F469651

General Info

Members Datasets Scaffolds Average Seq Length
617 303 617 146

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0003468|Ga0373926_0003468_2312_2797
Length 161
Sequence LNDKLSEIPTKPYLLRALFEWCVDNGYTPHLAVKVDSRTQVPLEYVKNGEITLNISPNAVHKLQMGNELIEFSARFGGVARQLAVPINNVYALYARETGHGMTFDVDGPKAGVQAKAESEPVREPKHPAIKPPAQLPVPAATSPEPPKKPSGGKPTLRRIK

Samples

Sample ID Description Type Environment
1 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
161 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
162 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
163 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
164 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
165 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
166 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
198 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
199 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
200 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
201 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
202 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
203 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
204 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
205 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
206 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
244 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
249 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
255 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
279 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
284 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
301 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
302 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
303 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 0.32
Rhizosphere 97.89
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARCol0yngRDRAFT_1004317 3300000652 Bacteria 1033
2 Ga0065707_10010183 3300005295 Bacteria 2445
3 Ga0065707_10217684 3300005295 Bacteria 1238
4 Ga0070676_10166220 3300005328 Bacteria 1424
5 Ga0070676_10638324 3300005328 Bacteria 772
6 Ga0070690_100016772 3300005330 Bacteria 4395
7 Ga0070690_100154001 3300005330 Bacteria 1570
8 Ga0070690_100259709 3300005330 Bacteria 1232
9 Ga0070670_101746788 3300005331 Bacteria 573
10 Ga0070677_10164066 3300005333 Bacteria 1045
11 Ga0068869_100000139 3300005334 Bacteria 35367
12 Ga0068869_100152276 3300005334 Bacteria 1794
13 Ga0070680_100000688 3300005336 Bacteria 23463
14 Ga0070680_100163787 3300005336 Bacteria 1869
15 Ga0070680_100468454 3300005336 Bacteria 1076
16 Ga0070680_100669191 3300005336 Bacteria 893
17 Ga0070680_101174924 3300005336 Bacteria 663
18 Ga0070682_100393712 3300005337 Bacteria 1046
19 Ga0068868_100000115 3300005338 Bacteria 50197
20 Ga0068868_101461470 3300005338 Bacteria 639
21 Ga0070689_100049842 3300005340 Bacteria 3233
22 Ga0070689_100076770 3300005340 Bacteria 2617
23 Ga0070689_101317879 3300005340 Bacteria 651
24 Ga0070687_100000091 3300005343 Bacteria 29810
25 Ga0070692_10000335 3300005345 Bacteria 13622
26 Ga0070692_10061598 3300005345 Bacteria 1978
27 Ga0070692_10271833 3300005345 Bacteria 1023
28 Ga0070692_10760541 3300005345 Bacteria 658
29 Ga0070668_100043358 3300005347 Bacteria 3450
30 Ga0070669_100009032 3300005353 Bacteria 7107
31 Ga0070669_100409604 3300005353 Bacteria 1111
32 Ga0070669_100932223 3300005353 Bacteria 743
33 Ga0070675_100052444 3300005354 Bacteria 3353
34 Ga0070675_100646824 3300005354 Bacteria 961
35 Ga0070671_100229083 3300005355 Bacteria 1577
36 Ga0070671_100511204 3300005355 Bacteria 1034
37 Ga0070673_100638566 3300005364 Bacteria 974
38 Ga0070673_100831722 3300005364 Bacteria 854
39 Ga0070688_100108394 3300005365 Bacteria 1843
40 Ga0070703_10113264 3300005406 Bacteria 973
41 Ga0070709_11251110 3300005434 Bacteria 598
42 Ga0070714_100040727 3300005435 Bacteria 3917
43 Ga0070710_10152857 3300005437 Bacteria 1425
44 Ga0070701_10002057 3300005438 Bacteria 7646
45 Ga0070701_10871295 3300005438 Bacteria 620
46 Ga0070711_100325245 3300005439 Bacteria 1230
47 Ga0070711_100498237 3300005439 Bacteria 1004
48 Ga0070711_101445914 3300005439 Bacteria 599
49 Ga0070705_100001761 3300005440 Bacteria 11227
50 Ga0070705_100002781 3300005440 Bacteria 8720
51 Ga0070705_100647351 3300005440 Bacteria 823
52 Ga0070705_100720626 3300005440 Bacteria 786
53 Ga0070705_100856111 3300005440 Bacteria 728
54 Ga0070705_101022743 3300005440 Bacteria 672
55 Ga0070700_100008537 3300005441 Bacteria 5577
56 Ga0070700_100165485 3300005441 Bacteria 1526
57 Ga0070694_100000133 3300005444 Bacteria 37050
58 Ga0070694_100081232 3300005444 Bacteria 2255
59 Ga0070694_100100526 3300005444 Bacteria 2045
60 Ga0070694_100242314 3300005444 Bacteria 1360
61 Ga0070694_101051162 3300005444 Bacteria 678
62 Ga0070708_100139710 3300005445 Bacteria 2246
63 Ga0070681_10000081 3300005458 Bacteria 71809
64 Ga0070681_10145543 3300005458 Bacteria 2299
65 Ga0070681_10277248 3300005458 Bacteria 1588
66 Ga0068867_100000084 3300005459 Bacteria 58558
67 Ga0068867_100000755 3300005459 Bacteria 21746
68 Ga0070685_10219953 3300005466 Bacteria 1244
69 Ga0070706_100429431 3300005467 Bacteria 1229
70 Ga0070699_100008554 3300005518 Bacteria 8868
71 Ga0070699_100080666 3300005518 Bacteria 2836
72 Ga0070699_100356165 3300005518 Bacteria 1319
73 Ga0070679_100003611 3300005530 Bacteria 14138
74 Ga0070684_100100681 3300005535 Bacteria 2581
75 Ga0070697_100000299 3300005536 Bacteria 39638
76 Ga0070697_100001557 3300005536 Bacteria 17448
77 Ga0068853_100199450 3300005539 Bacteria 1821
78 Ga0070672_100199866 3300005543 Bacteria 1671
79 Ga0070672_100320379 3300005543 Bacteria 1318
80 Ga0070686_100000193 3300005544 Bacteria 42276
81 Ga0070686_100004514 3300005544 Bacteria 7674
82 Ga0070686_100189360 3300005544 Bacteria 1467
83 Ga0070686_101331524 3300005544 Bacteria 601
84 Ga0070695_100000303 3300005545 Bacteria 24889
85 Ga0070695_100001505 3300005545 Bacteria 12926
86 Ga0070695_100125662 3300005545 Bacteria 1761
87 Ga0070695_100897377 3300005545 Bacteria 716
88 Ga0070696_100000284 3300005546 Bacteria 30526
89 Ga0070696_100005214 3300005546 Bacteria 8687
90 Ga0070696_100133174 3300005546 Bacteria 1811
91 Ga0070696_100493894 3300005546 Bacteria 973
92 Ga0070696_100508102 3300005546 Bacteria 960
93 Ga0070693_100000111 3300005547 Bacteria 36381
94 Ga0070693_100292019 3300005547 Bacteria 1096
95 Ga0070693_100360433 3300005547 Bacteria 998
96 Ga0070704_100000008 3300005549 Bacteria 71641
97 Ga0070704_100064757 3300005549 Bacteria 2628
98 Ga0068855_100000242 3300005563 Bacteria 68674
99 Ga0070664_101542457 3300005564 Bacteria 629
100 Ga0068857_100870631 3300005577 Bacteria 863
101 Ga0068857_102149844 3300005577 Bacteria 548
102 Ga0068854_100045331 3300005578 Bacteria 3126
103 Ga0068856_100010173 3300005614 Bacteria 9143
104 Ga0070702_100000012 3300005615 Bacteria 58298
105 Ga0070702_100851299 3300005615 Bacteria 710
106 Ga0068852_100176407 3300005616 Bacteria 2007
107 Ga0068859_100005212 3300005617 Bacteria 13208
108 Ga0068864_100412279 3300005618 Bacteria 1286
109 Ga0068866_10000109 3300005718 Bacteria 35401
110 Ga0068866_10044301 3300005718 Bacteria 2225
111 Ga0068861_100016620 3300005719 Bacteria 5210
112 Ga0068861_100140675 3300005719 Bacteria 1969
113 Ga0068861_100345438 3300005719 Bacteria 1303
114 Ga0068861_101306134 3300005719 Bacteria 705
115 Ga0068870_11301106 3300005840 Bacteria 530
116 Ga0068863_100583404 3300005841 Bacteria 1106
117 Ga0068858_100287149 3300005842 Bacteria 1567
118 Ga0068858_100561221 3300005842 Bacteria 1106
119 Ga0068860_100005589 3300005843 Bacteria 12708
120 Ga0068862_100002876 3300005844 Bacteria 15079
121 Ga0068862_100247792 3300005844 Bacteria 1622
122 Ga0068862_100722720 3300005844 Bacteria 966
123 Ga0068862_101050474 3300005844 Bacteria 808
124 Ga0081539_10005168 3300005985 Bacteria 13568
125 Ga0075364_10012099 3300006051 Bacteria 5267
126 Ga0070715_10147971 3300006163 Bacteria 1148
127 Ga0070716_100337509 3300006173 Bacteria 1062
128 Ga0070712_100220327 3300006175 Bacteria 1502
129 Ga0070712_100484186 3300006175 Bacteria 1035
130 Ga0097621_100000756 3300006237 Bacteria 22691
131 Ga0097621_100040927 3300006237 Bacteria 3727
132 Ga0068871_100000559 3300006358 Bacteria 25362
133 Ga0068871_100000588 3300006358 Bacteria 24949
134 Ga0068871_100411112 3300006358 Bacteria 1206
135 Ga0075428_100000183 3300006844 Bacteria 58831
136 Ga0075428_100116077 3300006844 Bacteria 2916
137 Ga0075428_100195195 3300006844 Bacteria 2189
138 Ga0075428_100257457 3300006844 Bacteria 1880
139 Ga0075428_100578279 3300006844 Bacteria 1200
140 Ga0075430_100120254 3300006846 Bacteria 2189
141 Ga0075430_100149148 3300006846 Bacteria 1947
142 Ga0075431_100024403 3300006847 Bacteria 6196
143 Ga0075431_100353244 3300006847 Bacteria 1477
144 Ga0075431_100359887 3300006847 Bacteria 1462
145 Ga0075431_100481072 3300006847 Bacteria 1234
146 Ga0075433_10000480 3300006852 Bacteria 26041
147 Ga0075433_10456184 3300006852 Bacteria 1126
148 Ga0075433_10539614 3300006852 Bacteria 1026
149 Ga0075433_10680256 3300006852 Bacteria 902
150 Ga0075434_100000079 3300006871 Bacteria 52051
151 Ga0075434_100001287 3300006871 Bacteria 20920
152 Ga0075434_100027998 3300006871 Bacteria 5533
153 Ga0075434_100172686 3300006871 Bacteria 2182
154 Ga0075434_100460018 3300006871 Bacteria 1294
155 Ga0075434_100897053 3300006871 Bacteria 901
156 Ga0075429_100000891 3300006880 Bacteria 23613
157 Ga0075429_100039432 3300006880 Bacteria 4110
158 Ga0068865_100001481 3300006881 Bacteria 13669
159 Ga0068865_100028296 3300006881 Bacteria 3709
160 Ga0068865_102026390 3300006881 Bacteria 523
161 Ga0075436_100000529 3300006914 Bacteria 24848
162 Ga0075436_100005350 3300006914 Bacteria 8832
163 Ga0075436_100034418 3300006914 Bacteria 3493
164 Ga0075436_100060029 3300006914 Bacteria 2627
165 Ga0075436_100076432 3300006914 Bacteria 2319
166 Ga0075436_100094639 3300006914 Bacteria 2077
167 Ga0075436_100125923 3300006914 Bacteria 1795
168 Ga0097620_100005212 3300006931 Bacteria 13208
169 Ga0075435_100027298 3300007076 Bacteria 4464
170 Ga0075435_100078504 3300007076 Bacteria 2707
171 Ga0075435_100199926 3300007076 Bacteria 1693
172 Ga0075435_100294934 3300007076 Bacteria 1386
173 Ga0099794_10190473 3300007265 Bacteria 1049
174 Ga0099794_10244627 3300007265 Bacteria 924
175 Ga0099794_10305082 3300007265 Bacteria 825
176 Ga0099795_10026232 3300007788 Bacteria 1961
177 Ga0111539_10059022 3300009094 Bacteria 4551
178 Ga0111539_10180623 3300009094 Bacteria 2464
179 Ga0111539_10286237 3300009094 Bacteria 1918
180 Ga0111539_10448554 3300009094 Bacteria 1502
181 Ga0111539_10512605 3300009094 Bacteria 1397
182 Ga0111539_11541672 3300009094 Bacteria 771
183 Ga0105245_10000245 3300009098 Bacteria 51952
184 Ga0105245_11129038 3300009098 Bacteria 830
185 Ga0105245_11328017 3300009098 Bacteria 768
186 Ga0105247_11393726 3300009101 Unclassified 567
187 Ga0114129_10000219 3300009147 Bacteria 63579
188 Ga0114129_10053431 3300009147 Bacteria 5665
189 Ga0114129_12491464 3300009147 Bacteria 619
190 Ga0105243_10000279 3300009148 Bacteria 56997
191 Ga0105243_10035369 3300009148 Bacteria 3872
192 Ga0105243_11684111 3300009148 Bacteria 663
193 Ga0105241_10029972 3300009174 Bacteria 4064
194 Ga0105242_10000480 3300009176 Bacteria 31755
195 Ga0105248_10139905 3300009177 Bacteria 2730
196 Ga0105248_10388289 3300009177 Bacteria 1572
197 Ga0105237_11258178 3300009545 Bacteria 746
198 Ga0105249_10001388 3300009553 Bacteria 21206
199 Ga0105249_10003616 3300009553 Bacteria 13369
200 Ga0105239_10284425 3300010375 Bacteria 1862
201 Ga0157345_1010036 3300012498 Bacteria 818
202 Ga0157369_10731336 3300013105 Bacteria 1018
203 Ga0157378_10000294 3300013297 Bacteria 48405
204 Ga0163162_10218721 3300013306 Bacteria 2035
205 Ga0163162_10270340 3300013306 Bacteria 1831
206 Ga0157372_10204428 3300013307 Bacteria 2288
207 Ga0157375_10567393 3300013308 Bacteria 1296
208 Ga0157380_10061130 3300014326 Bacteria 3013
209 Ga0157380_13441885 3300014326 Bacteria 507
210 Ga0157377_10247375 3300014745 Bacteria 1154
211 Ga0207653_10011595 3300025885 Bacteria 2749
212 Ga0207692_10006506 3300025898 Bacteria 4742
213 Ga0207642_10000913 3300025899 Bacteria 9234
214 Ga0207688_10020516 3300025901 Bacteria 3608
215 Ga0207688_10190654 3300025901 Bacteria 1226
216 Ga0207647_10037052 3300025904 Bacteria 3095
217 Ga0207685_10114128 3300025905 Bacteria 1176
218 Ga0207645_10253509 3300025907 Bacteria 1165
219 Ga0207645_10456069 3300025907 Bacteria 863
220 Ga0207643_10038216 3300025908 Bacteria 2696
221 Ga0207643_10134949 3300025908 Bacteria 1471
222 Ga0207684_10570821 3300025910 Bacteria 967
223 Ga0207654_10010311 3300025911 Bacteria 4756
224 Ga0207707_10002239 3300025912 Bacteria 17488
225 Ga0207707_10205636 3300025912 Bacteria 1716
226 Ga0207707_10288502 3300025912 Bacteria 1420
227 Ga0207663_10352943 3300025916 Bacteria 1114
228 Ga0207663_11117569 3300025916 Bacteria 634
229 Ga0207660_10004569 3300025917 Bacteria 9015
230 Ga0207660_10245533 3300025917 Bacteria 1412
231 Ga0207660_10318649 3300025917 Bacteria 1241
232 Ga0207660_10328845 3300025917 Bacteria 1222
233 Ga0207662_10000285 3300025918 Bacteria 23452
234 Ga0207662_10138015 3300025918 Bacteria 1542
235 Ga0207662_10188327 3300025918 Bacteria 1331
236 Ga0207662_10269198 3300025918 Bacteria 1124
237 Ga0207662_10626435 3300025918 Bacteria 750
238 Ga0207652_10029970 3300025921 Bacteria 4554
239 Ga0207646_10785687 3300025922 Bacteria 848
240 Ga0207681_10296737 3300025923 Bacteria 1277
241 Ga0207659_10030671 3300025926 Bacteria 3675
242 Ga0207687_10001352 3300025927 Bacteria 16793
243 Ga0207700_10363290 3300025928 Bacteria 1263
244 Ga0207664_10171573 3300025929 Bacteria 1857
245 Ga0207706_10435461 3300025933 Bacteria 1135
246 Ga0207686_10001979 3300025934 Bacteria 11292
247 Ga0207709_10000549 3300025935 Bacteria 32146
248 Ga0207709_10002601 3300025935 Bacteria 11247
249 Ga0207670_10003216 3300025936 Bacteria 8653
250 Ga0207670_10497576 3300025936 Bacteria 989
251 Ga0207669_10025345 3300025937 Bacteria 3204
252 Ga0207704_10007942 3300025938 Bacteria 5045
253 Ga0207704_10252977 3300025938 Bacteria 1324
254 Ga0207665_10501953 3300025939 Bacteria 937
255 Ga0207665_10895233 3300025939 Bacteria 704
256 Ga0207691_10027511 3300025940 Bacteria 5330
257 Ga0207691_10144443 3300025940 Bacteria 2095
258 Ga0207711_10220115 3300025941 Bacteria 1736
259 Ga0207689_10000293 3300025942 Bacteria 45522
260 Ga0207689_10028985 3300025942 Bacteria 4628
261 Ga0207689_10970247 3300025942 Bacteria 717
262 Ga0207667_10002578 3300025949 Bacteria 22517
263 Ga0207651_10563432 3300025960 Bacteria 992
264 Ga0207712_10000959 3300025961 Bacteria 20778
265 Ga0207712_10001259 3300025961 Bacteria 17480
266 Ga0207640_10003141 3300025981 Bacteria 8893
267 Ga0207658_10906090 3300025986 Bacteria 803
268 Ga0207677_10000669 3300026023 Bacteria 20376
269 Ga0207703_10048738 3300026035 Bacteria 3421
270 Ga0207639_10050576 3300026041 Bacteria 3157
271 Ga0207708_10019059 3300026075 Bacteria 5167
272 Ga0207708_10093936 3300026075 Bacteria 2315
273 Ga0207702_10006239 3300026078 Bacteria 10305
274 Ga0207648_10000185 3300026089 Bacteria 65925
275 Ga0207648_10086304 3300026089 Bacteria 2738
276 Ga0207674_10635153 3300026116 Bacteria 1031
277 Ga0207675_100000150 3300026118 Bacteria 61064
278 Ga0207675_100000812 3300026118 Bacteria 31052
279 Ga0207698_10167404 3300026142 Bacteria 1931
280 Ga0209967_1003247 3300027364 Bacteria 2140
281 Ga0209981_1000782 3300027378 Bacteria 4014
282 Ga0210000_1002477 3300027462 Bacteria 2628
283 Ga0209588_1032497 3300027671 Bacteria 1672
284 Ga0209588_1055415 3300027671 Bacteria 1281
285 Ga0207428_10000290 3300027907 Bacteria 67367
286 Ga0207428_10148564 3300027907 Bacteria 1785
287 Ga0207428_10260527 3300027907 Bacteria 1292
288 Ga0268265_10001010 3300028380 Bacteria 25458
289 Ga0268265_10031660 3300028380 Bacteria 3821
290 Ga0268265_11619770 3300028380 Bacteria 652
291 Ga0268264_10000580 3300028381 Bacteria 44357
292 Ga0265316_10018991 3300031344 Bacteria 5897
293 Ga0265316_10374881 3300031344 Bacteria 1027
294 Ga0307509_10866651 3300031507 Bacteria 568
295 Ga0307408_100567135 3300031548 Bacteria 1004
296 Ga0307408_100614634 3300031548 Bacteria 967
297 Ga0307413_10565819 3300031824 Bacteria 925
298 Ga0307412_10036695 3300031911 Bacteria 3143
299 Ga0307412_10451548 3300031911 Bacteria 1059
300 Ga0307412_10811776 3300031911 Bacteria 813
301 Ga0307409_101501168 3300031995 Bacteria 701
302 Ga0307416_100056591 3300032002 Bacteria 3166
303 Ga0307416_100124639 3300032002 Bacteria 2305
304 Ga0307416_100480552 3300032002 Bacteria 1302
305 Ga0307416_100618117 3300032002 Bacteria 1165
306 Ga0307416_100994916 3300032002 Bacteria 941
307 Ga0307416_101135522 3300032002 Bacteria 886
308 Ga0307416_102252803 3300032002 Bacteria 646
309 Ga0307411_10118852 3300032005 Bacteria 1908
310 Ga0307411_10487864 3300032005 Bacteria 1039
311 Ga0307411_10818454 3300032005 Bacteria 821
312 Ga0307415_100558325 3300032126 Bacteria 1012
313 Ga0307415_100965244 3300032126 Bacteria 790
314 Ga0307415_101285716 3300032126 Bacteria 692
315 Ga0373930_0005659 3300034816 Bacteria 2085
316 Ga0373950_0060394 3300034818 Bacteria 760
317 Ga0373958_0064377 3300034819 Bacteria 801
318 Ga0373938_0064950 3300034957 Bacteria 861
319 Ga0373926_0003468 3300035083 Bacteria 5092
320 Ga0373928_0162206 3300035084 Bacteria 625
321 Ga0373929_0034185 3300035085 Bacteria 1101
322 Ga0373934_0043110 3300035086 Bacteria 1783
323 Ga0373940_0355254 3300035088 Bacteria 515
324 Ga0373944_0051715 3300035089 Bacteria 1296
325 Ga0373949_0042848 3300035090 Bacteria 1118
326 Ga0373952_0001581 3300035092 Bacteria 4154
327 Ga0373952_0019919 3300035092 Bacteria 1401
328 Ga0373952_0022032 3300035092 Bacteria 1350
329 Ga0373952_0024547 3300035092 Bacteria 1295
330 Ga0373932_0005643 3300035112 Bacteria 2943
331 Ga0373932_0125834 3300035112 Bacteria 859
332 Ga0373932_0144706 3300035112 Bacteria 811
333 Ga0373936_0006530 3300035113 Bacteria 4393
334 Ga0373939_0054963 3300035114 Bacteria 1248
335 Ga0373939_0255362 3300035114 Bacteria 684
336 Ga0373941_0023589 3300035115 Bacteria 1758
337 Ga0373941_0024345 3300035115 Bacteria 1738
338 Ga0373941_0041270 3300035115 Bacteria 1427
339 Ga0373945_0001983 3300035116 Bacteria 6358
340 Ga0373953_0037524 3300035117 Bacteria 1912
341 Ga0373953_0118763 3300035117 Bacteria 1122
342 Ga0373954_0001511 3300035118 Bacteria 9463
343 Ga0373956_0076665 3300035119 Bacteria 1530
344 Ga0373957_0077834 3300035120 Bacteria 1305
345 Ga0373955_0015830 3300035172 Bacteria 3699
346 Ga0373942_0076624 3300035207 Bacteria 986
347 Ga0373942_0248958 3300035207 Bacteria 603
348 Ga0373961_0049213 3300035241 Bacteria 1245
349 Ga0373962_0006941 3300035242 Bacteria 2759
350 Ga0373962_0086573 3300035242 Bacteria 959
351 Ga0373924_0015301 3300035410 Bacteria 2915
352 Ga0373931_0001802 3300035691 Bacteria 9317
353 Ga0373931_0037732 3300035691 Bacteria 2523
354 Ga0373935_0195970 3300035692 Bacteria 1394
355 Ga0373935_0363644 3300035692 Bacteria 1033
356 Ga0373935_0766290 3300035692 Bacteria 711
357 Ga0373927_0084775 3300035695 Bacteria 2055
358 Ga0373927_0647041 3300035695 Bacteria 699
359 Ga0373933_0006341 3300035724 Bacteria 6436
360 Ga0373933_0028698 3300035724 Bacteria 3211
361 Ga0373933_0299227 3300035724 Bacteria 1041
362 Ga0373933_0635445 3300035724 Bacteria 701
363 Ga0373947_0097992 3300035725 Bacteria 1838
364 Ga0373937_0038399 3300036401 Bacteria 4362
365 Ga0373937_0047453 3300036401 Bacteria 3929
366 Ga0373937_0066894 3300036401 Bacteria 3310
367 Ga0373937_0117705 3300036401 Bacteria 2475
368 Ga0373937_2111944 3300036401 Bacteria 509
369 Ga0373925_0029441 3300037068 Bacteria 4029
370 Ga0373925_0169885 3300037068 Bacteria 1721
371 Ga0373925_0504189 3300037068 Bacteria 994
372 Ga0436365_1860246 3300039437 Bacteria 627
373 Ga0436360_0435182 3300039438 Bacteria 859
374 Ga0436363_0132198 3300039450 Bacteria 883
375 Ga0436363_0210243 3300039450 Bacteria 727
376 Ga0451807_1150880 3300041486 Bacteria 1010
377 Ga0451839_0100477 3300041496 Bacteria 842
378 Ga0451839_0404989 3300041496 Bacteria 817
379 Ga0451839_0760959 3300041496 Bacteria 1052
380 Ga0451849_1032019 3300041505 Bacteria 716
381 Ga0451843_1223335 3300041509 Bacteria 1150
382 Ga0439431_0044157 3300041997 Bacteria 1142
383 Ga0439441_009068 3300042001 Bacteria 1639
384 Ga0439446_0086173 3300042156 Bacteria 978
385 Ga0439434_0046342 3300042435 Bacteria 1342
386 Ga0439434_0047796 3300042435 Bacteria 1322
387 Ga0439435_0009935 3300042436 Bacteria 2245
388 Ga0439444_0004549 3300042437 Bacteria 2022
389 Ga0439464_0128884 3300042439 Bacteria 783
390 Ga0451577_0104973 3300042876 Bacteria 2525
391 Ga0466965_0443298 3300044683 Bacteria 722
392 Ga0466964_0157565 3300044706 Bacteria 1058
393 Ga0453684_0005767 3300044712 Bacteria 24180
394 Ga0453684_2150294 3300044712 Bacteria 558
395 Ga0466971_0345568 3300044719 Bacteria 719
396 Ga0466960_0203021 3300044901 Bacteria 1084
397 Ga0451576_0001107 3300045051 Bacteria 49185
398 Ga0451576_0053818 3300045051 Bacteria 4214
399 Ga0451576_0330463 3300045051 Bacteria 1595
400 Ga0451576_0425970 3300045051 Bacteria 1392
401 Ga0451576_0493615 3300045051 Bacteria 1286
402 Ga0495592_0283137 3300046454 Bacteria 1084
403 Ga0495603_0023231 3300046455 Bacteria 3754
404 Ga0495603_0165540 3300046455 Bacteria 1282
405 Ga0495629_0227091 3300046459 Bacteria 1287
406 Ga0495653_0361940 3300046463 Bacteria 931
407 Ga0495580_0005567 3300046472 Bacteria 10387
408 Ga0495582_0073235 3300046473 Bacteria 1896
409 Ga0495639_0035947 3300046475 Bacteria 2217
410 Ga0495662_0013878 3300046476 Bacteria 3921
411 Ga0495608_0000767 3300046511 Bacteria 22475
412 Ga0495608_0547506 3300046511 Bacteria 697
413 Ga0495618_0009252 3300046514 Bacteria 5945
414 Ga0495618_0441998 3300046514 Bacteria 790
415 Ga0495628_0001090 3300046516 Bacteria 24809
416 Ga0495630_0001546 3300046517 Bacteria 15988
417 Ga0495630_0078786 3300046517 Bacteria 2485
418 Ga0495630_0143014 3300046517 Bacteria 1819
419 Ga0495630_0259875 3300046517 Bacteria 1326
420 Ga0495666_0034170 3300046526 Bacteria 2481
421 Ga0495652_0044840 3300046529 Bacteria 3806
422 Ga0495652_0052673 3300046529 Bacteria 3470
423 Ga0495665_0093296 3300046531 Bacteria 1582
424 Ga0495640_0005052 3300046533 Bacteria 10476
425 Ga0495640_0231639 3300046533 Bacteria 1161
426 Ga0495586_0000790 3300046535 Bacteria 18209
427 Ga0495587_0026751 3300046536 Bacteria 3514
428 Ga0495598_0243269 3300046537 Bacteria 664
429 Ga0495645_0408147 3300046543 Bacteria 864
430 Ga0495667_0000941 3300046559 Bacteria 18791
431 Ga0495634_0000957 3300046642 Bacteria 27315
432 Ga0495635_0025694 3300046663 Bacteria 4103
433 Ga0495635_0380217 3300046663 Bacteria 940
434 Ga0495659_0013310 3300046664 Bacteria 2679
435 Ga0495657_0117720 3300046675 Bacteria 1676
436 Ga0495599_0057194 3300046678 Bacteria 2440
437 Ga0495647_0000304 3300046681 Bacteria 13816
438 Ga0495658_0014094 3300046683 Bacteria 4076
439 Ga0495658_0048489 3300046683 Bacteria 2395
440 Ga0495669_0010927 3300046684 Bacteria 3842
441 Ga0495669_0250381 3300046684 Bacteria 851
442 Ga0495624_0080945 3300046690 Bacteria 2012
443 Ga0495624_0182826 3300046690 Bacteria 1277
444 Ga0495624_0262093 3300046690 Bacteria 1044
445 Ga0495670_0368472 3300046691 Bacteria 774
446 Ga0495600_0013997 3300046809 Bacteria 5055
447 Ga0495581_0100413 3300047315 Bacteria 1681
448 Ga0495581_0245736 3300047315 Bacteria 1046
449 Ga0495604_0007822 3300047317 Bacteria 8463
450 Ga0495604_0133473 3300047317 Bacteria 1782
451 Ga0495636_0250262 3300047318 Bacteria 819
452 Ga0495676_0036800 3300047321 Bacteria 4082
453 Ga0495680_0002465 3300047322 Bacteria 18939
454 Ga0495680_0104671 3300047322 Bacteria 2105
455 Ga0495677_0174578 3300047445 Bacteria 832
456 Ga0495684_0399302 3300047471 Bacteria 965
457 Ga0496109_0707805 3300048912 Bacteria 945
458 Ga0501291_004472 3300049514 Bacteria 1788
459 Ga0501297_018511 3300049520 Bacteria 855
460 Ga0501031_0175943 3300049568 Bacteria 1398
461 Ga0501031_0275344 3300049568 Bacteria 1092
462 Ga0501031_0727779 3300049568 Bacteria 637
463 Ga0501032_0255336 3300049569 Bacteria 1137
464 Ga0501034_0946447 3300049571 Bacteria 747
465 Ga0501036_0013192 3300049572 Bacteria 6863
466 Ga0501036_0082064 3300049572 Bacteria 2725
467 Ga0501036_0353614 3300049572 Bacteria 1227
468 Ga0501037_0161709 3300049573 Bacteria 1596
469 Ga0501037_0194123 3300049573 Bacteria 1437
470 Ga0501038_0007492 3300049574 Bacteria 10065
471 Ga0501038_0150351 3300049574 Bacteria 1899
472 Ga0501038_0173450 3300049574 Bacteria 1744
473 Ga0501038_1327321 3300049574 Unclassified 519
474 Ga0501039_0039139 3300049575 Bacteria 3662
475 Ga0501039_0046020 3300049575 Bacteria 3371
476 Ga0501039_0106931 3300049575 Bacteria 2185
477 Ga0501039_0405570 3300049575 Bacteria 1070
478 Ga0501040_0030621 3300049576 Bacteria 3635
479 Ga0501040_0205115 3300049576 Bacteria 1400
480 Ga0501040_0609479 3300049576 Bacteria 789
481 Ga0501040_0725776 3300049576 Bacteria 719
482 Ga0501041_0002591 3300049577 Bacteria 10314
483 Ga0501041_0143185 3300049577 Bacteria 1491
484 Ga0501041_0269754 3300049577 Bacteria 1070
485 Ga0501042_0199581 3300049578 Bacteria 1442
486 Ga0501042_0282669 3300049578 Bacteria 1198
487 Ga0501042_0354323 3300049578 Bacteria 1062
488 Ga0501042_0509277 3300049578 Bacteria 874
489 Ga0501042_0999069 3300049578 Bacteria 610
490 Ga0501043_0214531 3300049579 Bacteria 1491
491 Ga0501043_0728548 3300049579 Bacteria 722
492 Ga0501046_0111666 3300049580 Bacteria 2087
493 Ga0501046_0176322 3300049580 Bacteria 1601
494 Ga0501048_0020297 3300049582 Bacteria 4870
495 Ga0501048_0047309 3300049582 Bacteria 3069
496 Ga0501048_0304880 3300049582 Bacteria 1133
497 Ga0501048_0415730 3300049582 Bacteria 962
498 Ga0501048_0561559 3300049582 Bacteria 819
499 Ga0501048_0603102 3300049582 Bacteria 788
500 Ga0501048_0678153 3300049582 Bacteria 740
501 Ga0501048_0941674 3300049582 Bacteria 621
502 Ga0501068_0023674 3300049584 Bacteria 3601
503 Ga0501069_0265760 3300049585 Bacteria 1002
504 Ga0501071_0006939 3300049587 Bacteria 7390
505 Ga0501071_0008794 3300049587 Bacteria 6691
506 Ga0501071_0164986 3300049587 Bacteria 1657
507 Ga0501071_0350970 3300049587 Bacteria 1123
508 Ga0501072_0058372 3300049588 Bacteria 3042
509 Ga0501072_0076655 3300049588 Bacteria 2645
510 Ga0501072_0266316 3300049588 Bacteria 1363
511 Ga0501072_0386767 3300049588 Bacteria 1110
512 Ga0501072_1310184 3300049588 Bacteria 561
513 Ga0501073_0223288 3300049589 Bacteria 1301
514 Ga0501073_0360847 3300049589 Bacteria 1003
515 Ga0501073_0609725 3300049589 Bacteria 754
516 Ga0501073_0880149 3300049589 Bacteria 617
517 Ga0501074_0050093 3300049590 Bacteria 3015
518 Ga0501074_0244649 3300049590 Bacteria 1276
519 Ga0501074_0377690 3300049590 Bacteria 1005
520 Ga0501075_0002081 3300049591 Bacteria 13218
521 Ga0501075_0018354 3300049591 Bacteria 5062
522 Ga0501075_0232316 3300049591 Bacteria 1406
523 Ga0501075_0772674 3300049591 Bacteria 731
524 Ga0501076_0003361 3300049592 Bacteria 11230
525 Ga0501076_0004745 3300049592 Bacteria 9700
526 Ga0501076_0178619 3300049592 Bacteria 1730
527 Ga0501076_0433033 3300049592 Bacteria 1082
528 Ga0501076_0922662 3300049592 Bacteria 720
529 Ga0501077_0039802 3300049593 Bacteria 2994
530 Ga0501077_0316384 3300049593 Bacteria 995
531 Ga0501253_216035 3300049683 Bacteria 512
532 Ga0501257_123734 3300049686 Bacteria 695
533 Ga0501079_0025100 3300049741 Bacteria 4572
534 Ga0501079_0193061 3300049741 Bacteria 1590
535 Ga0501079_0321155 3300049741 Bacteria 1212
536 Ga0501079_0350600 3300049741 Bacteria 1156
537 Ga0501080_0000502 3300049742 Bacteria 30705
538 Ga0501080_0023192 3300049742 Bacteria 5755
539 Ga0501080_0115785 3300049742 Bacteria 2485
540 Ga0501080_0644027 3300049742 Bacteria 938
541 Ga0501081_0018316 3300049743 Bacteria 4648
542 Ga0501081_0021954 3300049743 Bacteria 4265
543 Ga0501081_0179698 3300049743 Bacteria 1530
544 Ga0501081_0235188 3300049743 Bacteria 1335
545 Ga0501081_0395352 3300049743 Bacteria 1023
546 Ga0501083_0225342 3300049744 Bacteria 1221
547 Ga0501083_0381419 3300049744 Bacteria 917
548 Ga0501035_0407409 3300049822 Bacteria 1130
549 Ga0501035_1389779 3300049822 Bacteria 538
550 Ga0501045_0004712 3300049824 Bacteria 9418
551 Ga0501045_0028922 3300049824 Bacteria 4000
552 Ga0501045_0035938 3300049824 Bacteria 3597
553 Ga0501045_1106240 3300049824 Bacteria 579
554 Ga0501204_088375 3300049850 Bacteria 537
555 nmdc:mga00v17_35964_c1 3300050491 Bacteria 2950
556 nmdc:mga05p37_389_c1 3300050507 Bacteria 47594
557 nmdc:mga05p37_45015_c1 3300050507 Bacteria 5429
558 nmdc:mga09592_304370_c1 3300050508 Bacteria 1382
559 nmdc:mga09592_34542_c1 3300050508 Bacteria 4227
560 nmdc:mga09592_542054_c1 3300050508 Bacteria 1000
561 nmdc:mga09592_82027_c1 3300050508 Bacteria 2748
562 nmdc:mga0qj67_307700_c1 3300050509 Bacteria 1284
563 nmdc:mga0qj67_79719_c1 3300050509 Bacteria 2623
564 nmdc:mga06r32_1020465_c1 3300050510 Bacteria 779
565 nmdc:mga06r32_1092963_c1 3300050510 Bacteria 747
566 nmdc:mga06r32_1321144_c1 3300050510 Bacteria 665
567 nmdc:mga06r32_822135_c1 3300050510 Bacteria 889
568 nmdc:mga08y16_1010092_c1 3300050511 Bacteria 811
569 nmdc:mga08y16_115995_c1 3300050511 Bacteria 2788
570 nmdc:mga08y16_198287_c1 3300050511 Bacteria 2081
571 nmdc:mga08y16_5420_c1 3300050511 Bacteria 13338
572 nmdc:mga08y16_686592_c1 3300050511 Bacteria 1025
573 nmdc:mga08y16_721077_c1 3300050511 Bacteria 995
574 nmdc:mga0n895_1129388_c1 3300050512 Bacteria 760
575 nmdc:mga0n895_1165355_c1 3300050512 Bacteria 746
576 nmdc:mga0n895_166929_c1 3300050512 Bacteria 2233
577 nmdc:mga0n895_189176_c1 3300050512 Bacteria 2090
578 nmdc:mga0n895_42017_c1 3300050512 Bacteria 4447
579 nmdc:mga0n895_734_c1 3300050512 Bacteria 23141
580 nmdc:mga0n895_807251_c1 3300050512 Bacteria 928
581 nmdc:mga0n895_81695_c1 3300050512 Bacteria 3221
582 nmdc:mga0rr50_193612_c1 3300050513 Bacteria 1667
583 nmdc:mga0rr50_228516_c1 3300050513 Bacteria 1539
584 nmdc:mga0rr50_27655_c1 3300050513 Bacteria 3975
585 nmdc:mga0rr50_316265_c1 3300050513 Bacteria 1308
586 nmdc:mga0rr50_4968_c1 3300050513 Bacteria 7875
587 nmdc:mga0rr50_7917_c1 3300050513 Bacteria 6593
588 nmdc:mga0rr50_91960_c1 3300050513 Bacteria 2364
589 nmdc:mga08x19_113031_c1 3300050514 Bacteria 1813
590 nmdc:mga08x19_21818_c1 3300050514 Bacteria 3957
591 nmdc:mga08x19_23320_c1 3300050514 Bacteria 3839
592 nmdc:mga08x19_258_c1 3300050514 Bacteria 28365
593 nmdc:mga08x19_381080_c1 3300050514 Bacteria 988
594 nmdc:mga08x19_66083_c1 3300050514 Bacteria 2350
595 nmdc:mga08x19_66559_c1 3300050514 Bacteria 2342
596 nmdc:mga08x19_84428_c1 3300050514 Bacteria 2089
597 nmdc:mga0a205_137_c1 3300050515 Bacteria 46112
598 nmdc:mga0a205_377092_c1 3300050515 Bacteria 1284
599 nmdc:mga0a205_44949_c1 3300050515 Bacteria 4259
600 nmdc:mga0a205_545975_c1 3300050515 Bacteria 1014
601 Ga0495601_0192052 3300053077 Bacteria 1334
602 Ga0495595_0368492 3300053084 Bacteria 726
603 Ga0495619_0188567 3300053085 Bacteria 1427
604 Ga0501084_0033552 3300054114 Bacteria 4294
605 Ga0501084_0037733 3300054114 Bacteria 4038
606 Ga0501084_0078625 3300054114 Bacteria 2765
607 Ga0501084_0123263 3300054114 Bacteria 2180
608 Ga0501084_0623812 3300054114 Bacteria 911
609 Ga0501084_1332512 3300054114 Bacteria 601
610 Ga0501084_1434633 3300054114 Bacteria 578
611 Ga0590071_063953 3300059421 Bacteria 902
612 Ga0501082_0048685 3300060353 Bacteria 3653
613 Ga0501082_0082355 3300060353 Bacteria 2777
614 Ga0501082_0324336 3300060353 Bacteria 1342
615 Ga0530510_0014387 3300061734 Bacteria 5579
616 Ga0530510_0418221 3300061734 Bacteria 1011
617 Ga0530510_0457034 3300061734 Bacteria 966

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041496 Ga0451839_0100477 Ga0451839_0100477_426_818 111
2 3300031344 Ga0265316_10018991 Ga0265316_100189918 116
3 3300044712 Ga0453684_2150294 Ga0453684_2150294_20_451 124
4 3300005440 Ga0070705_100720626 Ga0070705_1007206262 128
5 3300005546 Ga0070696_100493894 Ga0070696_1004938943 128
6 3300005719 Ga0068861_100345438 Ga0068861_1003454383 128
7 3300031507 Ga0307509_10866651 Ga0307509_108666511 128
8 3300036401 Ga0373937_0066894 Ga0373937_0066894_1189_1632 128
9 3300041509 Ga0451843_1223335 Ga0451843_1223335_184_618 128
10 3300046463 Ga0495653_0361940 Ga0495653_0361940_88_531 128
11 3300046511 Ga0495608_0000767 Ga0495608_0000767_13811_14254 128
12 3300046514 Ga0495618_0009252 Ga0495618_0009252_3763_4206 128
13 3300046516 Ga0495628_0001090 Ga0495628_0001090_23353_23796 128
14 3300046517 Ga0495630_0001546 Ga0495630_0001546_15392_15835 128
15 3300046529 Ga0495652_0052673 Ga0495652_0052673_1527_1970 128
16 3300046533 Ga0495640_0005052 Ga0495640_0005052_1812_2255 128
17 3300046535 Ga0495586_0000790 Ga0495586_0000790_16546_16989 128
18 3300046536 Ga0495587_0026751 Ga0495587_0026751_1387_1830 128
19 3300046559 Ga0495667_0000941 Ga0495667_0000941_16586_17029 128
20 3300046642 Ga0495634_0000957 Ga0495634_0000957_4674_5117 128
21 3300046678 Ga0495599_0057194 Ga0495599_0057194_1230_1673 128
22 3300046683 Ga0495658_0048489 Ga0495658_0048489_570_1013 128
23 3300046690 Ga0495624_0080945 Ga0495624_0080945_601_1044 128
24 3300046809 Ga0495600_0013997 Ga0495600_0013997_2106_2549 128
25 3300047317 Ga0495604_0007822 Ga0495604_0007822_3678_4121 128
26 3300047322 Ga0495680_0002465 Ga0495680_0002465_4918_5361 128
27 3300047471 Ga0495684_0399302 Ga0495684_0399302_72_515 128
28 3300049575 Ga0501039_0405570 Ga0501039_0405570_412_840 128
29 3300049576 Ga0501040_0609479 Ga0501040_0609479_195_623 128
30 3300049582 Ga0501048_0561559 Ga0501048_0561559_253_681 128
31 3300049588 Ga0501072_0386767 Ga0501072_0386767_530_958 128
32 3300049591 Ga0501075_0232316 Ga0501075_0232316_388_816 128
33 3300049592 Ga0501076_0003361 Ga0501076_0003361_633_1061 128
34 3300049743 Ga0501081_0179698 Ga0501081_0179698_677_1105 128
35 3300053077 Ga0495601_0192052 Ga0495601_0192052_133_576 128
36 3300053084 Ga0495595_0368492 Ga0495595_0368492_202_645 128
37 3300053085 Ga0495619_0188567 Ga0495619_0188567_923_1366 128
38 3300054114 Ga0501084_1332512 Ga0501084_1332512_14_442 128
39 3300005444 Ga0070694_100100526 Ga0070694_1001005263 129
40 3300005546 Ga0070696_100508102 Ga0070696_1005081022 129
41 3300005549 Ga0070704_100064757 Ga0070704_1000647574 129
42 3300005844 Ga0068862_101050474 Ga0068862_1010504742 129
43 3300025922 Ga0207646_10785687 Ga0207646_107856872 129
44 3300035242 Ga0373962_0086573 Ga0373962_0086573_551_940 129
45 3300036401 Ga0373937_2111944 Ga0373937_2111944_93_485 129
46 3300049824 Ga0501045_1106240 Ga0501045_1106240_101_529 129
47 3300005458 Ga0070681_10145543 Ga0070681_101455432 130
48 3300006852 Ga0075433_10539614 Ga0075433_105396142 130
49 3300006871 Ga0075434_100000079 Ga0075434_10000007938 130
50 3300006914 Ga0075436_100076432 Ga0075436_1000764322 130
51 3300007076 Ga0075435_100027298 Ga0075435_1000272982 130
52 3300013307 Ga0157372_10204428 Ga0157372_102044282 130
53 3300025912 Ga0207707_10288502 Ga0207707_102885023 130
54 3300035724 Ga0373933_0299227 Ga0373933_0299227_481_933 130
55 3300036401 Ga0373937_0117705 Ga0373937_0117705_220_672 130
56 3300042001 Ga0439441_009068 Ga0439441_009068_629_1114 130
57 3300050512 nmdc:mga0n895_734_c1 nmdc:mga0n895_734_c1_14891_15346 130
58 3300050513 nmdc:mga0rr50_4968_c1 nmdc:mga0rr50_4968_c1_4248_4703 130
59 3300050514 nmdc:mga08x19_66083_c1 nmdc:mga08x19_66083_c1_377_832 130
60 3300007265 Ga0099794_10244627 Ga0099794_102446272 131
61 3300027671 Ga0209588_1055415 Ga0209588_10554152 131
62 3300039438 Ga0436360_0435182 Ga0436360_0435182_228_677 131
63 3300005440 Ga0070705_100002781 Ga0070705_10000278111 132
64 3300005444 Ga0070694_100081232 Ga0070694_1000812323 132
65 3300005467 Ga0070706_100429431 Ga0070706_1004294311 132
66 3300005518 Ga0070699_100008554 Ga0070699_1000085542 132
67 3300005536 Ga0070697_100001557 Ga0070697_10000155711 132
68 3300005545 Ga0070695_100001505 Ga0070695_1000015055 132
69 3300005546 Ga0070696_100005214 Ga0070696_1000052146 132
70 3300006051 Ga0075364_10012099 Ga0075364_100120994 132
71 3300006871 Ga0075434_100027998 Ga0075434_1000279984 132
72 3300006914 Ga0075436_100034418 Ga0075436_1000344185 132
73 3300025910 Ga0207684_10570821 Ga0207684_105708213 132
74 3300039450 Ga0436363_0210243 Ga0436363_0210243_169_633 132
75 3300044712 Ga0453684_0005767 Ga0453684_0005767_17613_18047 132
76 3300049585 Ga0501069_0265760 Ga0501069_0265760_263_718 132
77 3300049593 Ga0501077_0316384 Ga0501077_0316384_74_538 132
78 3300050491 nmdc:mga00v17_35964_c1 nmdc:mga00v17_35964_c1_2115_2624 132
79 3300050512 nmdc:mga0n895_42017_c1 nmdc:mga0n895_42017_c1_3829_4275 132
80 3300050514 nmdc:mga08x19_84428_c1 nmdc:mga08x19_84428_c1_99_554 132
81 3300005330 Ga0070690_100016772 Ga0070690_1000167724 133
82 3300005535 Ga0070684_100100681 Ga0070684_1001006813 133
83 3300005544 Ga0070686_100004514 Ga0070686_1000045146 133
84 3300005547 Ga0070693_100360433 Ga0070693_1003604331 133
85 3300005615 Ga0070702_100851299 Ga0070702_1008512992 133
86 3300005842 Ga0068858_100561221 Ga0068858_1005612213 133
87 3300006237 Ga0097621_100000756 Ga0097621_10000075617 133
88 3300006358 Ga0068871_100000588 Ga0068871_10000058819 133
89 3300006844 Ga0075428_100257457 Ga0075428_1002574572 133
90 3300009101 Ga0105247_11393726 Ga0105247_113937261 133
91 3300009147 Ga0114129_12491464 Ga0114129_124914641 133
92 3300009177 Ga0105248_10388289 Ga0105248_103882892 133
93 3300025918 Ga0207662_10138015 Ga0207662_101380153 133
94 3300035092 Ga0373952_0022032 Ga0373952_0022032_321_770 133
95 3300035115 Ga0373941_0041270 Ga0373941_0041270_891_1340 133
96 3300035241 Ga0373961_0049213 Ga0373961_0049213_306_755 133
97 3300049578 Ga0501042_0999069 Ga0501042_0999069_16_420 133
98 3300050512 nmdc:mga0n895_166929_c1 nmdc:mga0n895_166929_c1_1697_2146 133
99 3300035724 Ga0373933_0635445 Ga0373933_0635445_138_584 134
100 3300046517 Ga0495630_0143014 Ga0495630_0143014_992_1438 134
101 3300046529 Ga0495652_0044840 Ga0495652_0044840_1361_1807 134
102 3300046663 Ga0495635_0380217 Ga0495635_0380217_467_913 134
103 3300046684 Ga0495669_0250381 Ga0495669_0250381_324_779 134
104 3300054114 Ga0501084_1434633 Ga0501084_1434633_60_512 134
105 3300005345 Ga0070692_10760541 Ga0070692_107605412 135
106 3300006871 Ga0075434_100172686 Ga0075434_1001726862 135
107 3300007076 Ga0075435_100294934 Ga0075435_1002949342 135
108 3300031995 Ga0307409_101501168 Ga0307409_1015011682 135
109 3300032126 Ga0307415_100558325 Ga0307415_1005583252 135
110 3300035088 Ga0373940_0355254 Ga0373940_0355254_51_500 135
111 3300035207 Ga0373942_0076624 Ga0373942_0076624_513_968 135
112 3300045051 Ga0451576_0493615 Ga0451576_0493615_679_1149 135
113 3300050512 nmdc:mga0n895_807251_c1 nmdc:mga0n895_807251_c1_430_867 135
114 3300050513 nmdc:mga0rr50_193612_c1 nmdc:mga0rr50_193612_c1_865_1302 135
115 3300005355 Ga0070671_100229083 Ga0070671_1002290832 136
116 3300009094 Ga0111539_11541672 Ga0111539_115416723 136
117 3300035207 Ga0373942_0248958 Ga0373942_0248958_53_514 136
118 3300044706 Ga0466964_0157565 Ga0466964_0157565_434_892 136
119 3300044719 Ga0466971_0345568 Ga0466971_0345568_193_651 136
120 3300049573 Ga0501037_0194123 Ga0501037_0194123_328_780 136
121 3300049574 Ga0501038_0173450 Ga0501038_0173450_951_1403 136
122 3300049575 Ga0501039_0039139 Ga0501039_0039139_1772_2224 136
123 3300049582 Ga0501048_0304880 Ga0501048_0304880_221_673 136
124 3300049584 Ga0501068_0023674 Ga0501068_0023674_97_549 136
125 3300049587 Ga0501071_0006939 Ga0501071_0006939_5359_5811 136
126 3300049588 Ga0501072_0076655 Ga0501072_0076655_1277_1729 136
127 3300049589 Ga0501073_0223288 Ga0501073_0223288_529_981 136
128 3300049590 Ga0501074_0377690 Ga0501074_0377690_373_825 136
129 3300049591 Ga0501075_0018354 Ga0501075_0018354_1424_1876 136
130 3300049592 Ga0501076_0178619 Ga0501076_0178619_219_671 136
131 3300049741 Ga0501079_0025100 Ga0501079_0025100_2571_3023 136
132 3300049742 Ga0501080_0000502 Ga0501080_0000502_24492_24944 136
133 3300049743 Ga0501081_0018316 Ga0501081_0018316_1900_2352 136
134 3300050511 nmdc:mga08y16_1010092_c1 nmdc:mga08y16_1010092_c1_221_724 136
135 3300054114 Ga0501084_0078625 Ga0501084_0078625_2115_2567 136
136 3300061734 Ga0530510_0457034 Ga0530510_0457034_328_780 136
137 3300005437 Ga0070710_10152857 Ga0070710_101528572 137
138 3300025898 Ga0207692_10006506 Ga0207692_100065066 137
139 3300035117 Ga0373953_0037524 Ga0373953_0037524_365_826 137
140 3300035119 Ga0373956_0076665 Ga0373956_0076665_663_1124 137
141 3300035120 Ga0373957_0077834 Ga0373957_0077834_216_677 137
142 3300035172 Ga0373955_0015830 Ga0373955_0015830_1954_2415 137
143 3300035410 Ga0373924_0015301 Ga0373924_0015301_673_1134 137
144 3300035692 Ga0373935_0195970 Ga0373935_0195970_792_1241 137
145 3300035724 Ga0373933_0006341 Ga0373933_0006341_2367_2828 137
146 3300036401 Ga0373937_0038399 Ga0373937_0038399_1087_1548 137
147 3300037068 Ga0373925_0169885 Ga0373925_0169885_498_929 137
148 3300046543 Ga0495645_0408147 Ga0495645_0408147_303_752 137
149 3300047322 Ga0495680_0104671 Ga0495680_0104671_1107_1568 137
150 3300049520 Ga0501297_018511 Ga0501297_018511_323_790 137
151 3300049572 Ga0501036_0082064 Ga0501036_0082064_408_854 137
152 3300049574 Ga0501038_0150351 Ga0501038_0150351_495_923 137
153 3300049575 Ga0501039_0046020 Ga0501039_0046020_237_683 137
154 3300049577 Ga0501041_0143185 Ga0501041_0143185_391_837 137
155 3300049578 Ga0501042_0282669 Ga0501042_0282669_224_670 137
156 3300049579 Ga0501043_0214531 Ga0501043_0214531_845_1291 137
157 3300049580 Ga0501046_0176322 Ga0501046_0176322_863_1309 137
158 3300049582 Ga0501048_0020297 Ga0501048_0020297_632_1078 137
159 3300049587 Ga0501071_0008794 Ga0501071_0008794_3227_3673 137
160 3300049588 Ga0501072_0058372 Ga0501072_0058372_1651_2097 137
161 3300049589 Ga0501073_0880149 Ga0501073_0880149_84_509 137
162 3300049591 Ga0501075_0002081 Ga0501075_0002081_11643_12089 137
163 3300049592 Ga0501076_0433033 Ga0501076_0433033_415_861 137
164 3300049741 Ga0501079_0321155 Ga0501079_0321155_485_931 137
165 3300049742 Ga0501080_0023192 Ga0501080_0023192_1152_1598 137
166 3300049743 Ga0501081_0235188 Ga0501081_0235188_361_807 137
167 3300049744 Ga0501083_0381419 Ga0501083_0381419_314_760 137
168 3300049824 Ga0501045_0004712 Ga0501045_0004712_2317_2763 137
169 3300054114 Ga0501084_0037733 Ga0501084_0037733_1428_1874 137
170 3300060353 Ga0501082_0082355 Ga0501082_0082355_551_997 137
171 3300061734 Ga0530510_0014387 Ga0530510_0014387_1358_1804 137
172 3300005439 Ga0070711_100325245 Ga0070711_1003252451 139
173 3300006175 Ga0070712_100484186 Ga0070712_1004841862 139
174 3300007076 Ga0075435_100078504 Ga0075435_1000785045 139
175 3300025916 Ga0207663_10352943 Ga0207663_103529432 139
176 3300025928 Ga0207700_10363290 Ga0207700_103632902 139
177 3300032002 Ga0307416_100618117 Ga0307416_1006181173 139
178 3300050513 nmdc:mga0rr50_27655_c1 nmdc:mga0rr50_27655_c1_3152_3607 139
179 3300050514 nmdc:mga08x19_21818_c1 nmdc:mga08x19_21818_c1_2909_3364 139
180 3300005295 Ga0065707_10010183 Ga0065707_100101833 140
181 3300005328 Ga0070676_10166220 Ga0070676_101662203 140
182 3300005328 Ga0070676_10638324 Ga0070676_106383242 140
183 3300005331 Ga0070670_101746788 Ga0070670_1017467882 140
184 3300005333 Ga0070677_10164066 Ga0070677_101640663 140
185 3300005334 Ga0068869_100152276 Ga0068869_1001522765 140
186 3300005336 Ga0070680_100163787 Ga0070680_1001637874 140
187 3300005336 Ga0070680_100468454 Ga0070680_1004684542 140
188 3300005336 Ga0070680_101174924 Ga0070680_1011749241 140
189 3300005338 Ga0068868_101461470 Ga0068868_1014614701 140
190 3300005340 Ga0070689_100076770 Ga0070689_1000767704 140
191 3300005340 Ga0070689_101317879 Ga0070689_1013178791 140
192 3300005345 Ga0070692_10061598 Ga0070692_100615983 140
193 3300005345 Ga0070692_10271833 Ga0070692_102718331 140
194 3300005347 Ga0070668_100043358 Ga0070668_1000433585 140
195 3300005353 Ga0070669_100009032 Ga0070669_1000090328 140
196 3300005354 Ga0070675_100052444 Ga0070675_1000524445 140
197 3300005364 Ga0070673_100638566 Ga0070673_1006385662 140
198 3300005365 Ga0070688_100108394 Ga0070688_1001083941 140
199 3300005440 Ga0070705_101022743 Ga0070705_1010227431 140
200 3300005441 Ga0070700_100165485 Ga0070700_1001654856 140
201 3300005459 Ga0068867_100000755 Ga0068867_10000075518 140
202 3300005466 Ga0070685_10219953 Ga0070685_102199531 140
203 3300005543 Ga0070672_100199866 Ga0070672_1001998666 140
204 3300005577 Ga0068857_102149844 Ga0068857_1021498441 140
205 3300005718 Ga0068866_10044301 Ga0068866_100443015 140
206 3300005719 Ga0068861_100016620 Ga0068861_1000166205 140
207 3300005719 Ga0068861_101306134 Ga0068861_1013061341 140
208 3300005840 Ga0068870_11301106 Ga0068870_113011061 140
209 3300005844 Ga0068862_100247792 Ga0068862_1002477924 140
210 3300005844 Ga0068862_100722720 Ga0068862_1007227203 140
211 3300005985 Ga0081539_10005168 Ga0081539_1000516810 140
212 3300006844 Ga0075428_100116077 Ga0075428_1001160772 140
213 3300006844 Ga0075428_100195195 Ga0075428_1001951952 140
214 3300006844 Ga0075428_100578279 Ga0075428_1005782794 140
215 3300006846 Ga0075430_100120254 Ga0075430_1001202542 140
216 3300006847 Ga0075431_100024403 Ga0075431_1000244033 140
217 3300006880 Ga0075429_100039432 Ga0075429_1000394327 140
218 3300006881 Ga0068865_100028296 Ga0068865_1000282964 140
219 3300006881 Ga0068865_102026390 Ga0068865_1020263901 140
220 3300009094 Ga0111539_10180623 Ga0111539_101806235 140
221 3300009147 Ga0114129_10053431 Ga0114129_100534319 140
222 3300009148 Ga0105243_10035369 Ga0105243_100353694 140
223 3300009553 Ga0105249_10001388 Ga0105249_1000138815 140
224 3300013306 Ga0163162_10270340 Ga0163162_102703402 140
225 3300013308 Ga0157375_10567393 Ga0157375_105673932 140
226 3300014326 Ga0157380_10061130 Ga0157380_100611302 140
227 3300014326 Ga0157380_13441885 Ga0157380_134418851 140
228 3300014745 Ga0157377_10247375 Ga0157377_102473752 140
229 3300025901 Ga0207688_10190654 Ga0207688_101906543 140
230 3300025907 Ga0207645_10253509 Ga0207645_102535093 140
231 3300025907 Ga0207645_10456069 Ga0207645_104560692 140
232 3300025908 Ga0207643_10038216 Ga0207643_100382165 140
233 3300025917 Ga0207660_10004569 Ga0207660_100045695 140
234 3300025917 Ga0207660_10328845 Ga0207660_103288454 140
235 3300025923 Ga0207681_10296737 Ga0207681_102967374 140
236 3300025926 Ga0207659_10030671 Ga0207659_100306714 140
237 3300025935 Ga0207709_10002601 Ga0207709_100026014 140
238 3300025936 Ga0207670_10497576 Ga0207670_104975762 140
239 3300025937 Ga0207669_10025345 Ga0207669_100253453 140
240 3300025938 Ga0207704_10252977 Ga0207704_102529772 140
241 3300025940 Ga0207691_10027511 Ga0207691_100275115 140
242 3300025942 Ga0207689_10028985 Ga0207689_100289855 140
243 3300025942 Ga0207689_10970247 Ga0207689_109702472 140
244 3300025961 Ga0207712_10001259 Ga0207712_100012593 140
245 3300026075 Ga0207708_10093936 Ga0207708_100939365 140
246 3300026089 Ga0207648_10086304 Ga0207648_100863045 140
247 3300026116 Ga0207674_10635153 Ga0207674_106351531 140
248 3300026118 Ga0207675_100000812 Ga0207675_10000081214 140
249 3300027907 Ga0207428_10148564 Ga0207428_101485642 140
250 3300028380 Ga0268265_10031660 Ga0268265_100316605 140
251 3300028380 Ga0268265_11619770 Ga0268265_116197702 140
252 3300031344 Ga0265316_10374881 Ga0265316_103748811 140
253 3300031911 Ga0307412_10811776 Ga0307412_108117763 140
254 3300032002 Ga0307416_100124639 Ga0307416_1001246394 140
255 3300032005 Ga0307411_10818454 Ga0307411_108184542 140
256 3300032126 Ga0307415_100965244 Ga0307415_1009652442 140
257 3300041496 Ga0451839_0760959 Ga0451839_0760959_288_749 140
258 3300042439 Ga0439464_0128884 Ga0439464_0128884_161_613 140
259 3300046537 Ga0495598_0243269 Ga0495598_0243269_160_612 140
260 3300047445 Ga0495677_0174578 Ga0495677_0174578_279_731 140
261 3300049683 Ga0501253_216035 Ga0501253_216035_12_464 140
262 3300050507 nmdc:mga05p37_45015_c1 nmdc:mga05p37_45015_c1_1723_2196 140
263 3300050508 nmdc:mga09592_304370_c1 nmdc:mga09592_304370_c1_153_626 140
264 3300050509 nmdc:mga0qj67_307700_c1 nmdc:mga0qj67_307700_c1_616_1065 140
265 3300050511 nmdc:mga08y16_198287_c1 nmdc:mga08y16_198287_c1_993_1442 140
266 3300050511 nmdc:mga08y16_686592_c1 nmdc:mga08y16_686592_c1_156_605 140
267 3300005330 Ga0070690_100259709 Ga0070690_1002597091 141
268 3300005544 Ga0070686_101331524 Ga0070686_1013315241 141
269 3300009094 Ga0111539_10448554 Ga0111539_104485543 141
270 3300009098 Ga0105245_11129038 Ga0105245_111290382 141
271 3300025917 Ga0207660_10318649 Ga0207660_103186492 141
272 3300035092 Ga0373952_0001581 Ga0373952_0001581_3493_3945 141
273 3300035114 Ga0373939_0255362 Ga0373939_0255362_142_594 141
274 3300035115 Ga0373941_0024345 Ga0373941_0024345_1127_1579 141
275 3300044683 Ga0466965_0443298 Ga0466965_0443298_164_616 141
276 3300044901 Ga0466960_0203021 Ga0466960_0203021_293_745 141
277 3300049582 Ga0501048_0415730 Ga0501048_0415730_386_835 141
278 3300050511 nmdc:mga08y16_721077_c1 nmdc:mga08y16_721077_c1_481_963 141
279 3300005458 Ga0070681_10000081 Ga0070681_1000008139 142
280 3300006914 Ga0075436_100060029 Ga0075436_1000600295 142
281 3300007265 Ga0099794_10305082 Ga0099794_103050822 142
282 3300025912 Ga0207707_10002239 Ga0207707_100022395 142
283 3300031824 Ga0307413_10565819 Ga0307413_105658192 142
284 3300032002 Ga0307416_101135522 Ga0307416_1011355222 142
285 3300049589 Ga0501073_0360847 Ga0501073_0360847_379_867 142
286 3300049590 Ga0501074_0244649 Ga0501074_0244649_650_1138 142
287 3300049742 Ga0501080_0644027 Ga0501080_0644027_206_694 142
288 3300049850 Ga0501204_088375 Ga0501204_088375_14_466 142
289 3300050510 nmdc:mga06r32_1321144_c1 nmdc:mga06r32_1321144_c1_53_502 142
290 3300050514 nmdc:mga08x19_66559_c1 nmdc:mga08x19_66559_c1_1549_2007 142
291 3300054114 Ga0501084_0623812 Ga0501084_0623812_402_890 142
292 3300005353 Ga0070669_100932223 Ga0070669_1009322231 143
293 3300005544 Ga0070686_100189360 Ga0070686_1001893602 143
294 3300006846 Ga0075430_100149148 Ga0075430_1001491482 143
295 3300006847 Ga0075431_100481072 Ga0075431_1004810722 143
296 3300009098 Ga0105245_11328017 Ga0105245_113280172 143
297 3300025918 Ga0207662_10188327 Ga0207662_101883273 143
298 3300027364 Ga0209967_1003247 Ga0209967_10032473 143
299 3300031548 Ga0307408_100614634 Ga0307408_1006146342 143
300 3300032002 Ga0307416_100994916 Ga0307416_1009949162 143
301 3300035112 Ga0373932_0125834 Ga0373932_0125834_187_636 143
302 3300042437 Ga0439444_0004549 Ga0439444_0004549_37_489 143
303 3300049514 Ga0501291_004472 Ga0501291_004472_603_1055 143
304 3300049582 Ga0501048_0941674 Ga0501048_0941674_72_524 143
305 3300049592 Ga0501076_0922662 Ga0501076_0922662_141_593 143
306 3300049686 Ga0501257_123734 Ga0501257_123734_176_628 143
307 3300049568 Ga0501031_0275344 Ga0501031_0275344_477_932 144
308 3300049569 Ga0501032_0255336 Ga0501032_0255336_198_653 144
309 3300049571 Ga0501034_0946447 Ga0501034_0946447_253_708 144
310 3300049572 Ga0501036_0013192 Ga0501036_0013192_5502_5957 144
311 3300049573 Ga0501037_0161709 Ga0501037_0161709_606_1061 144
312 3300049574 Ga0501038_0007492 Ga0501038_0007492_8402_8857 144
313 3300049575 Ga0501039_0106931 Ga0501039_0106931_922_1377 144
314 3300049576 Ga0501040_0030621 Ga0501040_0030621_528_983 144
315 3300049577 Ga0501041_0002591 Ga0501041_0002591_2534_2989 144
316 3300049578 Ga0501042_0199581 Ga0501042_0199581_510_965 144
317 3300049579 Ga0501043_0728548 Ga0501043_0728548_103_558 144
318 3300049580 Ga0501046_0111666 Ga0501046_0111666_150_605 144
319 3300049582 Ga0501048_0047309 Ga0501048_0047309_2197_2652 144
320 3300049588 Ga0501072_0266316 Ga0501072_0266316_304_759 144
321 3300049589 Ga0501073_0609725 Ga0501073_0609725_14_469 144
322 3300049592 Ga0501076_0004745 Ga0501076_0004745_320_775 144
323 3300049593 Ga0501077_0039802 Ga0501077_0039802_304_759 144
324 3300049741 Ga0501079_0350600 Ga0501079_0350600_105_560 144
325 3300049742 Ga0501080_0115785 Ga0501080_0115785_299_754 144
326 3300049743 Ga0501081_0021954 Ga0501081_0021954_2888_3343 144
327 3300049744 Ga0501083_0225342 Ga0501083_0225342_679_1134 144
328 3300049822 Ga0501035_0407409 Ga0501035_0407409_37_492 144
329 3300049824 Ga0501045_0028922 Ga0501045_0028922_150_605 144
330 3300050509 nmdc:mga0qj67_79719_c1 nmdc:mga0qj67_79719_c1_1804_2256 144
331 3300050510 nmdc:mga06r32_1020465_c1 nmdc:mga06r32_1020465_c1_131_583 144
332 3300050513 nmdc:mga0rr50_91960_c1 nmdc:mga0rr50_91960_c1_925_1389 144
333 3300054114 Ga0501084_0033552 Ga0501084_0033552_2879_3334 144
334 3300060353 Ga0501082_0048685 Ga0501082_0048685_298_753 144
335 3300061734 Ga0530510_0418221 Ga0530510_0418221_147_602 144
336 3300005518 Ga0070699_100080666 Ga0070699_1000806663 145
337 3300006914 Ga0075436_100125923 Ga0075436_1001259232 145
338 3300013105 Ga0157369_10731336 Ga0157369_107313362 145
339 3300050514 nmdc:mga08x19_113031_c1 nmdc:mga08x19_113031_c1_449_901 145
340 3300005545 Ga0070695_100897377 Ga0070695_1008973772 146
341 3300005546 Ga0070696_100133174 Ga0070696_1001331744 146
342 3300005364 Ga0070673_100831722 Ga0070673_1008317222 147
343 3300005438 Ga0070701_10871295 Ga0070701_108712951 147
344 3300006871 Ga0075434_100460018 Ga0075434_1004600183 147
345 3300007265 Ga0099794_10190473 Ga0099794_101904732 147
346 3300009094 Ga0111539_10286237 Ga0111539_102862373 147
347 3300025960 Ga0207651_10563432 Ga0207651_105634322 147
348 3300027671 Ga0209588_1032497 Ga0209588_10324973 147
349 3300027907 Ga0207428_10260527 Ga0207428_102605272 147
350 3300041486 Ga0451807_1150880 Ga0451807_1150880_84_530 147
351 3300041496 Ga0451839_0404989 Ga0451839_0404989_312_758 147
352 3300045051 Ga0451576_0425970 Ga0451576_0425970_726_1172 147
353 3300046454 Ga0495592_0283137 Ga0495592_0283137_166_624 147
354 3300046459 Ga0495629_0227091 Ga0495629_0227091_329_775 147
355 3300046476 Ga0495662_0013878 Ga0495662_0013878_2172_2618 147
356 3300046514 Ga0495618_0441998 Ga0495618_0441998_94_540 147
357 3300046517 Ga0495630_0259875 Ga0495630_0259875_299_745 147
358 3300046533 Ga0495640_0231639 Ga0495640_0231639_147_593 147
359 3300046663 Ga0495635_0025694 Ga0495635_0025694_399_845 147
360 3300046690 Ga0495624_0182826 Ga0495624_0182826_333_779 147
361 3300047315 Ga0495581_0100413 Ga0495581_0100413_534_980 147
362 3300049568 Ga0501031_0727779 Ga0501031_0727779_80_571 147
363 3300050508 nmdc:mga09592_82027_c1 nmdc:mga09592_82027_c1_2128_2574 147
364 3300050511 nmdc:mga08y16_115995_c1 nmdc:mga08y16_115995_c1_1579_2025 147
365 3300050512 nmdc:mga0n895_1165355_c1 nmdc:mga0n895_1165355_c1_169_615 147
366 3300050513 nmdc:mga0rr50_316265_c1 nmdc:mga0rr50_316265_c1_618_1064 147
367 3300006358 Ga0068871_100411112 Ga0068871_1004111124 148
368 3300032002 Ga0307416_102252803 Ga0307416_1022528031 148
369 3300032005 Ga0307411_10118852 Ga0307411_101188523 148
370 3300032126 Ga0307415_101285716 Ga0307415_1012857162 148
371 3300042435 Ga0439434_0046342 Ga0439434_0046342_648_1097 148
372 3300046455 Ga0495603_0165540 Ga0495603_0165540_108_557 148
373 3300050508 nmdc:mga09592_542054_c1 nmdc:mga09592_542054_c1_175_624 148
374 3300006847 Ga0075431_100353244 Ga0075431_1003532441 149
375 3300031548 Ga0307408_100567135 Ga0307408_1005671352 149
376 3300031911 Ga0307412_10451548 Ga0307412_104515483 149
377 3300032002 Ga0307416_100056591 Ga0307416_1000565913 149
378 3300041505 Ga0451849_1032019 Ga0451849_1032019_95_547 149
379 3300049576 Ga0501040_0725776 Ga0501040_0725776_94_546 149
380 3300049578 Ga0501042_0354323 Ga0501042_0354323_139_591 149
381 3300049578 Ga0501042_0509277 Ga0501042_0509277_348_800 149
382 3300050510 nmdc:mga06r32_822135_c1 nmdc:mga06r32_822135_c1_355_807 149
383 3300035086 Ga0373934_0043110 Ga0373934_0043110_388_843 150
384 3300035117 Ga0373953_0118763 Ga0373953_0118763_111_566 150
385 3300035118 Ga0373954_0001511 Ga0373954_0001511_153_608 150
386 3300035724 Ga0373933_0028698 Ga0373933_0028698_228_683 150
387 3300036401 Ga0373937_0047453 Ga0373937_0047453_3239_3694 150
388 3300046511 Ga0495608_0547506 Ga0495608_0547506_45_500 150
389 3300046675 Ga0495657_0117720 Ga0495657_0117720_889_1344 150
390 3300047317 Ga0495604_0133473 Ga0495604_0133473_1216_1671 150
391 3300005336 Ga0070680_100669191 Ga0070680_1006691912 151
392 3300005434 Ga0070709_11251110 Ga0070709_112511101 151
393 3300005435 Ga0070714_100040727 Ga0070714_1000407275 151
394 3300005440 Ga0070705_100647351 Ga0070705_1006473513 151
395 3300005440 Ga0070705_100856111 Ga0070705_1008561112 151
396 3300005444 Ga0070694_100242314 Ga0070694_1002423142 151
397 3300005545 Ga0070695_100125662 Ga0070695_1001256624 151
398 3300005547 Ga0070693_100292019 Ga0070693_1002920192 151
399 3300006173 Ga0070716_100337509 Ga0070716_1003375091 151
400 3300006852 Ga0075433_10680256 Ga0075433_106802562 151
401 3300006914 Ga0075436_100000529 Ga0075436_10000052924 151
402 3300006914 Ga0075436_100094639 Ga0075436_1000946394 151
403 3300007076 Ga0075435_100199926 Ga0075435_1001999261 151
404 3300007788 Ga0099795_10026232 Ga0099795_100262324 151
405 3300009148 Ga0105243_11684111 Ga0105243_116841112 151
406 3300025916 Ga0207663_11117569 Ga0207663_111175691 151
407 3300025917 Ga0207660_10245533 Ga0207660_102455332 151
408 3300025918 Ga0207662_10269198 Ga0207662_102691982 151
409 3300025918 Ga0207662_10626435 Ga0207662_106264352 151
410 3300025929 Ga0207664_10171573 Ga0207664_101715733 151
411 3300027378 Ga0209981_1000782 Ga0209981_10007823 151
412 3300027462 Ga0210000_1002477 Ga0210000_10024774 151
413 3300035692 Ga0373935_0766290 Ga0373935_0766290_151_609 151
414 3300035695 Ga0373927_0647041 Ga0373927_0647041_57_515 151
415 3300037068 Ga0373925_0504189 Ga0373925_0504189_340_798 151
416 3300039450 Ga0436363_0132198 Ga0436363_0132198_64_522 151
417 3300041997 Ga0439431_0044157 Ga0439431_0044157_550_1014 151
418 3300042156 Ga0439446_0086173 Ga0439446_0086173_144_608 151
419 3300042435 Ga0439434_0047796 Ga0439434_0047796_502_966 151
420 3300042436 Ga0439435_0009935 Ga0439435_0009935_1742_2206 151
421 3300045051 Ga0451576_0330463 Ga0451576_0330463_722_1177 151
422 3300046684 Ga0495669_0010927 Ga0495669_0010927_766_1224 151
423 3300049572 Ga0501036_0353614 Ga0501036_0353614_49_507 151
424 3300049574 Ga0501038_1327321 Ga0501038_1327321_49_507 151
425 3300049576 Ga0501040_0205115 Ga0501040_0205115_616_1074 151
426 3300049577 Ga0501041_0269754 Ga0501041_0269754_376_834 151
427 3300049582 Ga0501048_0603102 Ga0501048_0603102_170_628 151
428 3300049587 Ga0501071_0164986 Ga0501071_0164986_153_611 151
429 3300049588 Ga0501072_1310184 Ga0501072_1310184_82_540 151
430 3300049590 Ga0501074_0050093 Ga0501074_0050093_2401_2865 151
431 3300049591 Ga0501075_0772674 Ga0501075_0772674_158_628 151
432 3300049741 Ga0501079_0193061 Ga0501079_0193061_519_977 151
433 3300049743 Ga0501081_0395352 Ga0501081_0395352_530_988 151
434 3300049824 Ga0501045_0035938 Ga0501045_0035938_969_1427 151
435 3300050512 nmdc:mga0n895_81695_c1 nmdc:mga0n895_81695_c1_1395_1853 151
436 3300050513 nmdc:mga0rr50_228516_c1 nmdc:mga0rr50_228516_c1_470_928 151
437 3300050514 nmdc:mga08x19_258_c1 nmdc:mga08x19_258_c1_23241_23696 151
438 3300050514 nmdc:mga08x19_381080_c1 nmdc:mga08x19_381080_c1_211_669 151
439 3300050515 nmdc:mga0a205_44949_c1 nmdc:mga0a205_44949_c1_155_613 151
440 3300050515 nmdc:mga0a205_545975_c1 nmdc:mga0a205_545975_c1_482_946 151
441 3300054114 Ga0501084_0123263 Ga0501084_0123263_213_671 151
442 3300059421 Ga0590071_063953 Ga0590071_063953_67_525 151
443 3300060353 Ga0501082_0324336 Ga0501082_0324336_164_622 151
444 3300039437 Ga0436365_1860246 Ga0436365_1860246_128_601 152
445 3300005536 Ga0070697_100000299 Ga0070697_1000002994 153
446 3300025939 Ga0207665_10895233 Ga0207665_108952333 153
447 3300031911 Ga0307412_10036695 Ga0307412_100366952 156
448 3300032002 Ga0307416_100480552 Ga0307416_1004805522 156
449 3300032005 Ga0307411_10487864 Ga0307411_104878641 156
450 3300000652 ARCol0yngRDRAFT_1004317 ARCol0yngRDRAFT_10043173 157
451 3300005295 Ga0065707_10217684 Ga0065707_102176843 157
452 3300005330 Ga0070690_100154001 Ga0070690_1001540014 157
453 3300005334 Ga0068869_100000139 Ga0068869_1000001394 157
454 3300005336 Ga0070680_100000688 Ga0070680_10000068824 157
455 3300005337 Ga0070682_100393712 Ga0070682_1003937122 157
456 3300005338 Ga0068868_100000115 Ga0068868_10000011520 157
457 3300005340 Ga0070689_100049842 Ga0070689_1000498426 157
458 3300005343 Ga0070687_100000091 Ga0070687_1000000915 157
459 3300005345 Ga0070692_10000335 Ga0070692_1000033512 157
460 3300005353 Ga0070669_100409604 Ga0070669_1004096042 157
461 3300005354 Ga0070675_100646824 Ga0070675_1006468242 157
462 3300005355 Ga0070671_100511204 Ga0070671_1005112041 157
463 3300005406 Ga0070703_10113264 Ga0070703_101132642 157
464 3300005438 Ga0070701_10002057 Ga0070701_100020572 157
465 3300005439 Ga0070711_100498237 Ga0070711_1004982371 157
466 3300005439 Ga0070711_101445914 Ga0070711_1014459141 157
467 3300005440 Ga0070705_100001761 Ga0070705_10000176113 157
468 3300005441 Ga0070700_100008537 Ga0070700_1000085376 157
469 3300005444 Ga0070694_100000133 Ga0070694_1000001334 157
470 3300005444 Ga0070694_101051162 Ga0070694_1010511621 157
471 3300005445 Ga0070708_100139710 Ga0070708_1001397106 157
472 3300005458 Ga0070681_10277248 Ga0070681_102772485 157
473 3300005459 Ga0068867_100000084 Ga0068867_10000008433 157
474 3300005518 Ga0070699_100356165 Ga0070699_1003561655 157
475 3300005530 Ga0070679_100003611 Ga0070679_10000361116 157
476 3300005539 Ga0068853_100199450 Ga0068853_1001994505 157
477 3300005543 Ga0070672_100320379 Ga0070672_1003203794 157
478 3300005544 Ga0070686_100000193 Ga0070686_10000019332 157
479 3300005545 Ga0070695_100000303 Ga0070695_10000030326 157
480 3300005546 Ga0070696_100000284 Ga0070696_10000028433 157
481 3300005547 Ga0070693_100000111 Ga0070693_1000001114 157
482 3300005549 Ga0070704_100000008 Ga0070704_10000000822 157
483 3300005563 Ga0068855_100000242 Ga0068855_10000024241 157
484 3300005564 Ga0070664_101542457 Ga0070664_1015424572 157
485 3300005577 Ga0068857_100870631 Ga0068857_1008706313 157
486 3300005578 Ga0068854_100045331 Ga0068854_1000453316 157
487 3300005614 Ga0068856_100010173 Ga0068856_1000101732 157
488 3300005615 Ga0070702_100000012 Ga0070702_10000001258 157
489 3300005616 Ga0068852_100176407 Ga0068852_1001764075 157
490 3300005617 Ga0068859_100005212 Ga0068859_1000052124 157
491 3300005618 Ga0068864_100412279 Ga0068864_1004122794 157
492 3300005718 Ga0068866_10000109 Ga0068866_1000010933 157
493 3300005719 Ga0068861_100140675 Ga0068861_1001406754 157
494 3300005841 Ga0068863_100583404 Ga0068863_1005834042 157
495 3300005842 Ga0068858_100287149 Ga0068858_1002871494 157
496 3300005843 Ga0068860_100005589 Ga0068860_1000055894 157
497 3300005844 Ga0068862_100002876 Ga0068862_10000287619 157
498 3300006163 Ga0070715_10147971 Ga0070715_101479712 157
499 3300006175 Ga0070712_100220327 Ga0070712_1002203272 157
500 3300006237 Ga0097621_100040927 Ga0097621_1000409274 157
501 3300006358 Ga0068871_100000559 Ga0068871_10000055926 157
502 3300006844 Ga0075428_100000183 Ga0075428_10000018317 157
503 3300006847 Ga0075431_100359887 Ga0075431_1003598873 157
504 3300006852 Ga0075433_10000480 Ga0075433_1000048018 157
505 3300006852 Ga0075433_10456184 Ga0075433_104561842 157
506 3300006871 Ga0075434_100001287 Ga0075434_1000012874 157
507 3300006871 Ga0075434_100897053 Ga0075434_1008970532 157
508 3300006880 Ga0075429_100000891 Ga0075429_10000089129 157
509 3300006881 Ga0068865_100001481 Ga0068865_1000014819 157
510 3300006914 Ga0075436_100005350 Ga0075436_1000053506 157
511 3300006931 Ga0097620_100005212 Ga0097620_10000521218 157
512 3300009094 Ga0111539_10059022 Ga0111539_100590224 157
513 3300009094 Ga0111539_10512605 Ga0111539_105126053 157
514 3300009098 Ga0105245_10000245 Ga0105245_1000024537 157
515 3300009147 Ga0114129_10000219 Ga0114129_1000021948 157
516 3300009148 Ga0105243_10000279 Ga0105243_1000027943 157
517 3300009174 Ga0105241_10029972 Ga0105241_100299726 157
518 3300009176 Ga0105242_10000480 Ga0105242_1000048035 157
519 3300009177 Ga0105248_10139905 Ga0105248_101399056 157
520 3300009545 Ga0105237_11258178 Ga0105237_112581782 157
521 3300009553 Ga0105249_10003616 Ga0105249_100036162 157
522 3300010375 Ga0105239_10284425 Ga0105239_102844255 157
523 3300012498 Ga0157345_1010036 Ga0157345_10100363 157
524 3300013297 Ga0157378_10000294 Ga0157378_1000029435 157
525 3300013306 Ga0163162_10218721 Ga0163162_102187213 157
526 3300025885 Ga0207653_10011595 Ga0207653_100115953 157
527 3300025899 Ga0207642_10000913 Ga0207642_100009138 157
528 3300025901 Ga0207688_10020516 Ga0207688_100205164 157
529 3300025904 Ga0207647_10037052 Ga0207647_100370523 157
530 3300025905 Ga0207685_10114128 Ga0207685_101141282 157
531 3300025908 Ga0207643_10134949 Ga0207643_101349494 157
532 3300025911 Ga0207654_10010311 Ga0207654_100103116 157
533 3300025912 Ga0207707_10205636 Ga0207707_102056362 157
534 3300025918 Ga0207662_10000285 Ga0207662_1000028521 157
535 3300025921 Ga0207652_10029970 Ga0207652_100299706 157
536 3300025927 Ga0207687_10001352 Ga0207687_1000135218 157
537 3300025933 Ga0207706_10435461 Ga0207706_104354614 157
538 3300025934 Ga0207686_10001979 Ga0207686_1000197913 157
539 3300025935 Ga0207709_10000549 Ga0207709_1000054913 157
540 3300025936 Ga0207670_10003216 Ga0207670_100032168 157
541 3300025938 Ga0207704_10007942 Ga0207704_100079425 157
542 3300025939 Ga0207665_10501953 Ga0207665_105019531 157
543 3300025940 Ga0207691_10144443 Ga0207691_101444433 157
544 3300025941 Ga0207711_10220115 Ga0207711_102201155 157
545 3300025942 Ga0207689_10000293 Ga0207689_1000029339 157
546 3300025949 Ga0207667_10002578 Ga0207667_1000257822 157
547 3300025961 Ga0207712_10000959 Ga0207712_1000095923 157
548 3300025981 Ga0207640_10003141 Ga0207640_100031416 157
549 3300025986 Ga0207658_10906090 Ga0207658_109060902 157
550 3300026023 Ga0207677_10000669 Ga0207677_100006694 157
551 3300026035 Ga0207703_10048738 Ga0207703_100487384 157
552 3300026041 Ga0207639_10050576 Ga0207639_100505764 157
553 3300026075 Ga0207708_10019059 Ga0207708_100190596 157
554 3300026078 Ga0207702_10006239 Ga0207702_1000623913 157
555 3300026089 Ga0207648_10000185 Ga0207648_1000018540 157
556 3300026118 Ga0207675_100000150 Ga0207675_10000015036 157
557 3300026142 Ga0207698_10167404 Ga0207698_101674042 157
558 3300027907 Ga0207428_10000290 Ga0207428_1000029028 157
559 3300028380 Ga0268265_10001010 Ga0268265_1000101032 157
560 3300028381 Ga0268264_10000580 Ga0268264_1000058017 157
561 3300034816 Ga0373930_0005659 Ga0373930_0005659_1293_1766 157
562 3300034818 Ga0373950_0060394 Ga0373950_0060394_261_734 157
563 3300034819 Ga0373958_0064377 Ga0373958_0064377_206_679 157
564 3300034957 Ga0373938_0064950 Ga0373938_0064950_207_683 157
565 3300035083 Ga0373926_0003468 Ga0373926_0003468_2312_2797 157
566 3300035084 Ga0373928_0162206 Ga0373928_0162206_127_600 157
567 3300035085 Ga0373929_0034185 Ga0373929_0034185_286_759 157
568 3300035089 Ga0373944_0051715 Ga0373944_0051715_177_662 157
569 3300035090 Ga0373949_0042848 Ga0373949_0042848_183_656 157
570 3300035092 Ga0373952_0019919 Ga0373952_0019919_185_658 157
571 3300035092 Ga0373952_0024547 Ga0373952_0024547_155_628 157
572 3300035112 Ga0373932_0005643 Ga0373932_0005643_1057_1530 157
573 3300035112 Ga0373932_0144706 Ga0373932_0144706_141_614 157
574 3300035113 Ga0373936_0006530 Ga0373936_0006530_434_919 157
575 3300035114 Ga0373939_0054963 Ga0373939_0054963_182_655 157
576 3300035115 Ga0373941_0023589 Ga0373941_0023589_1091_1564 157
577 3300035116 Ga0373945_0001983 Ga0373945_0001983_2730_3215 157
578 3300035242 Ga0373962_0006941 Ga0373962_0006941_425_898 157
579 3300035691 Ga0373931_0001802 Ga0373931_0001802_2619_3092 157
580 3300035691 Ga0373931_0037732 Ga0373931_0037732_1600_2073 157
581 3300035692 Ga0373935_0363644 Ga0373935_0363644_89_574 157
582 3300035695 Ga0373927_0084775 Ga0373927_0084775_103_588 157
583 3300035725 Ga0373947_0097992 Ga0373947_0097992_218_703 157
584 3300037068 Ga0373925_0029441 Ga0373925_0029441_2164_2649 157
585 3300042876 Ga0451577_0104973 Ga0451577_0104973_1972_2445 157
586 3300045051 Ga0451576_0001107 Ga0451576_0001107_28448_28921 157
587 3300045051 Ga0451576_0053818 Ga0451576_0053818_1734_2207 157
588 3300046455 Ga0495603_0023231 Ga0495603_0023231_2416_2901 157
589 3300046472 Ga0495580_0005567 Ga0495580_0005567_6519_7004 157
590 3300046473 Ga0495582_0073235 Ga0495582_0073235_1263_1748 157
591 3300046475 Ga0495639_0035947 Ga0495639_0035947_1575_2060 157
592 3300046517 Ga0495630_0078786 Ga0495630_0078786_1922_2407 157
593 3300046526 Ga0495666_0034170 Ga0495666_0034170_374_859 157
594 3300046531 Ga0495665_0093296 Ga0495665_0093296_316_801 157
595 3300046664 Ga0495659_0013310 Ga0495659_0013310_1928_2413 157
596 3300046681 Ga0495647_0000304 Ga0495647_0000304_11698_12183 157
597 3300046683 Ga0495658_0014094 Ga0495658_0014094_1699_2184 157
598 3300046690 Ga0495624_0262093 Ga0495624_0262093_445_930 157
599 3300046691 Ga0495670_0368472 Ga0495670_0368472_140_613 157
600 3300047315 Ga0495581_0245736 Ga0495581_0245736_407_892 157
601 3300047318 Ga0495636_0250262 Ga0495636_0250262_87_572 157
602 3300047321 Ga0495676_0036800 Ga0495676_0036800_1665_2150 157
603 3300048912 Ga0496109_0707805 Ga0496109_0707805_178_654 157
604 3300049568 Ga0501031_0175943 Ga0501031_0175943_739_1212 157
605 3300049582 Ga0501048_0678153 Ga0501048_0678153_208_681 157
606 3300049587 Ga0501071_0350970 Ga0501071_0350970_198_671 157
607 3300049822 Ga0501035_1389779 Ga0501035_1389779_37_510 157
608 3300050507 nmdc:mga05p37_389_c1 nmdc:mga05p37_389_c1_32752_33225 157
609 3300050508 nmdc:mga09592_34542_c1 nmdc:mga09592_34542_c1_1479_1952 157
610 3300050510 nmdc:mga06r32_1092963_c1 nmdc:mga06r32_1092963_c1_154_627 157
611 3300050511 nmdc:mga08y16_5420_c1 nmdc:mga08y16_5420_c1_11901_12374 157
612 3300050512 nmdc:mga0n895_1129388_c1 nmdc:mga0n895_1129388_c1_97_570 157
613 3300050512 nmdc:mga0n895_189176_c1 nmdc:mga0n895_189176_c1_179_655 157
614 3300050513 nmdc:mga0rr50_7917_c1 nmdc:mga0rr50_7917_c1_4278_4754 157
615 3300050514 nmdc:mga08x19_23320_c1 nmdc:mga08x19_23320_c1_1062_1538 157
616 3300050515 nmdc:mga0a205_137_c1 nmdc:mga0a205_137_c1_5136_5612 157
617 3300050515 nmdc:mga0a205_377092_c1 nmdc:mga0a205_377092_c1_469_942 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04386

SspB

Stringent starvation protein B

9

161

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1twb-assembly1.cif.gz_A sspb disulfide crosslinked to an ssra degradation tag 0.978 5 101
1zsz-assembly2.cif.gz_B crystal structure of a computationally designed sspb heterodimer 0.9775 5 101
1ou9-assembly2.cif.gz_B structure of sspb, a aaa+ protease delivery protein 0.9735 2 101
1ou9-assembly1.cif.gz_A structure of sspb, a aaa+ protease delivery protein 0.9735 1 101
1ox8-assembly1.cif.gz_B crystal structure of sspb 0.9628 4 101
ID Description Score Start End Superfamily
1ox9G00 Mainly Beta;Roll;SH3 type barrels.;SspB-like 0.966 1 101 2.30.30.220
1ox9G00 Mainly Beta;Roll;SH3 type barrels.;SspB-like 0.8967 1 101 2.30.30.220
1oulA00 Mainly Beta;Roll;SH3 type barrels.;SspB-like 0.8417 1 117 2.30.30.220
af_Q9VAW6_82_298_3.40.309.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.8313 58 83 3.40.309.10
1oulA00 Mainly Beta;Roll;SH3 type barrels.;SspB-like 0.8144 1 117 2.30.30.220
ID Description Score Start End GO Terms
AF-A0A7X6WQR2-F1-model_v4 deleted 0.9922 3 91
AF-A0A661EAW1-F1-model_v4 ClpXP protease specificity-enhancing factor 0.9896 5 101 GO:0005829
GO:0005840
GO:0006508
GO:0008233
GO:0045732
AF-A0A521VCC0-F1-model_v4 ClpXP protease specificity-enhancing factor 0.988 1 77 GO:0005829
GO:0005840
GO:0045732
AF-A0A4Q4AZW0-F1-model_v4 deleted 0.9878 1 86
AF-A0A090REW0-F1-model_v4 deleted 0.9857 2 86

Feature Viewer

pLDDT pTM Quality
77.94 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map