0105249_10003616 | Ga0105249_100036162 | 157 |
| 522 | 3300010375 | Ga0105239_10284425 | Ga0105239_102844255 | 157 |
| 523 | 3300012498 | Ga0157345_1010036 | Ga0157345_10100363 | 157 |
| 524 | 3300013297 | Ga0157378_10000294 | Ga0157378_1000029435 | 157 |
| 525 | 3300013306 | Ga0163162_10218721 | Ga0163162_102187213 | 157 |
| 526 | 3300025885 | Ga0207653_10011595 | Ga0207653_100115953 | 157 |
| 527 | 3300025899 | Ga0207642_10000913 | Ga0207642_100009138 | 157 |
| 528 | 3300025901 | Ga0207688_10020516 | Ga0207688_100205164 | 157 |
| 529 | 3300025904 | Ga0207647_10037052 | Ga0207647_100370523 | 157 |
| 530 | 3300025905 | Ga0207685_10114128 | Ga0207685_101141282 | 157 |
| 531 | 3300025908 | Ga0207643_10134949 | Ga0207643_101349494 | 157 |
| 532 | 3300025911 | Ga0207654_10010311 | Ga0207654_100103116 | 157 |
| 533 | 3300025912 | Ga0207707_10205636 | Ga0207707_102056362 | 157 |
| 534 | 3300025918 | Ga0207662_10000285 | Ga0207662_1000028521 | 157 |
| 535 | 3300025921 | Ga0207652_10029970 | Ga0207652_100299706 | 157 |
| 536 | 3300025927 | Ga0207687_10001352 | Ga0207687_1000135218 | 157 |
| 537 | 3300025933 | Ga0207706_10435461 | Ga0207706_104354614 | 157 |
| 538 | 3300025934 | Ga0207686_10001979 | Ga0207686_1000197913 | 157 |
| 539 | 3300025935 | Ga0207709_10000549 | Ga0207709_1000054913 | 157 |
| 540 | 3300025936 | Ga0207670_10003216 | Ga0207670_100032168 | 157 |
| 541 | 3300025938 | Ga0207704_10007942 | Ga0207704_100079425 | 157 |
| 542 | 3300025939 | Ga0207665_10501953 | Ga0207665_105019531 | 157 |
| 543 | 3300025940 | Ga0207691_10144443 | Ga0207691_101444433 | 157 |
| 544 | 3300025941 | Ga0207711_10220115 | Ga0207711_102201155 | 157 |
| 545 | 3300025942 | Ga0207689_10000293 | Ga0207689_1000029339 | 157 |
| 546 | 3300025949 | Ga0207667_10002578 | Ga0207667_1000257822 | 157 |
| 547 | 3300025961 | Ga0207712_10000959 | Ga0207712_1000095923 | 157 |
| 548 | 3300025981 | Ga0207640_10003141 | Ga0207640_100031416 | 157 |
| 549 | 3300025986 | Ga0207658_10906090 | Ga0207658_109060902 | 157 |
| 550 | 3300026023 | Ga0207677_10000669 | Ga0207677_100006694 | 157 |
| 551 | 3300026035 | Ga0207703_10048738 | Ga0207703_100487384 | 157 |
| 552 | 3300026041 | Ga0207639_10050576 | Ga0207639_100505764 | 157 |
| 553 | 3300026075 | Ga0207708_10019059 | Ga0207708_100190596 | 157 |
| 554 | 3300026078 | Ga0207702_10006239 | Ga0207702_1000623913 | 157 |
| 555 | 3300026089 | Ga0207648_10000185 | Ga0207648_1000018540 | 157 |
| 556 | 3300026118 | Ga0207675_100000150 | Ga0207675_10000015036 | 157 |
| 557 | 3300026142 | Ga0207698_10167404 | Ga0207698_101674042 | 157 |
| 558 | 3300027907 | Ga0207428_10000290 | Ga0207428_1000029028 | 157 |
| 559 | 3300028380 | Ga0268265_10001010 | Ga0268265_1000101032 | 157 |
| 560 | 3300028381 | Ga0268264_10000580 | Ga0268264_1000058017 | 157 |
| 561 | 3300034816 | Ga0373930_0005659 | Ga0373930_0005659_1293_1766 | 157 |
| 562 | 3300034818 | Ga0373950_0060394 | Ga0373950_0060394_261_734 | 157 |
| 563 | 3300034819 | Ga0373958_0064377 | Ga0373958_0064377_206_679 | 157 |
| 564 | 3300034957 | Ga0373938_0064950 | Ga0373938_0064950_207_683 | 157 |
| 565 | 3300035083 | Ga0373926_0003468 | Ga0373926_0003468_2312_2797 | 157 |
| 566 | 3300035084 | Ga0373928_0162206 | Ga0373928_0162206_127_600 | 157 |
| 567 | 3300035085 | Ga0373929_0034185 | Ga0373929_0034185_286_759 | 157 |
| 568 | 3300035089 | Ga0373944_0051715 | Ga0373944_0051715_177_662 | 157 |
| 569 | 3300035090 | Ga0373949_0042848 | Ga0373949_0042848_183_656 | 157 |
| 570 | 3300035092 | Ga0373952_0019919 | Ga0373952_0019919_185_658 | 157 |
| 571 | 3300035092 | Ga0373952_0024547 | Ga0373952_0024547_155_628 | 157 |
| 572 | 3300035112 | Ga0373932_0005643 | Ga0373932_0005643_1057_1530 | 157 |
| 573 | 3300035112 | Ga0373932_0144706 | Ga0373932_0144706_141_614 | 157 |
| 574 | 3300035113 | Ga0373936_0006530 | Ga0373936_0006530_434_919 | 157 |
| 575 | 3300035114 | Ga0373939_0054963 | Ga0373939_0054963_182_655 | 157 |
| 576 | 3300035115 | Ga0373941_0023589 | Ga0373941_0023589_1091_1564 | 157 |
| 577 | 3300035116 | Ga0373945_0001983 | Ga0373945_0001983_2730_3215 | 157 |
| 578 | 3300035242 | Ga0373962_0006941 | Ga0373962_0006941_425_898 | 157 |
| 579 | 3300035691 | Ga0373931_0001802 | Ga0373931_0001802_2619_3092 | 157 |
| 580 | 3300035691 | Ga0373931_0037732 | Ga0373931_0037732_1600_2073 | 157 |
| 581 | 3300035692 | Ga0373935_0363644 | Ga0373935_0363644_89_574 | 157 |
| 582 | 3300035695 | Ga0373927_0084775 | Ga0373927_0084775_103_588 | 157 |
| 583 | 3300035725 | Ga0373947_0097992 | Ga0373947_0097992_218_703 | 157 |
| 584 | 3300037068 | Ga0373925_0029441 | Ga0373925_0029441_2164_2649 | 157 |
| 585 | 3300042876 | Ga0451577_0104973 | Ga0451577_0104973_1972_2445 | 157 |
| 586 | 3300045051 | Ga0451576_0001107 | Ga0451576_0001107_28448_28921 | 157 |
| 587 | 3300045051 | Ga0451576_0053818 | Ga0451576_0053818_1734_2207 | 157 |
| 588 | 3300046455 | Ga0495603_0023231 | Ga0495603_0023231_2416_2901 | 157 |
| 589 | 3300046472 | Ga0495580_0005567 | Ga0495580_0005567_6519_7004 | 157 |
| 590 | 3300046473 | Ga0495582_0073235 | Ga0495582_0073235_1263_1748 | 157 |
| 591 | 3300046475 | Ga0495639_0035947 | Ga0495639_0035947_1575_2060 | 157 |
| 592 | 3300046517 | Ga0495630_0078786 | Ga0495630_0078786_1922_2407 | 157 |
| 593 | 3300046526 | Ga0495666_0034170 | Ga0495666_0034170_374_859 | 157 |
| 594 | 3300046531 | Ga0495665_0093296 | Ga0495665_0093296_316_801 | 157 |
| 595 | 3300046664 | Ga0495659_0013310 | Ga0495659_0013310_1928_2413 | 157 |
| 596 | 3300046681 | Ga0495647_0000304 | Ga0495647_0000304_11698_12183 | 157 |
| 597 | 3300046683 | Ga0495658_0014094 | Ga0495658_0014094_1699_2184 | 157 |
| 598 | 3300046690 | Ga0495624_0262093 | Ga0495624_0262093_445_930 | 157 |
| 599 | 3300046691 | Ga0495670_0368472 | Ga0495670_0368472_140_613 | 157 |
| 600 | 3300047315 | Ga0495581_0245736 | Ga0495581_0245736_407_892 | 157 |
| 601 | 3300047318 | Ga0495636_0250262 | Ga0495636_0250262_87_572 | 157 |
| 602 | 3300047321 | Ga0495676_0036800 | Ga0495676_0036800_1665_2150 | 157 |
| 603 | 3300048912 | Ga0496109_0707805 | Ga0496109_0707805_178_654 | 157 |
| 604 | 3300049568 | Ga0501031_0175943 | Ga0501031_0175943_739_1212 | 157 |
| 605 | 3300049582 | Ga0501048_0678153 | Ga0501048_0678153_208_681 | 157 |
| 606 | 3300049587 | Ga0501071_0350970 | Ga0501071_0350970_198_671 | 157 |
| 607 | 3300049822 | Ga0501035_1389779 | Ga0501035_1389779_37_510 | 157 |
| 608 | 3300050507 | nmdc:mga05p37_389_c1 | nmdc:mga05p37_389_c1_32752_33225 | 157 |
| 609 | 3300050508 | nmdc:mga09592_34542_c1 | nmdc:mga09592_34542_c1_1479_1952 | 157 |
| 610 | 3300050510 | nmdc:mga06r32_1092963_c1 | nmdc:mga06r32_1092963_c1_154_627 | 157 |
| 611 | 3300050511 | nmdc:mga08y16_5420_c1 | nmdc:mga08y16_5420_c1_11901_12374 | 157 |
| 612 | 3300050512 | nmdc:mga0n895_1129388_c1 | nmdc:mga0n895_1129388_c1_97_570 | 157 |
| 613 | 3300050512 | nmdc:mga0n895_189176_c1 | nmdc:mga0n895_189176_c1_179_655 | 157 |
| 614 | 3300050513 | nmdc:mga0rr50_7917_c1 | nmdc:mga0rr50_7917_c1_4278_4754 | 157 |
| 615 | 3300050514 | nmdc:mga08x19_23320_c1 | nmdc:mga08x19_23320_c1_1062_1538 | 157 |
| 616 | 3300050515 | nmdc:mga0a205_137_c1 | nmdc:mga0a205_137_c1_5136_5612 | 157 |
| 617 | 3300050515 | nmdc:mga0a205_377092_c1 | nmdc:mga0a205_377092_c1_469_942 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1twb-assembly1.cif.gz_A | sspb disulfide crosslinked to an ssra degradation tag | 0.978 | 5 | 101 |
| 1zsz-assembly2.cif.gz_B | crystal structure of a computationally designed sspb heterodimer | 0.9775 | 5 | 101 |
| 1ou9-assembly2.cif.gz_B | structure of sspb, a aaa+ protease delivery protein | 0.9735 | 2 | 101 |
| 1ou9-assembly1.cif.gz_A | structure of sspb, a aaa+ protease delivery protein | 0.9735 | 1 | 101 |
| 1ox8-assembly1.cif.gz_B | crystal structure of sspb | 0.9628 | 4 | 101 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ox9G00 | Mainly Beta;Roll;SH3 type barrels.;SspB-like | 0.966 | 1 | 101 | 2.30.30.220 |
| 1ox9G00 | Mainly Beta;Roll;SH3 type barrels.;SspB-like | 0.8967 | 1 | 101 | 2.30.30.220 |
| 1oulA00 | Mainly Beta;Roll;SH3 type barrels.;SspB-like | 0.8417 | 1 | 117 | 2.30.30.220 |
| af_Q9VAW6_82_298_3.40.309.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 | 0.8313 | 58 | 83 | 3.40.309.10 |
| 1oulA00 | Mainly Beta;Roll;SH3 type barrels.;SspB-like | 0.8144 | 1 | 117 | 2.30.30.220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X6WQR2-F1-model_v4 | deleted | 0.9922 | 3 | 91 |
|
| AF-A0A661EAW1-F1-model_v4 | ClpXP protease specificity-enhancing factor | 0.9896 | 5 | 101 |
GO:0005829
GO:0005840 GO:0006508 GO:0008233 GO:0045732 |
| AF-A0A521VCC0-F1-model_v4 | ClpXP protease specificity-enhancing factor | 0.988 | 1 | 77 |
GO:0005829
GO:0005840 GO:0045732 |
| AF-A0A4Q4AZW0-F1-model_v4 | deleted | 0.9878 | 1 | 86 |
|
| AF-A0A090REW0-F1-model_v4 | deleted | 0.9857 | 2 | 86 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar