F469648

General Info

Members Datasets Scaffolds Average Seq Length
617 289 1234 244

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10001462|Ga0265338_1000146219
Length 255
Sequence MAADGRRAAQAASFGAAAATYQRGRPTYPPEAIDWLLPPGARRVLDLGAGTGKLTSLLHGRGLDVVAVEPSGGMRAQLALCVPDVPVFAGTAEEIPLEDGSVDVVLAAQAWHWVDPRRAVPEVARVLAAAGQLGLVWNIRDEREEWVAELGRIIHGDHNEDLINSAPAVGPPFGPVDRLDVEWRNRITPGTLIDLAASRSYIITMQAGERAAVLAAVRRLLDTHPALAGRAEIDLPYVTRCSRTFLAGAGPVSAG

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
167 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
175 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
176 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
177 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
178 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
179 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
234 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
262 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
263 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
264 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
269 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
270 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
273 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
274 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
277 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
278 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
279 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
280 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
281 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
282 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
283 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
284 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
285 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
286 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
287 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
288 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
289 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.22
Metatranscriptomes 0
Isolates 1.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.99
Nodule 0.16
Rhizoplane 11.18
Rhizosphere 67.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10001462 3300028800 Bacteria 38277
2 JGI24746J21847_1005233 3300001977 Bacteria 2029
3 JGI24735J21928_10064706 3300002067 Bacteria 1050
4 JGI24738J21930_10012129 3300002075 Bacteria 1885
5 JGI24744J21845_10000374 3300002077 Bacteria 7622
6 JGI24742J22300_10004926 3300002244 Bacteria 2191
7 rootH2_10063788 3300003320 Bacteria 3048
8 Ga0055540_1001925 3300003792 Bacteria 11596
9 Ga0055540_1002814 3300003792 Bacteria 8899
10 Ga0070676_10009047 3300005328 Bacteria 5389
11 Ga0070676_10129504 3300005328 Bacteria 1594
12 Ga0070690_100314464 3300005330 Bacteria 1127
13 Ga0068869_100008020 3300005334 Bacteria 6783
14 Ga0068869_100024055 3300005334 Bacteria 4216
15 Ga0070666_10007242 3300005335 Bacteria 6839
16 Ga0070682_100049720 3300005337 Bacteria 2615
17 Ga0070682_100060473 3300005337 Bacteria 2396
18 Ga0068868_100001422 3300005338 Bacteria 16496
19 Ga0068868_100400157 3300005338 Bacteria 1185
20 Ga0070689_100036512 3300005340 Bacteria 3759
21 Ga0070689_100214222 3300005340 Bacteria 1577
22 Ga0070691_10005914 3300005341 Bacteria 5580
23 Ga0070691_10068704 3300005341 Bacteria 1716
24 Ga0070687_100370406 3300005343 Bacteria 930
25 Ga0070668_100002923 3300005347 Bacteria 12626
26 Ga0070668_100097242 3300005347 Bacteria 2328
27 Ga0070669_100001172 3300005353 Bacteria 19133
28 Ga0070669_100172629 3300005353 Bacteria 1687
29 Ga0070675_100598447 3300005354 Bacteria 1000
30 Ga0070675_100805178 3300005354 Bacteria 859
31 Ga0070671_100041760 3300005355 Bacteria 3811
32 Ga0070671_100053670 3300005355 Bacteria 3351
33 Ga0070671_100618930 3300005355 Bacteria 936
34 Ga0070674_100000217 3300005356 Bacteria 27850
35 Ga0070674_100061413 3300005356 Bacteria 2622
36 Ga0070674_100433620 3300005356 Bacteria 1081
37 Ga0070673_100080697 3300005364 Bacteria 2637
38 Ga0070659_100089780 3300005366 Bacteria 2462
39 Ga0070667_100000447 3300005367 Bacteria 42767
40 Ga0070667_100000722 3300005367 Bacteria 31740
41 Ga0070667_100004508 3300005367 Bacteria 11744
42 Ga0070667_100149088 3300005367 Bacteria 2053
43 Ga0070667_100158736 3300005367 Bacteria 1991
44 Ga0070709_10009059 3300005434 Bacteria 5480
45 Ga0070709_10109931 3300005434 Bacteria 1851
46 Ga0070714_100000892 3300005435 Bacteria 21159
47 Ga0070714_100224169 3300005435 Bacteria 1729
48 Ga0070714_100373428 3300005435 Bacteria 1343
49 Ga0070714_100575875 3300005435 Bacteria 1080
50 Ga0070713_100000615 3300005436 Bacteria 22702
51 Ga0070713_100368423 3300005436 Bacteria 1336
52 Ga0070710_10000162 3300005437 Bacteria 30904
53 Ga0070710_10000197 3300005437 Bacteria 28159
54 Ga0070710_10007238 3300005437 Bacteria 5363
55 Ga0070701_10000896 3300005438 Bacteria 10743
56 Ga0070711_100000432 3300005439 Bacteria 21875
57 Ga0070711_100001123 3300005439 Bacteria 14301
58 Ga0070711_100003442 3300005439 Bacteria 9219
59 Ga0070711_100147453 3300005439 Bacteria 1771
60 Ga0070694_100038402 3300005444 Bacteria 3182
61 Ga0070663_100010148 3300005455 Bacteria 5860
62 Ga0070663_100045719 3300005455 Bacteria 3094
63 Ga0070678_100000266 3300005456 Bacteria 24153
64 Ga0070662_100001304 3300005457 Bacteria 15325
65 Ga0068867_100003480 3300005459 Bacteria 11068
66 Ga0068867_100207569 3300005459 Bacteria 1571
67 Ga0070685_10327284 3300005466 Bacteria 1041
68 Ga0070679_100449206 3300005530 Bacteria 1234
69 Ga0068853_100028905 3300005539 Bacteria 4667
70 Ga0068853_100047018 3300005539 Bacteria 3703
71 Ga0068853_100065905 3300005539 Bacteria 3143
72 Ga0070693_100038604 3300005547 Bacteria 2670
73 Ga0070665_100005250 3300005548 Bacteria 13393
74 Ga0070665_100080573 3300005548 Bacteria 3261
75 Ga0070665_100114239 3300005548 Bacteria 2703
76 Ga0070665_100146649 3300005548 Bacteria 2363
77 Ga0070704_100000494 3300005549 Bacteria 18742
78 Ga0070704_100216891 3300005549 Bacteria 1553
79 Ga0068855_100675088 3300005563 Bacteria 1107
80 Ga0068854_100004995 3300005578 Bacteria 8363
81 Ga0068854_100020743 3300005578 Bacteria 4452
82 Ga0068856_100164009 3300005614 Bacteria 2233
83 Ga0070702_100009818 3300005615 Bacteria 4696
84 Ga0070702_100013523 3300005615 Bacteria 4121
85 Ga0068852_100184782 3300005616 Bacteria 1962
86 Ga0068859_100003471 3300005617 Bacteria 16034
87 Ga0068859_100012981 3300005617 Bacteria 8370
88 Ga0068859_101013767 3300005617 Bacteria 912
89 Ga0068866_10007627 3300005718 Bacteria 4536
90 Ga0068861_100001756 3300005719 Bacteria 13937
91 Ga0068861_100255484 3300005719 Bacteria 1497
92 Ga0068870_10428643 3300005840 Bacteria 867
93 Ga0068863_100001461 3300005841 Bacteria 23435
94 Ga0068863_100003619 3300005841 Bacteria 15258
95 Ga0068858_100011847 3300005842 Bacteria 8220
96 Ga0068858_100057380 3300005842 Bacteria 3598
97 Ga0068858_100125107 3300005842 Bacteria 2406
98 Ga0068858_100288198 3300005842 Bacteria 1565
99 Ga0068860_100000016 3300005843 Bacteria 310468
100 Ga0068860_100012750 3300005843 Bacteria 8264
101 Ga0068860_100328253 3300005843 Bacteria 1502
102 Ga0068862_100000051 3300005844 Bacteria 145362
103 Ga0068862_100015575 3300005844 Bacteria 6315
104 Ga0070717_10453653 3300006028 Bacteria 1156
105 Ga0075365_10006198 3300006038 Bacteria 6554
106 Ga0075365_10014377 3300006038 Bacteria 4759
107 Ga0075365_10027830 3300006038 Bacteria 3601
108 Ga0075365_10073628 3300006038 Bacteria 2303
109 Ga0075365_10086551 3300006038 Bacteria 2130
110 Ga0075365_10129879 3300006038 Bacteria 1743
111 Ga0075365_10221643 3300006038 Bacteria 1327
112 Ga0075368_10075314 3300006042 Bacteria 1368
113 Ga0075363_100000311 3300006048 Bacteria 14346
114 Ga0075363_100003969 3300006048 Bacteria 6394
115 Ga0075363_100007576 3300006048 Bacteria 5001
116 Ga0075363_100035341 3300006048 Bacteria 2614
117 Ga0075363_100042181 3300006048 Bacteria 2409
118 Ga0075363_100179697 3300006048 Bacteria 1203
119 Ga0075364_10001449 3300006051 Bacteria 12883
120 Ga0075364_10002181 3300006051 Bacteria 10969
121 Ga0075364_10018214 3300006051 Bacteria 4395
122 Ga0075364_10345209 3300006051 Bacteria 1014
123 Ga0075432_10096043 3300006058 Bacteria 1090
124 Ga0070715_10002367 3300006163 Bacteria 5770
125 Ga0070716_100000099 3300006173 Bacteria 34121
126 Ga0070716_100008964 3300006173 Bacteria 4976
127 Ga0070716_100021955 3300006173 Bacteria 3369
128 Ga0070712_100001887 3300006175 Bacteria 12783
129 Ga0070712_100071791 3300006175 Bacteria 2478
130 Ga0075367_10021672 3300006178 Bacteria 3594
131 Ga0075367_10042318 3300006178 Bacteria 2665
132 Ga0075369_10000780 3300006186 Bacteria 10414
133 Ga0075369_10017711 3300006186 Bacteria 2893
134 Ga0075369_10042894 3300006186 Bacteria 1940
135 Ga0075369_10047349 3300006186 Bacteria 1854
136 Ga0075369_10048332 3300006186 Bacteria 1836
137 Ga0075369_10190215 3300006186 Bacteria 946
138 Ga0075366_10145689 3300006195 Bacteria 1433
139 Ga0097621_100074171 3300006237 Bacteria 2818
140 Ga0075370_10000615 3300006353 Bacteria 13785
141 Ga0075370_10012101 3300006353 Bacteria 4552
142 Ga0075370_10058034 3300006353 Bacteria 2201
143 Ga0068871_100065656 3300006358 Bacteria 2972
144 Ga0075428_100008221 3300006844 Bacteria 11574
145 Ga0075430_100025973 3300006846 Bacteria 4984
146 Ga0068865_100004825 3300006881 Bacteria 8148
147 Ga0068865_100506807 3300006881 Bacteria 1007
148 Ga0097620_100003471 3300006931 Bacteria 16034
149 Ga0097620_100012980 3300006931 Bacteria 8370
150 Ga0097620_101013820 3300006931 Bacteria 912
151 Ga0099795_10032648 3300007788 Bacteria 1802
152 Ga0105250_10016187 3300009092 Bacteria 3044
153 Ga0111539_10159711 3300009094 Bacteria 2637
154 Ga0105245_10001901 3300009098 Bacteria 18974
155 Ga0105245_10070647 3300009098 Bacteria 3169
156 Ga0105247_10000017 3300009101 Bacteria 260438
157 Ga0105247_10001537 3300009101 Bacteria 16476
158 Ga0105247_10206256 3300009101 Bacteria 1323
159 Ga0114129_10230379 3300009147 Bacteria 2495
160 Ga0105243_10006892 3300009148 Bacteria 8757
161 Ga0105243_10084945 3300009148 Bacteria 2593
162 Ga0105242_10010413 3300009176 Bacteria 7133
163 Ga0105248_10000025 3300009177 Bacteria 259691
164 Ga0105248_10002782 3300009177 Bacteria 19446
165 Ga0105248_10333744 3300009177 Bacteria 1707
166 Ga0105237_10000745 3300009545 Bacteria 44856
167 Ga0105237_10006530 3300009545 Bacteria 12910
168 Ga0105237_10252451 3300009545 Bacteria 1766
169 Ga0105237_10379520 3300009545 Bacteria 1418
170 Ga0105238_10222438 3300009551 Bacteria 1864
171 Ga0105249_10000021 3300009553 Bacteria 260448
172 Ga0105249_10003602 3300009553 Bacteria 13399
173 Ga0105249_10011777 3300009553 Bacteria 7687
174 Ga0105249_10134591 3300009553 Bacteria 2364
175 Ga0099796_10063207 3300010159 Bacteria 1318
176 Ga0105239_10006939 3300010375 Bacteria 13064
177 Ga0105239_10015207 3300010375 Bacteria 8529
178 Ga0105239_10017943 3300010375 Bacteria 7826
179 Ga0105239_10144887 3300010375 Bacteria 2649
180 Ga0105246_10087859 3300011119 Bacteria 2232
181 Ga0105246_10187713 3300011119 Bacteria 1597
182 Ga0157369_10120374 3300013105 Bacteria 2786
183 Ga0157369_10748579 3300013105 Bacteria 1005
184 Ga0157378_10006852 3300013297 Bacteria 9937
185 Ga0157378_10160145 3300013297 Bacteria 2104
186 Ga0163162_10011274 3300013306 Bacteria 8717
187 Ga0163162_10371926 3300013306 Bacteria 1562
188 Ga0163162_10821463 3300013306 Bacteria 1046
189 Ga0157372_10005875 3300013307 Bacteria 13060
190 Ga0157372_10252325 3300013307 Bacteria 2048
191 Ga0157375_10001189 3300013308 Bacteria 22465
192 Ga0163163_10014123 3300014325 Bacteria 7334
193 Ga0163163_10043279 3300014325 Bacteria 4414
194 Ga0157380_10000311 3300014326 Bacteria 29419
195 Ga0157379_10056011 3300014968 Bacteria 3524
196 Ga0157379_10624216 3300014968 Bacteria 1007
197 Ga0157379_10675634 3300014968 Bacteria 968
198 Ga0163161_10000438 3300017792 Bacteria 34726
199 Ga0213876_10009034 3300021384 Bacteria 5368
200 Ga0213876_10011660 3300021384 Bacteria 4692
201 Ga0213875_10008727 3300021388 Bacteria 5172
202 Ga0213875_10029213 3300021388 Bacteria 2615
203 Ga0209673_1007947 3300025273 Bacteria 4790
204 Ga0209051_1000328 3300025303 Bacteria 71477
205 Ga0209051_1000495 3300025303 Bacteria 50813
206 Ga0209051_1001554 3300025303 Bacteria 19000
207 Ga0209051_1023171 3300025303 Bacteria 2590
208 Ga0209051_1025590 3300025303 Bacteria 2397
209 Ga0209051_1074166 3300025303 Bacteria 1010
210 Ga0207696_1046433 3300025711 Bacteria 1253
211 Ga0207692_10000508 3300025898 Bacteria 13743
212 Ga0207692_10001211 3300025898 Bacteria 9569
213 Ga0207642_10000444 3300025899 Bacteria 12552
214 Ga0207642_10157349 3300025899 Bacteria 1216
215 Ga0207710_10000033 3300025900 Bacteria 260531
216 Ga0207710_10140503 3300025900 Bacteria 1166
217 Ga0207688_10000419 3300025901 Bacteria 19964
218 Ga0207688_10003935 3300025901 Bacteria 8097
219 Ga0207688_10305177 3300025901 Bacteria 974
220 Ga0207680_10039053 3300025903 Bacteria 2751
221 Ga0207685_10005257 3300025905 Bacteria 3397
222 Ga0207699_10159427 3300025906 Bacteria 1501
223 Ga0207645_10008542 3300025907 Bacteria 7137
224 Ga0207645_10179380 3300025907 Bacteria 1389
225 Ga0207643_10317542 3300025908 Bacteria 972
226 Ga0207671_10004366 3300025914 Bacteria 13558
227 Ga0207671_10004823 3300025914 Bacteria 12701
228 Ga0207693_10003367 3300025915 Bacteria 13655
229 Ga0207693_10008209 3300025915 Bacteria 8554
230 Ga0207693_10062064 3300025915 Bacteria 2928
231 Ga0207663_10003894 3300025916 Bacteria 7376
232 Ga0207663_10010186 3300025916 Bacteria 4992
233 Ga0207663_10019279 3300025916 Bacteria 3839
234 Ga0207663_10095469 3300025916 Bacteria 1984
235 Ga0207660_10080468 3300025917 Bacteria 2393
236 Ga0207662_10038644 3300025918 Bacteria 2797
237 Ga0207652_10314442 3300025921 Bacteria 1414
238 Ga0207681_10001320 3300025923 Bacteria 16003
239 Ga0207681_10097910 3300025923 Bacteria 2109
240 Ga0207694_10236913 3300025924 Bacteria 1491
241 Ga0207687_10001562 3300025927 Bacteria 15734
242 Ga0207700_10000423 3300025928 Bacteria 24876
243 Ga0207664_10000246 3300025929 Bacteria 40614
244 Ga0207644_10031774 3300025931 Bacteria 3680
245 Ga0207644_10061406 3300025931 Bacteria 2722
246 Ga0207706_10023699 3300025933 Bacteria 5508
247 Ga0207706_10037189 3300025933 Bacteria 4323
248 Ga0207686_10185657 3300025934 Bacteria 1478
249 Ga0207669_10000871 3300025937 Bacteria 12803
250 Ga0207669_10093928 3300025937 Bacteria 1961
251 Ga0207704_10004808 3300025938 Bacteria 6201
252 Ga0207665_10000253 3300025939 Bacteria 36881
253 Ga0207665_10012970 3300025939 Bacteria 5479
254 Ga0207665_10016469 3300025939 Bacteria 4853
255 Ga0207691_10106006 3300025940 Bacteria 2504
256 Ga0207711_10000390 3300025941 Bacteria 46512
257 Ga0207711_10027536 3300025941 Bacteria 4775
258 Ga0207711_10042329 3300025941 Bacteria 3881
259 Ga0207711_10357960 3300025941 Bacteria 1352
260 Ga0207689_10007162 3300025942 Bacteria 9807
261 Ga0207689_10015324 3300025942 Bacteria 6488
262 Ga0207661_10448197 3300025944 Bacteria 1175
263 Ga0207667_10438810 3300025949 Bacteria 1327
264 Ga0207651_10109393 3300025960 Bacteria 2071
265 Ga0207712_10000005 3300025961 Bacteria 608697
266 Ga0207712_10022437 3300025961 Bacteria 4156
267 Ga0207712_10032994 3300025961 Bacteria 3498
268 Ga0207668_10000367 3300025972 Bacteria 28871
269 Ga0207668_10003927 3300025972 Bacteria 8769
270 Ga0207668_10036636 3300025972 Bacteria 3276
271 Ga0207668_10147104 3300025972 Bacteria 1819
272 Ga0207668_10305587 3300025972 Bacteria 1314
273 Ga0207640_10001703 3300025981 Bacteria 11791
274 Ga0207658_10000299 3300025986 Bacteria 51661
275 Ga0207658_10002731 3300025986 Bacteria 12753
276 Ga0207658_10028316 3300025986 Bacteria 3945
277 Ga0207658_10054722 3300025986 Bacteria 2954
278 Ga0207658_10095028 3300025986 Bacteria 2321
279 Ga0207658_10117215 3300025986 Bacteria 2116
280 Ga0207658_10348145 3300025986 Bacteria 1289
281 Ga0207677_10026596 3300026023 Bacteria 3632
282 Ga0207677_10193263 3300026023 Bacteria 1611
283 Ga0207677_10240891 3300026023 Bacteria 1463
284 Ga0207703_10022185 3300026035 Bacteria 4977
285 Ga0207703_10047718 3300026035 Bacteria 3454
286 Ga0207639_10057523 3300026041 Bacteria 2986
287 Ga0207639_10067553 3300026041 Bacteria 2782
288 Ga0207639_10085493 3300026041 Bacteria 2508
289 Ga0207639_10335686 3300026041 Bacteria 1346
290 Ga0207678_10003843 3300026067 Bacteria 13504
291 Ga0207678_10013274 3300026067 Bacteria 7228
292 Ga0207678_10013643 3300026067 Bacteria 7136
293 Ga0207678_10177086 3300026067 Bacteria 1821
294 Ga0207708_10010776 3300026075 Bacteria 6793
295 Ga0207708_10042213 3300026075 Bacteria 3477
296 Ga0207702_10213349 3300026078 Bacteria 1796
297 Ga0207641_10003252 3300026088 Bacteria 14481
298 Ga0207641_10030028 3300026088 Bacteria 4499
299 Ga0207648_10003875 3300026089 Bacteria 15614
300 Ga0207648_10005009 3300026089 Bacteria 13451
301 Ga0207648_10801851 3300026089 Bacteria 876
302 Ga0207675_100001197 3300026118 Bacteria 25872
303 Ga0207675_100078589 3300026118 Bacteria 3091
304 Ga0207675_100258643 3300026118 Bacteria 1686
305 Ga0207675_100680148 3300026118 Bacteria 1037
306 Ga0207683_10087941 3300026121 Bacteria 2763
307 Ga0207683_10135750 3300026121 Bacteria 2214
308 Ga0268266_10004568 3300028379 Bacteria 13228
309 Ga0268266_10010168 3300028379 Bacteria 8245
310 Ga0268266_10071927 3300028379 Bacteria 2998
311 Ga0268265_10000022 3300028380 Bacteria 270788
312 Ga0268265_10031049 3300028380 Bacteria 3855
313 Ga0268265_10091227 3300028380 Bacteria 2436
314 Ga0268264_10000005 3300028381 Bacteria 934972
315 Ga0268264_10007501 3300028381 Bacteria 9100
316 Ga0268264_10268936 3300028381 Bacteria 1592
317 Ga0268264_10370219 3300028381 Bacteria 1369
318 Ga0265327_10000690 3300031251 Bacteria 53948
319 Ga0265327_10014744 3300031251 Bacteria 5092
320 Ga0316578_10142310 3300031728 Bacteria 1445
321 Ga0307413_10022562 3300031824 Bacteria 3395
322 Ga0307410_10040797 3300031852 Bacteria 3057
323 Ga0307407_10111184 3300031903 Bacteria 1720
324 Ga0307407_10163814 3300031903 Bacteria 1458
325 Ga0307409_100010907 3300031995 Bacteria 5689
326 Ga0307409_100273172 3300031995 Bacteria 1558
327 Ga0307416_100200321 3300032002 Bacteria 1894
328 Ga0307416_100815811 3300032002 Bacteria 1029
329 Ga0307414_10242165 3300032004 Bacteria 1494
330 Ga0307415_100005581 3300032126 Bacteria 6694
331 Ga0316583_10061156 3300032133 Bacteria 1320
332 Ga0373929_0044939 3300035085 Bacteria 993
333 Ga0373949_0025414 3300035090 Bacteria 1382
334 Ga0373960_0032050 3300035121 Bacteria 1474
335 Ga0373942_0034042 3300035207 Bacteria 1361
336 Ga0373962_0068995 3300035242 Bacteria 1053
337 Ga0373931_0126356 3300035691 Bacteria 1467
338 Ga0373931_0133695 3300035691 Bacteria 1430
339 Ga0436364_0134803 3300037853 Bacteria 7473
340 Ga0436364_0529249 3300037853 Bacteria 39037
341 Ga0436364_1230402 3300037853 Bacteria 1419
342 Ga0436364_1361321 3300037853 Bacteria 5774
343 Ga0436365_0133306 3300039437 Bacteria 59687
344 Ga0436365_0393632 3300039437 Bacteria 30038
345 Ga0436365_0788541 3300039437 Bacteria 6826
346 Ga0436365_1786979 3300039437 Bacteria 3304
347 Ga0436360_0999311 3300039438 Bacteria 1020
348 Ga0436361_0300336 3300039447 Bacteria 1572
349 Ga0436363_0202621 3300039450 Bacteria 2763
350 Ga0436363_0706973 3300039450 Bacteria 879
351 Ga0436363_1680582 3300039450 Bacteria 1755
352 Ga0439466_0002725 3300041411 Bacteria 6921
353 Ga0439466_0051325 3300041411 Bacteria 1351
354 Ga0439465_0000360 3300041413 Bacteria 13039
355 Ga0439465_0008694 3300041413 Bacteria 3202
356 Ga0439465_0033574 3300041413 Bacteria 1641
357 Ga0451789_1271276 3300041443 Bacteria 1682
358 Ga0451793_0915949 3300041452 Bacteria 1895
359 Ga0439431_0003322 3300041997 Bacteria 3540
360 Ga0439431_0008704 3300041997 Bacteria 2285
361 Ga0439445_0001784 3300042004 Bacteria 4744
362 Ga0439445_0028283 3300042004 Bacteria 1444
363 Ga0439448_0003342 3300042005 Bacteria 4439
364 Ga0439434_0017423 3300042435 Bacteria 2150
365 Ga0439434_0056794 3300042435 Bacteria 1220
366 Ga0439459_0008329 3300042438 Bacteria 1769
367 Ga0466969_0056926 3300044656 Bacteria 1907
368 Ga0466969_0191019 3300044656 Bacteria 936
369 Ga0466972_0003356 3300044658 Bacteria 7934
370 Ga0466972_0019943 3300044658 Bacteria 3351
371 Ga0466972_0041164 3300044658 Bacteria 2250
372 Ga0466972_0089071 3300044658 Bacteria 1464
373 Ga0466965_0008126 3300044683 Bacteria 4846
374 Ga0466965_0014115 3300044683 Bacteria 3779
375 Ga0466965_0033741 3300044683 Bacteria 2502
376 Ga0466965_0139817 3300044683 Bacteria 1260
377 Ga0466966_0004917 3300044684 Bacteria 8787
378 Ga0466966_0013763 3300044684 Bacteria 5352
379 Ga0466961_0002498 3300044693 Bacteria 11408
380 Ga0466961_0004678 3300044693 Bacteria 8597
381 Ga0466963_0019045 3300044694 Bacteria 4298
382 Ga0466963_0033347 3300044694 Bacteria 3342
383 Ga0466963_0046204 3300044694 Bacteria 2870
384 Ga0466963_0071076 3300044694 Bacteria 2342
385 Ga0466963_0135753 3300044694 Bacteria 1702
386 Ga0466963_0149796 3300044694 Bacteria 1620
387 Ga0466963_0363174 3300044694 Bacteria 1020
388 Ga0466971_0027173 3300044719 Bacteria 2562
389 Ga0466968_0001088 3300044735 Bacteria 9619
390 Ga0466968_0004504 3300044735 Bacteria 5212
391 Ga0466968_0051903 3300044735 Bacteria 1753
392 Ga0466970_0007456 3300044765 Bacteria 5485
393 Ga0466970_0013966 3300044765 Bacteria 4120
394 Ga0466970_0022282 3300044765 Bacteria 3306
395 Ga0466970_0339610 3300044765 Bacteria 851
396 Ga0466957_0003089 3300044842 Bacteria 9063
397 Ga0466957_0007005 3300044842 Bacteria 6372
398 Ga0466957_0146201 3300044842 Bacteria 1526
399 Ga0466960_0008793 3300044901 Bacteria 4146
400 Ga0466960_0050384 3300044901 Bacteria 2007
401 Ga0466960_0105088 3300044901 Bacteria 1459
402 Ga0466959_0003322 3300045049 Bacteria 10503
403 Ga0466959_0035075 3300045049 Bacteria 3711
404 Ga0466959_0046857 3300045049 Bacteria 3181
405 Ga0466959_0186589 3300045049 Bacteria 1448
406 Ga0466958_0002748 3300045836 Bacteria 8935
407 Ga0466958_0041371 3300045836 Bacteria 2771
408 Ga0466967_0022311 3300045976 Bacteria 5163
409 Ga0466967_0102269 3300045976 Bacteria 2621
410 Ga0466967_0223533 3300045976 Bacteria 1790
411 Ga0466967_0233827 3300045976 Bacteria 1751
412 Ga0466967_0274379 3300045976 Bacteria 1616
413 Ga0466967_0647685 3300045976 Bacteria 1045
414 Ga0495629_0024641 3300046459 Bacteria 4283
415 Ga0495638_0029099 3300046460 Bacteria 3563
416 Ga0495638_0041968 3300046460 Bacteria 2891
417 Ga0495641_0028997 3300046461 Bacteria 2672
418 Ga0495639_0021635 3300046475 Bacteria 2817
419 Ga0495594_0401566 3300046499 Bacteria 780
420 Ga0495606_0063107 3300046507 Bacteria 2362
421 Ga0495628_0057451 3300046516 Bacteria 3061
422 Ga0495630_0134744 3300046517 Bacteria 1877
423 Ga0495640_0019594 3300046533 Bacteria 4990
424 Ga0495586_0155039 3300046535 Bacteria 1290
425 Ga0495668_0022852 3300046616 Bacteria 3572
426 Ga0495611_0016219 3300046648 Bacteria 3185
427 Ga0495624_0148515 3300046690 Bacteria 1434
428 Ga0495671_0125403 3300046692 Bacteria 1252
429 Ga0495581_0028358 3300047315 Bacteria 3245
430 Ga0495672_0005443 3300047320 Bacteria 10101
431 Ga0495673_0003890 3300047469 Bacteria 9609
432 Ga0495686_0002730 3300047472 Bacteria 16130
433 Ga0496100_0000608 3300048903 Bacteria 16954
434 Ga0496100_0002549 3300048903 Bacteria 9283
435 Ga0496100_0004828 3300048903 Bacteria 7200
436 Ga0496100_0005877 3300048903 Bacteria 6643
437 Ga0496100_0168360 3300048903 Bacteria 1576
438 Ga0496101_0000002 3300048904 Bacteria 410971
439 Ga0496101_0000118 3300048904 Bacteria 77684
440 Ga0496101_0000257 3300048904 Bacteria 37750
441 Ga0496101_0003088 3300048904 Bacteria 10295
442 Ga0496101_0066944 3300048904 Bacteria 2621
443 Ga0496101_0229008 3300048904 Bacteria 1444
444 Ga0496102_0000003 3300048905 Bacteria 592263
445 Ga0496102_0000449 3300048905 Bacteria 46890
446 Ga0496102_0001144 3300048905 Bacteria 24248
447 Ga0496102_0022005 3300048905 Bacteria 5647
448 Ga0496102_0023733 3300048905 Bacteria 5450
449 Ga0496102_0024246 3300048905 Bacteria 5393
450 Ga0496102_0030295 3300048905 Bacteria 4842
451 Ga0496102_0037947 3300048905 Bacteria 4346
452 Ga0496102_0042824 3300048905 Bacteria 4104
453 Ga0496102_0257713 3300048905 Bacteria 1644
454 Ga0496102_0772397 3300048905 Bacteria 883
455 Ga0496103_0000014 3300048906 Bacteria 290397
456 Ga0496103_0000515 3300048906 Bacteria 31901
457 Ga0496103_0001682 3300048906 Bacteria 14467
458 Ga0496103_0002601 3300048906 Bacteria 11301
459 Ga0496103_0046690 3300048906 Bacteria 2675
460 Ga0496103_0048947 3300048906 Bacteria 2613
461 Ga0496104_0000393 3300048907 Bacteria 38237
462 Ga0496104_0025610 3300048907 Bacteria 5439
463 Ga0496104_0475610 3300048907 Bacteria 1161
464 Ga0496104_0608410 3300048907 Bacteria 1003
465 Ga0496105_0008164 3300048908 Bacteria 8137
466 Ga0496105_0049593 3300048908 Bacteria 3467
467 Ga0496106_0001146 3300048909 Bacteria 19638
468 Ga0496106_0001338 3300048909 Bacteria 18479
469 Ga0496106_0002241 3300048909 Bacteria 14411
470 Ga0496106_0015422 3300048909 Bacteria 5654
471 Ga0496106_0033810 3300048909 Bacteria 3816
472 Ga0496106_0115421 3300048909 Bacteria 2094
473 Ga0496107_0000106 3300048910 Bacteria 40710
474 Ga0496107_0000276 3300048910 Bacteria 27176
475 Ga0496107_0008806 3300048910 Bacteria 6991
476 Ga0496107_0009400 3300048910 Bacteria 6781
477 Ga0496107_0247028 3300048910 Bacteria 1328
478 Ga0496108_0008469 3300048911 Bacteria 8343
479 Ga0496108_0077212 3300048911 Bacteria 2816
480 Ga0496108_0118488 3300048911 Bacteria 2269
481 Ga0496108_0203708 3300048911 Bacteria 1717
482 Ga0496109_0000077 3300048912 Bacteria 103492
483 Ga0496109_0007105 3300048912 Bacteria 9452
484 Ga0496109_0009146 3300048912 Bacteria 8436
485 Ga0496109_0452386 3300048912 Bacteria 1213
486 Ga0496110_0036998 3300048913 Bacteria 4240
487 Ga0496110_0060478 3300048913 Bacteria 3341
488 Ga0496110_0252140 3300048913 Bacteria 1606
489 Ga0496112_0032298 3300048915 Bacteria 5082
490 Ga0496112_0033245 3300048915 Bacteria 5012
491 Ga0496112_0632521 3300048915 Bacteria 1001
492 Ga0496113_0029412 3300048916 Bacteria 3967
493 Ga0496114_0000446 3300048917 Bacteria 30334
494 Ga0496114_0019626 3300048917 Bacteria 5477
495 Ga0496114_0307659 3300048917 Bacteria 1400
496 Ga0496114_0513900 3300048917 Bacteria 1059
497 Ga0496115_0000841 3300048918 Bacteria 22438
498 Ga0496115_0011790 3300048918 Bacteria 6564
499 Ga0496115_0041074 3300048918 Bacteria 3679
500 Ga0496116_0000071 3300048919 Bacteria 244521
501 Ga0496116_0036636 3300048919 Bacteria 3429
502 Ga0496116_0056816 3300048919 Bacteria 2562
503 Ga0496117_0000003 3300048920 Bacteria 1881097
504 Ga0496117_0000417 3300048920 Bacteria 71654
505 Ga0496117_0027950 3300048920 Bacteria 4376
506 Ga0496118_0000001 3300048921 Bacteria 1881100
507 Ga0496118_0000350 3300048921 Bacteria 78354
508 Ga0496118_0002093 3300048921 Bacteria 28035
509 Ga0496118_0044144 3300048921 Bacteria 3493
510 Ga0496119_0000880 3300048922 Bacteria 39332
511 Ga0496119_0001473 3300048922 Bacteria 28179
512 Ga0496119_0016401 3300048922 Bacteria 5639
513 Ga0496120_0000157 3300048923 Bacteria 112786
514 Ga0496120_0002191 3300048923 Bacteria 20676
515 Ga0496121_0000002 3300048924 Bacteria 1494588
516 Ga0496121_0000019 3300048924 Bacteria 499976
517 Ga0496121_0007338 3300048924 Bacteria 13331
518 Ga0496122_0000051 3300048925 Bacteria 265104
519 Ga0496122_0030057 3300048925 Bacteria 4562
520 Ga0496123_0018252 3300048926 Bacteria 5588
521 Ga0496124_0000002 3300048927 Bacteria 1494588
522 Ga0496125_0000002 3300048928 Bacteria 1480920
523 Ga0496125_0086529 3300048928 Bacteria 2370
524 Ga0496126_0000011 3300048929 Bacteria 744275
525 Ga0496126_0000186 3300048929 Bacteria 140016
526 Ga0496126_0009101 3300048929 Bacteria 10605
527 Ga0496126_0009912 3300048929 Bacteria 10065
528 Ga0496126_0086408 3300048929 Bacteria 2764
529 Ga0495682_0084920 3300049460 Bacteria 1138
530 Ga0501032_0019381 3300049569 Bacteria 4759
531 Ga0501032_0029549 3300049569 Bacteria 3760
532 Ga0501032_0141461 3300049569 Bacteria 1584
533 Ga0501034_0001377 3300049571 Bacteria 32679
534 Ga0501034_0005081 3300049571 Bacteria 14453
535 Ga0501034_0106962 3300049571 Bacteria 2789
536 Ga0501034_0705337 3300049571 Bacteria 907
537 Ga0501036_0040979 3300049572 Bacteria 3919
538 Ga0501037_0001541 3300049573 Bacteria 16809
539 Ga0501039_0001154 3300049575 Bacteria 19473
540 Ga0501043_0002601 3300049579 Bacteria 15219
541 Ga0501046_0011076 3300049580 Bacteria 7721
542 Ga0501046_0440334 3300049580 Bacteria 938
543 Ga0501047_0017748 3300049581 Bacteria 6818
544 Ga0501047_0018744 3300049581 Bacteria 6636
545 Ga0501047_0051154 3300049581 Bacteria 3990
546 Ga0501047_0269855 3300049581 Bacteria 1548
547 Ga0501047_0306601 3300049581 Bacteria 1429
548 Ga0501048_0002589 3300049582 Bacteria 13852
549 Ga0501067_0200424 3300049583 Bacteria 1112
550 Ga0501069_0032380 3300049585 Bacteria 2877
551 Ga0501069_0089108 3300049585 Bacteria 1744
552 Ga0501070_0000598 3300049586 Bacteria 32974
553 Ga0501070_0020478 3300049586 Bacteria 5547
554 Ga0501070_0079803 3300049586 Bacteria 2708
555 Ga0501070_0194136 3300049586 Bacteria 1668
556 Ga0501073_0025704 3300049589 Bacteria 4220
557 Ga0501077_0074186 3300049593 Bacteria 2155
558 Ga0501080_0023304 3300049742 Bacteria 5740
559 Ga0501080_0099293 3300049742 Bacteria 2701
560 Ga0501080_0187284 3300049742 Bacteria 1903
561 Ga0501035_0003175 3300049822 Bacteria 15766
562 Ga0501035_0025913 3300049822 Bacteria 5372
563 Ga0501044_0003864 3300049823 Bacteria 16786
564 Ga0501044_0005126 3300049823 Bacteria 14613
565 Ga0501044_0005857 3300049823 Bacteria 13613
566 Ga0501044_0028145 3300049823 Bacteria 5932
567 nmdc:mga03683_246657_c1 3300050489 Bacteria 829
568 nmdc:mga03683_31612_c1 3300050489 Bacteria 2124
569 nmdc:mga03n38_1283_c1 3300050490 Bacteria 7074
570 nmdc:mga03n38_162412_c1 3300050490 Bacteria 1132
571 nmdc:mga03n38_216468_c1 3300050490 Bacteria 998
572 nmdc:mga03n38_250836_c1 3300050490 Bacteria 935
573 nmdc:mga03n38_32335_c1 3300050490 Bacteria 2216
574 nmdc:mga00v17_1409_c1 3300050491 Bacteria 12612
575 nmdc:mga00v17_173310_c1 3300050491 Bacteria 1392
576 nmdc:mga00v17_2741_c1 3300050491 Bacteria 9040
577 nmdc:mga00v17_57542_c1 3300050491 Bacteria 2379
578 nmdc:mga0yw44_13925_c1 3300050492 Bacteria 4252
579 nmdc:mga0yw44_20597_c1 3300050492 Bacteria 3663
580 nmdc:mga0yw44_25213_c1 3300050492 Bacteria 3377
581 nmdc:mga0yw44_31923_c1 3300050492 Bacteria 3066
582 nmdc:mga06z11_10047_c1 3300050494 Bacteria 4014
583 nmdc:mga07m45_214448_c1 3300050496 Bacteria 1120
584 nmdc:mga07m45_64782_c1 3300050496 Bacteria 2074
585 nmdc:mga07m45_7319_c1 3300050496 Bacteria 5632
586 nmdc:mga07m45_7367_c1 3300050496 Bacteria 5619
587 nmdc:mga07m45_81207_c1 3300050496 Bacteria 1851
588 nmdc:mga05p37_208080_c1 3300050507 Bacteria 2366
589 nmdc:mga0qj67_22815_c1 3300050509 Bacteria 4808
590 nmdc:mga06r32_77693_c1 3300050510 Bacteria 3225
591 nmdc:mga0sz30_33903_c1 3300050516 Bacteria 2123
592 nmdc:mga0sz30_45828_c1 3300050516 Bacteria 1845
593 nmdc:mga0sz30_69806_c1 3300050516 Bacteria 1511
594 nmdc:mga0sz30_79219_c1 3300050516 Bacteria 962
595 nmdc:mga0sz30_866_c1 3300050516 Bacteria 10911
596 Ga0500610_0027251 3300053079 Bacteria 2868
597 Ga0500635_0027887 3300053080 Bacteria 1799
598 Ga0495619_0319280 3300053085 Bacteria 1075
599 Ga0500643_003393 3300053087 Bacteria 7699
600 Ga0500643_043171 3300053087 Bacteria 1316
601 Ga0500556_0018904 3300053104 Bacteria 2182
602 Ga0500652_000732 3300053131 Bacteria 11126
603 Ga0500616_0011313 3300053153 Bacteria 5280
604 Ga0500627_0056093 3300053158 Bacteria 1726
605 Ga0500645_003598 3300053730 Bacteria 6219
606 Ga0466962_0041180 3300061719 Bacteria 2210
607 2644489902 2643221687 Bacteria 6500351
608 2644635512 2643221715 Bacteria 6671032
609 2738707524 2738541274 Bacteria 6909446
610 2739334013 2738543028 Bacteria 6917070
611 2842136952 2842134933 Bacteria 5847019
612 2902793273 2902792274 Bacteria 7270173
613 2902802859 2902799365 Bacteria 5419524
614 2902813459 2902810491 Bacteria 6794147
615 2902841527 2902837492 Bacteria 6697721
616 2929214006 2929212328 Bacteria 7708288
617 2939587808 2939582691 Bacteria 7088898
618 Ga0265338_10001462
619 JGI24746J21847_1005233
620 JGI24735J21928_10064706
621 JGI24738J21930_10012129
622 JGI24744J21845_10000374
623 JGI24742J22300_10004926
624 rootH2_10063788
625 Ga0055540_1001925
626 Ga0055540_1002814
627 Ga0070676_10009047
628 Ga0070676_10129504
629 Ga0070690_100314464
630 Ga0068869_100008020
631 Ga0068869_100024055
632 Ga0070666_10007242
633 Ga0070682_100049720
634 Ga0070682_100060473
635 Ga0068868_100001422
636 Ga0068868_100400157
637 Ga0070689_100036512
638 Ga0070689_100214222
639 Ga0070691_10005914
640 Ga0070691_10068704
641 Ga0070687_100370406
642 Ga0070668_100002923
643 Ga0070668_100097242
644 Ga0070669_100001172
645 Ga0070669_100172629
646 Ga0070675_100598447
647 Ga0070675_100805178
648 Ga0070671_100041760
649 Ga0070671_100053670
650 Ga0070671_100618930
651 Ga0070674_100000217
652 Ga0070674_100061413
653 Ga0070674_100433620
654 Ga0070673_100080697
655 Ga0070659_100089780
656 Ga0070667_100000447
657 Ga0070667_100000722
658 Ga0070667_100004508
659 Ga0070667_100149088
660 Ga0070667_100158736
661 Ga0070709_10009059
662 Ga0070709_10109931
663 Ga0070714_100000892
664 Ga0070714_100224169
665 Ga0070714_100373428
666 Ga0070714_100575875
667 Ga0070713_100000615
668 Ga0070713_100368423
669 Ga0070710_10000162
670 Ga0070710_10000197
671 Ga0070710_10007238
672 Ga0070701_10000896
673 Ga0070711_100000432
674 Ga0070711_100001123
675 Ga0070711_100003442
676 Ga0070711_100147453
677 Ga0070694_100038402
678 Ga0070663_100010148
679 Ga0070663_100045719
680 Ga0070678_100000266
681 Ga0070662_100001304
682 Ga0068867_100003480
683 Ga0068867_100207569
684 Ga0070685_10327284
685 Ga0070679_100449206
686 Ga0068853_100028905
687 Ga0068853_100047018
688 Ga0068853_100065905
689 Ga0070693_100038604
690 Ga0070665_100005250
691 Ga0070665_100080573
692 Ga0070665_100114239
693 Ga0070665_100146649
694 Ga0070704_100000494
695 Ga0070704_100216891
696 Ga0068855_100675088
697 Ga0068854_100004995
698 Ga0068854_100020743
699 Ga0068856_100164009
700 Ga0070702_100009818
701 Ga0070702_100013523
702 Ga0068852_100184782
703 Ga0068859_100003471
704 Ga0068859_100012981
705 Ga0068859_101013767
706 Ga0068866_10007627
707 Ga0068861_100001756
708 Ga0068861_100255484
709 Ga0068870_10428643
710 Ga0068863_100001461
711 Ga0068863_100003619
712 Ga0068858_100011847
713 Ga0068858_100057380
714 Ga0068858_100125107
715 Ga0068858_100288198
716 Ga0068860_100000016
717 Ga0068860_100012750
718 Ga0068860_100328253
719 Ga0068862_100000051
720 Ga0068862_100015575
721 Ga0070717_10453653
722 Ga0075365_10006198
723 Ga0075365_10014377
724 Ga0075365_10027830
725 Ga0075365_10073628
726 Ga0075365_10086551
727 Ga0075365_10129879
728 Ga0075365_10221643
729 Ga0075368_10075314
730 Ga0075363_100000311
731 Ga0075363_100003969
732 Ga0075363_100007576
733 Ga0075363_100035341
734 Ga0075363_100042181
735 Ga0075363_100179697
736 Ga0075364_10001449
737 Ga0075364_10002181
738 Ga0075364_10018214
739 Ga0075364_10345209
740 Ga0075432_10096043
741 Ga0070715_10002367
742 Ga0070716_100000099
743 Ga0070716_100008964
744 Ga0070716_100021955
745 Ga0070712_100001887
746 Ga0070712_100071791
747 Ga0075367_10021672
748 Ga0075367_10042318
749 Ga0075369_10000780
750 Ga0075369_10017711
751 Ga0075369_10042894
752 Ga0075369_10047349
753 Ga0075369_10048332
754 Ga0075369_10190215
755 Ga0075366_10145689
756 Ga0097621_100074171
757 Ga0075370_10000615
758 Ga0075370_10012101
759 Ga0075370_10058034
760 Ga0068871_100065656
761 Ga0075428_100008221
762 Ga0075430_100025973
763 Ga0068865_100004825
764 Ga0068865_100506807
765 Ga0097620_100003471
766 Ga0097620_100012980
767 Ga0097620_101013820
768 Ga0099795_10032648
769 Ga0105250_10016187
770 Ga0111539_10159711
771 Ga0105245_10001901
772 Ga0105245_10070647
773 Ga0105247_10000017
774 Ga0105247_10001537
775 Ga0105247_10206256
776 Ga0114129_10230379
777 Ga0105243_10006892
778 Ga0105243_10084945
779 Ga0105242_10010413
780 Ga0105248_10000025
781 Ga0105248_10002782
782 Ga0105248_10333744
783 Ga0105237_10000745
784 Ga0105237_10006530
785 Ga0105237_10252451
786 Ga0105237_10379520
787 Ga0105238_10222438
788 Ga0105249_10000021
789 Ga0105249_10003602
790 Ga0105249_10011777
791 Ga0105249_10134591
792 Ga0099796_10063207
793 Ga0105239_10006939
794 Ga0105239_10015207
795 Ga0105239_10017943
796 Ga0105239_10144887
797 Ga0105246_10087859
798 Ga0105246_10187713
799 Ga0157369_10120374
800 Ga0157369_10748579
801 Ga0157378_10006852
802 Ga0157378_10160145
803 Ga0163162_10011274
804 Ga0163162_10371926
805 Ga0163162_10821463
806 Ga0157372_10005875
807 Ga0157372_10252325
808 Ga0157375_10001189
809 Ga0163163_10014123
810 Ga0163163_10043279
811 Ga0157380_10000311
812 Ga0157379_10056011
813 Ga0157379_10624216
814 Ga0157379_10675634
815 Ga0163161_10000438
816 Ga0213876_10009034
817 Ga0213876_10011660
818 Ga0213875_10008727
819 Ga0213875_10029213
820 Ga0209673_1007947
821 Ga0209051_1000328
822 Ga0209051_1000495
823 Ga0209051_1001554
824 Ga0209051_1023171
825 Ga0209051_1025590
826 Ga0209051_1074166
827 Ga0207696_1046433
828 Ga0207692_10000508
829 Ga0207692_10001211
830 Ga0207642_10000444
831 Ga0207642_10157349
832 Ga0207710_10000033
833 Ga0207710_10140503
834 Ga0207688_10000419
835 Ga0207688_10003935
836 Ga0207688_10305177
837 Ga0207680_10039053
838 Ga0207685_10005257
839 Ga0207699_10159427
840 Ga0207645_10008542
841 Ga0207645_10179380
842 Ga0207643_10317542
843 Ga0207671_10004366
844 Ga0207671_10004823
845 Ga0207693_10003367
846 Ga0207693_10008209
847 Ga0207693_10062064
848 Ga0207663_10003894
849 Ga0207663_10010186
850 Ga0207663_10019279
851 Ga0207663_10095469
852 Ga0207660_10080468
853 Ga0207662_10038644
854 Ga0207652_10314442
855 Ga0207681_10001320
856 Ga0207681_10097910
857 Ga0207694_10236913
858 Ga0207687_10001562
859 Ga0207700_10000423
860 Ga0207664_10000246
861 Ga0207644_10031774
862 Ga0207644_10061406
863 Ga0207706_10023699
864 Ga0207706_10037189
865 Ga0207686_10185657
866 Ga0207669_10000871
867 Ga0207669_10093928
868 Ga0207704_10004808
869 Ga0207665_10000253
870 Ga0207665_10012970
871 Ga0207665_10016469
872 Ga0207691_10106006
873 Ga0207711_10000390
874 Ga0207711_10027536
875 Ga0207711_10042329
876 Ga0207711_10357960
877 Ga0207689_10007162
878 Ga0207689_10015324
879 Ga0207661_10448197
880 Ga0207667_10438810
881 Ga0207651_10109393
882 Ga0207712_10000005
883 Ga0207712_10022437
884 Ga0207712_10032994
885 Ga0207668_10000367
886 Ga0207668_10003927
887 Ga0207668_10036636
888 Ga0207668_10147104
889 Ga0207668_10305587
890 Ga0207640_10001703
891 Ga0207658_10000299
892 Ga0207658_10002731
893 Ga0207658_10028316
894 Ga0207658_10054722
895 Ga0207658_10095028
896 Ga0207658_10117215
897 Ga0207658_10348145
898 Ga0207677_10026596
899 Ga0207677_10193263
900 Ga0207677_10240891
901 Ga0207703_10022185
902 Ga0207703_10047718
903 Ga0207639_10057523
904 Ga0207639_10067553
905 Ga0207639_10085493
906 Ga0207639_10335686
907 Ga0207678_10003843
908 Ga0207678_10013274
909 Ga0207678_10013643
910 Ga0207678_10177086
911 Ga0207708_10010776
912 Ga0207708_10042213
913 Ga0207702_10213349
914 Ga0207641_10003252
915 Ga0207641_10030028
916 Ga0207648_10003875
917 Ga0207648_10005009
918 Ga0207648_10801851
919 Ga0207675_100001197
920 Ga0207675_100078589
921 Ga0207675_100258643
922 Ga0207675_100680148
923 Ga0207683_10087941
924 Ga0207683_10135750
925 Ga0268266_10004568
926 Ga0268266_10010168
927 Ga0268266_10071927
928 Ga0268265_10000022
929 Ga0268265_10031049
930 Ga0268265_10091227
931 Ga0268264_10000005
932 Ga0268264_10007501
933 Ga0268264_10268936
934 Ga0268264_10370219
935 Ga0265327_10000690
936 Ga0265327_10014744
937 Ga0316578_10142310
938 Ga0307413_10022562
939 Ga0307410_10040797
940 Ga0307407_10111184
941 Ga0307407_10163814
942 Ga0307409_100010907
943 Ga0307409_100273172
944 Ga0307416_100200321
945 Ga0307416_100815811
946 Ga0307414_10242165
947 Ga0307415_100005581
948 Ga0316583_10061156
949 Ga0373929_0044939
950 Ga0373949_0025414
951 Ga0373960_0032050
952 Ga0373942_0034042
953 Ga0373962_0068995
954 Ga0373931_0126356
955 Ga0373931_0133695
956 Ga0436364_0134803
957 Ga0436364_0529249
958 Ga0436364_1230402
959 Ga0436364_1361321
960 Ga0436365_0133306
961 Ga0436365_0393632
962 Ga0436365_0788541
963 Ga0436365_1786979
964 Ga0436360_0999311
965 Ga0436361_0300336
966 Ga0436363_0202621
967 Ga0436363_0706973
968 Ga0436363_1680582
969 Ga0439466_0002725
970 Ga0439466_0051325
971 Ga0439465_0000360
972 Ga0439465_0008694
973 Ga0439465_0033574
974 Ga0451789_1271276
975 Ga0451793_0915949
976 Ga0439431_0003322
977 Ga0439431_0008704
978 Ga0439445_0001784
979 Ga0439445_0028283
980 Ga0439448_0003342
981 Ga0439434_0017423
982 Ga0439434_0056794
983 Ga0439459_0008329
984 Ga0466969_0056926
985 Ga0466969_0191019
986 Ga0466972_0003356
987 Ga0466972_0019943
988 Ga0466972_0041164
989 Ga0466972_0089071
990 Ga0466965_0008126
991 Ga0466965_0014115
992 Ga0466965_0033741
993 Ga0466965_0139817
994 Ga0466966_0004917
995 Ga0466966_0013763
996 Ga0466961_0002498
997 Ga0466961_0004678
998 Ga0466963_0019045
999 Ga0466963_0033347
1000 Ga0466963_0046204
1001 Ga0466963_0071076
1002 Ga0466963_0135753
1003 Ga0466963_0149796
1004 Ga0466963_0363174
1005 Ga0466971_0027173
1006 Ga0466968_0001088
1007 Ga0466968_0004504
1008 Ga0466968_0051903
1009 Ga0466970_0007456
1010 Ga0466970_0013966
1011 Ga0466970_0022282
1012 Ga0466970_0339610
1013 Ga0466957_0003089
1014 Ga0466957_0007005
1015 Ga0466957_0146201
1016 Ga0466960_0008793
1017 Ga0466960_0050384
1018 Ga0466960_0105088
1019 Ga0466959_0003322
1020 Ga0466959_0035075
1021 Ga0466959_0046857
1022 Ga0466959_0186589
1023 Ga0466958_0002748
1024 Ga0466958_0041371
1025 Ga0466967_0022311
1026 Ga0466967_0102269
1027 Ga0466967_0223533
1028 Ga0466967_0233827
1029 Ga0466967_0274379
1030 Ga0466967_0647685
1031 Ga0495629_0024641
1032 Ga0495638_0029099
1033 Ga0495638_0041968
1034 Ga0495641_0028997
1035 Ga0495639_0021635
1036 Ga0495594_0401566
1037 Ga0495606_0063107
1038 Ga0495628_0057451
1039 Ga0495630_0134744
1040 Ga0495640_0019594
1041 Ga0495586_0155039
1042 Ga0495668_0022852
1043 Ga0495611_0016219
1044 Ga0495624_0148515
1045 Ga0495671_0125403
1046 Ga0495581_0028358
1047 Ga0495672_0005443
1048 Ga0495673_0003890
1049 Ga0495686_0002730
1050 Ga0496100_0000608
1051 Ga0496100_0002549
1052 Ga0496100_0004828
1053 Ga0496100_0005877
1054 Ga0496100_0168360
1055 Ga0496101_0000002
1056 Ga0496101_0000118
1057 Ga0496101_0000257
1058 Ga0496101_0003088
1059 Ga0496101_0066944
1060 Ga0496101_0229008
1061 Ga0496102_0000003
1062 Ga0496102_0000449
1063 Ga0496102_0001144
1064 Ga0496102_0022005
1065 Ga0496102_0023733
1066 Ga0496102_0024246
1067 Ga0496102_0030295
1068 Ga0496102_0037947
1069 Ga0496102_0042824
1070 Ga0496102_0257713
1071 Ga0496102_0772397
1072 Ga0496103_0000014
1073 Ga0496103_0000515
1074 Ga0496103_0001682
1075 Ga0496103_0002601
1076 Ga0496103_0046690
1077 Ga0496103_0048947
1078 Ga0496104_0000393
1079 Ga0496104_0025610
1080 Ga0496104_0475610
1081 Ga0496104_0608410
1082 Ga0496105_0008164
1083 Ga0496105_0049593
1084 Ga0496106_0001146
1085 Ga0496106_0001338
1086 Ga0496106_0002241
1087 Ga0496106_0015422
1088 Ga0496106_0033810
1089 Ga0496106_0115421
1090 Ga0496107_0000106
1091 Ga0496107_0000276
1092 Ga0496107_0008806
1093 Ga0496107_0009400
1094 Ga0496107_0247028
1095 Ga0496108_0008469
1096 Ga0496108_0077212
1097 Ga0496108_0118488
1098 Ga0496108_0203708
1099 Ga0496109_0000077
1100 Ga0496109_0007105
1101 Ga0496109_0009146
1102 Ga0496109_0452386
1103 Ga0496110_0036998
1104 Ga0496110_0060478
1105 Ga0496110_0252140
1106 Ga0496112_0032298
1107 Ga0496112_0033245
1108 Ga0496112_0632521
1109 Ga0496113_0029412
1110 Ga0496114_0000446
1111 Ga0496114_0019626
1112 Ga0496114_0307659
1113 Ga0496114_0513900
1114 Ga0496115_0000841
1115 Ga0496115_0011790
1116 Ga0496115_0041074
1117 Ga0496116_0000071
1118 Ga0496116_0036636
1119 Ga0496116_0056816
1120 Ga0496117_0000003
1121 Ga0496117_0000417
1122 Ga0496117_0027950
1123 Ga0496118_0000001
1124 Ga0496118_0000350
1125 Ga0496118_0002093
1126 Ga0496118_0044144
1127 Ga0496119_0000880
1128 Ga0496119_0001473
1129 Ga0496119_0016401
1130 Ga0496120_0000157
1131 Ga0496120_0002191
1132 Ga0496121_0000002
1133 Ga0496121_0000019
1134 Ga0496121_0007338
1135 Ga0496122_0000051
1136 Ga0496122_0030057
1137 Ga0496123_0018252
1138 Ga0496124_0000002
1139 Ga0496125_0000002
1140 Ga0496125_0086529
1141 Ga0496126_0000011
1142 Ga0496126_0000186
1143 Ga0496126_0009101
1144 Ga0496126_0009912
1145 Ga0496126_0086408
1146 Ga0495682_0084920
1147 Ga0501032_0019381
1148 Ga0501032_0029549
1149 Ga0501032_0141461
1150 Ga0501034_0001377
1151 Ga0501034_0005081
1152 Ga0501034_0106962
1153 Ga0501034_0705337
1154 Ga0501036_0040979
1155 Ga0501037_0001541
1156 Ga0501039_0001154
1157 Ga0501043_0002601
1158 Ga0501046_0011076
1159 Ga0501046_0440334
1160 Ga0501047_0017748
1161 Ga0501047_0018744
1162 Ga0501047_0051154
1163 Ga0501047_0269855
1164 Ga0501047_0306601
1165 Ga0501048_0002589
1166 Ga0501067_0200424
1167 Ga0501069_0032380
1168 Ga0501069_0089108
1169 Ga0501070_0000598
1170 Ga0501070_0020478
1171 Ga0501070_0079803
1172 Ga0501070_0194136
1173 Ga0501073_0025704
1174 Ga0501077_0074186
1175 Ga0501080_0023304
1176 Ga0501080_0099293
1177 Ga0501080_0187284
1178 Ga0501035_0003175
1179 Ga0501035_0025913
1180 Ga0501044_0003864
1181 Ga0501044_0005126
1182 Ga0501044_0005857
1183 Ga0501044_0028145
1184 nmdc:mga03683_246657_c1
1185 nmdc:mga03683_31612_c1
1186 nmdc:mga03n38_1283_c1
1187 nmdc:mga03n38_162412_c1
1188 nmdc:mga03n38_216468_c1
1189 nmdc:mga03n38_250836_c1
1190 nmdc:mga03n38_32335_c1
1191 nmdc:mga00v17_1409_c1
1192 nmdc:mga00v17_173310_c1
1193 nmdc:mga00v17_2741_c1
1194 nmdc:mga00v17_57542_c1
1195 nmdc:mga0yw44_13925_c1
1196 nmdc:mga0yw44_20597_c1
1197 nmdc:mga0yw44_25213_c1
1198 nmdc:mga0yw44_31923_c1
1199 nmdc:mga06z11_10047_c1
1200 nmdc:mga07m45_214448_c1
1201 nmdc:mga07m45_64782_c1
1202 nmdc:mga07m45_7319_c1
1203 nmdc:mga07m45_7367_c1
1204 nmdc:mga07m45_81207_c1
1205 nmdc:mga05p37_208080_c1
1206 nmdc:mga0qj67_22815_c1
1207 nmdc:mga06r32_77693_c1
1208 nmdc:mga0sz30_33903_c1
1209 nmdc:mga0sz30_45828_c1
1210 nmdc:mga0sz30_69806_c1
1211 nmdc:mga0sz30_79219_c1
1212 nmdc:mga0sz30_866_c1
1213 Ga0500610_0027251
1214 Ga0500635_0027887
1215 Ga0495619_0319280
1216 Ga0500643_003393
1217 Ga0500643_043171
1218 Ga0500556_0018904
1219 Ga0500652_000732
1220 Ga0500616_0011313
1221 Ga0500627_0056093
1222 Ga0500645_003598
1223 Ga0466962_0041180
1224 2644489902
1225 2644635512
1226 2738707524
1227 2739334013
1228 2842136952
1229 2902793273
1230 2902802859
1231 2902813459
1232 2902841527
1233 2929214006
1234 2939587808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

45

135

0.96

PF13649

Methyltransf_25

Methyltransferase domain

44

131

0.93

PF13489

Methyltransf_23

Methyltransferase domain

21

166

0.81

PF08242

Methyltransf_12

Methyltransferase domain

45

133

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oqe-assembly1.cif.gz_A crystal structure of the tylm1 n,n-dimethyltransferase in complex with sah and tdp-fuc3nme 0.8722 47 141
6m82-assembly1.cif.gz_A crystal structure of tylm1 y14paf bound to sah and dtdp-phenol 0.8706 45 141
3i9f-assembly1.cif.gz_B crystal structure of a putative type 11 methyltransferase from sulfolobus solfataricus 0.8248 50 151
6m83-assembly1.cif.gz_A-2 crystal structure of tylm1 s120a bound to sah and dtdp-phenol 0.8137 19 141
3g5t-assembly1.cif.gz_A crystal structure of trans-aconitate 3-methyltransferase from yeast 0.8122 24 251
ID Description Score Start End Superfamily
af_P9WK01_14_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9706 23 235 3.40.50.150
af_P9WK01_14_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9574 23 235 3.40.50.150
af_A0A1D6MWB7_118_238_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9467 49 86 3.40.50.150
af_Q4DGB0_458_609_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9295 59 95 3.40.50.1010
af_A0A1D6FP61_65_209_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8825 48 94 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1N0HLK6-F1-model_v4 deleted 0.9711 76 250
AF-A0A852YDR3-F1-model_v4 SAM-dependent methyltransferase 0.9496 18 251 GO:0008757
GO:0032259
AF-A0A327TAF6-F1-model_v4 Uncharacterized protein 0.9451 177 248
AF-A0A7K0A6X5-F1-model_v4 Methyltransferase domain-containing protein 0.9432 20 251 GO:0008757
GO:0032259
AF-A0A6N9YQ40-F1-model_v4 Class I SAM-dependent methyltransferase 0.9396 49 137 GO:0008168
GO:0032259

Map