F469644

General Info

Members Datasets Scaffolds Average Seq Length
617 286 617 156

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_11105266|Ga0207681_111052661
Length 177
Sequence MSVFVNAGRHWYVTKLNLSIMKQRVNYYEKGFKAIRPLFNLGAYLSKSPIEQSLLDLLSFRVSQINGCAYCLDMHSKDLRAHGETEQRLYMLDAWREAPLYTDRERAALAWAEAVTRLEKNNVPDDVYEQALTEFSEEELVDLTMAVNGINSWNRLNVAFQTPAGDYVPGQHAALVS

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
168 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
204 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
205 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
270 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
281 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
282 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
283 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
284 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
285 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0
Rhizoplane 2.59
Rhizosphere 94.33
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10108963 3300003322 Bacteria 6913
2 rootH1_10039019 3300003323 Bacteria 22093
3 Ga0065712_10574782 3300005290 Bacteria 604
4 Ga0070676_10518284 3300005328 Bacteria 849
5 Ga0070683_100008457 3300005329 Bacteria 8744
6 Ga0070683_100009334 3300005329 Bacteria 8384
7 Ga0070683_100159810 3300005329 Bacteria 2137
8 Ga0070683_100350869 3300005329 Bacteria 1405
9 Ga0070683_100598883 3300005329 Unclassified 1055
10 Ga0070683_100755779 3300005329 Bacteria 931
11 Ga0070683_100780607 3300005329 Bacteria 915
12 Ga0070690_101369986 3300005330 Unclassified 568
13 Ga0070670_100044499 3300005331 Bacteria 3817
14 Ga0070670_100149869 3300005331 Unclassified 2019
15 Ga0068869_100004563 3300005334 Bacteria 8627
16 Ga0068869_100144297 3300005334 Bacteria 1841
17 Ga0068869_101224435 3300005334 Bacteria 660
18 Ga0070666_10507878 3300005335 Bacteria 874
19 Ga0070680_100719430 3300005336 Bacteria 859
20 Ga0070682_100940450 3300005337 Bacteria 713
21 Ga0068868_100136128 3300005338 Unclassified 2014
22 Ga0068868_100636693 3300005338 Bacteria 948
23 Ga0070660_100016825 3300005339 Bacteria 5319
24 Ga0070689_100331625 3300005340 Unclassified 1273
25 Ga0070689_100404122 3300005340 Bacteria 1155
26 Ga0070689_100440698 3300005340 Bacteria 1107
27 Ga0070687_100567922 3300005343 Bacteria 774
28 Ga0070661_100002712 3300005344 Bacteria 12141
29 Ga0070661_100032923 3300005344 Unclassified 3754
30 Ga0070661_100037766 3300005344 Bacteria 3514
31 Ga0070661_100125931 3300005344 Bacteria 1922
32 Ga0070675_100391475 3300005354 Unclassified 1238
33 Ga0070675_100412247 3300005354 Bacteria 1207
34 Ga0070671_100530996 3300005355 Bacteria 1014
35 Ga0070673_100180459 3300005364 Bacteria 1807
36 Ga0070673_100497668 3300005364 Bacteria 1102
37 Ga0070688_100142140 3300005365 Bacteria 1632
38 Ga0070659_100010732 3300005366 Bacteria 6751
39 Ga0070659_100141447 3300005366 Unclassified 1959
40 Ga0070667_100202460 3300005367 Bacteria 1762
41 Ga0070667_100558313 3300005367 Bacteria 1053
42 Ga0070709_10840181 3300005434 Bacteria 723
43 Ga0070714_100036717 3300005435 Bacteria 4112
44 Ga0070714_100053931 3300005435 Bacteria 3434
45 Ga0070713_100002481 3300005436 Bacteria 12047
46 Ga0070713_100218040 3300005436 Bacteria 1730
47 Ga0070713_100623328 3300005436 Bacteria 1026
48 Ga0070701_10199215 3300005438 Bacteria 1183
49 Ga0070711_100622198 3300005439 Bacteria 903
50 Ga0070700_100045595 3300005441 Bacteria 2705
51 Ga0070700_100186904 3300005441 Bacteria 1446
52 Ga0070694_100932019 3300005444 Bacteria 718
53 Ga0070708_100226777 3300005445 Bacteria 1753
54 Ga0070663_100275927 3300005455 Bacteria 1338
55 Ga0070663_100519704 3300005455 Unclassified 991
56 Ga0070678_100169033 3300005456 Unclassified 1779
57 Ga0070662_100038573 3300005457 Unclassified 3393
58 Ga0070662_100255684 3300005457 Bacteria 1410
59 Ga0070662_100666216 3300005457 Bacteria 879
60 Ga0070662_100784822 3300005457 Bacteria 809
61 Ga0068867_100307440 3300005459 Bacteria 1309
62 Ga0068867_100507189 3300005459 Bacteria 1038
63 Ga0070685_10270745 3300005466 Bacteria 1133
64 Ga0070706_100005867 3300005467 Bacteria 11645
65 Ga0070707_100004630 3300005468 Bacteria 12875
66 Ga0070698_100010297 3300005471 Bacteria 9983
67 Ga0070698_100076895 3300005471 Unclassified 3339
68 Ga0070698_100606745 3300005471 Bacteria 1035
69 Ga0070698_101113685 3300005471 Bacteria 738
70 Ga0070699_100465083 3300005518 Bacteria 1147
71 Ga0070679_100120267 3300005530 Bacteria 2611
72 Ga0070679_100362678 3300005530 Bacteria 1396
73 Ga0070684_100000866 3300005535 Bacteria 21424
74 Ga0070684_100005712 3300005535 Bacteria 9555
75 Ga0070684_100019112 3300005535 Bacteria 5664
76 Ga0070684_100124582 3300005535 Bacteria 2320
77 Ga0070684_100156853 3300005535 Bacteria 2064
78 Ga0070684_100215665 3300005535 Bacteria 1750
79 Ga0070684_101704559 3300005535 Bacteria 595
80 Ga0068853_100007014 3300005539 Bacteria 9005
81 Ga0068853_100009281 3300005539 Bacteria 7933
82 Ga0068853_100039529 3300005539 Bacteria 4024
83 Ga0068853_100055051 3300005539 Bacteria 3428
84 Ga0068853_100171621 3300005539 Bacteria 1962
85 Ga0068853_100416470 3300005539 Bacteria 1259
86 Ga0068853_101302452 3300005539 Bacteria 702
87 Ga0070672_100279205 3300005543 Unclassified 1412
88 Ga0070695_100890007 3300005545 Bacteria 718
89 Ga0070695_100906054 3300005545 Unclassified 712
90 Ga0070693_100879314 3300005547 Bacteria 670
91 Ga0070665_100531980 3300005548 Bacteria 1187
92 Ga0070665_101153613 3300005548 Bacteria 786
93 Ga0070704_102092984 3300005549 Bacteria 526
94 Ga0068855_100013376 3300005563 Bacteria 9898
95 Ga0068855_100019058 3300005563 Bacteria 8249
96 Ga0068855_100057107 3300005563 Bacteria 4576
97 Ga0068855_100085417 3300005563 Bacteria 3651
98 Ga0068855_100311330 3300005563 Bacteria 1742
99 Ga0068855_101204706 3300005563 Bacteria 787
100 Ga0070664_100001013 3300005564 Bacteria 22070
101 Ga0070664_100001091 3300005564 Bacteria 21403
102 Ga0070664_100030545 3300005564 Bacteria 4496
103 Ga0070664_100071638 3300005564 Bacteria 2970
104 Ga0070664_100096829 3300005564 Unclassified 2561
105 Ga0070664_101084175 3300005564 Unclassified 754
106 Ga0068857_100003966 3300005577 Bacteria 12461
107 Ga0068857_100029668 3300005577 Bacteria 4827
108 Ga0068857_100035926 3300005577 Bacteria 4390
109 Ga0068857_100190602 3300005577 Bacteria 1867
110 Ga0068857_100278147 3300005577 Bacteria 1539
111 Ga0068857_100297688 3300005577 Bacteria 1487
112 Ga0068857_100498659 3300005577 Bacteria 1142
113 Ga0068854_100004399 3300005578 Bacteria 8890
114 Ga0068854_100013235 3300005578 Bacteria 5407
115 Ga0068854_100174763 3300005578 Bacteria 1673
116 Ga0068854_100395923 3300005578 Bacteria 1142
117 Ga0068854_100643426 3300005578 Bacteria 910
118 Ga0068856_100004251 3300005614 Bacteria 14300
119 Ga0068856_100044482 3300005614 Bacteria 4371
120 Ga0068856_100055230 3300005614 Bacteria 3919
121 Ga0068856_100062875 3300005614 Bacteria 3667
122 Ga0068856_100115026 3300005614 Bacteria 2689
123 Ga0068856_100554271 3300005614 Bacteria 1171
124 Ga0068856_100690751 3300005614 Bacteria 1041
125 Ga0068856_100782045 3300005614 Bacteria 974
126 Ga0068852_100002382 3300005616 Bacteria 12948
127 Ga0068852_100024160 3300005616 Bacteria 4908
128 Ga0068852_100070073 3300005616 Bacteria 3075
129 Ga0068852_100492678 3300005616 Bacteria 1219
130 Ga0068852_100869714 3300005616 Bacteria 917
131 Ga0068859_100116618 3300005617 Bacteria 2735
132 Ga0068859_100137080 3300005617 Bacteria 2521
133 Ga0068859_100155691 3300005617 Unclassified 2362
134 Ga0068859_100291569 3300005617 Bacteria 1725
135 Ga0068859_100551144 3300005617 Bacteria 1247
136 Ga0068859_100784776 3300005617 Bacteria 1041
137 Ga0068864_100039887 3300005618 Unclassified 4014
138 Ga0068864_100578909 3300005618 Bacteria 1088
139 Ga0068864_100657608 3300005618 Bacteria 1021
140 Ga0068861_100040137 3300005719 Bacteria 3498
141 Ga0068861_100048268 3300005719 Bacteria 3217
142 Ga0068861_100992394 3300005719 Bacteria 801
143 Ga0068851_10008128 3300005834 Bacteria 4842
144 Ga0068851_10022338 3300005834 Bacteria 3080
145 Ga0068863_100395505 3300005841 Bacteria 1351
146 Ga0068863_100567498 3300005841 Bacteria 1121
147 Ga0068858_100170097 3300005842 Bacteria 2054
148 Ga0068858_100841792 3300005842 Bacteria 896
149 Ga0068860_100010741 3300005843 Bacteria 9039
150 Ga0068862_100081350 3300005844 Bacteria 2810
151 Ga0068862_100545506 3300005844 Unclassified 1106
152 Ga0081538_10009408 3300005981 Bacteria 8164
153 Ga0081538_10124458 3300005981 Bacteria 1230
154 Ga0070717_10000329 3300006028 Bacteria 30746
155 Ga0070717_10592057 3300006028 Bacteria 1006
156 Ga0070717_11489515 3300006028 Bacteria 614
157 Ga0075368_10042008 3300006042 Bacteria 1798
158 Ga0070712_100852315 3300006175 Bacteria 784
159 Ga0070712_100865779 3300006175 Bacteria 778
160 Ga0075366_10570920 3300006195 Bacteria 701
161 Ga0075366_10679661 3300006195 Bacteria 639
162 Ga0097621_100034307 3300006237 Bacteria 4047
163 Ga0068871_100111737 3300006358 Bacteria 2299
164 Ga0068871_100174289 3300006358 Bacteria 1845
165 Ga0068871_100237352 3300006358 Bacteria 1584
166 Ga0068871_100488112 3300006358 Bacteria 1109
167 Ga0075428_100057010 3300006844 Bacteria 4278
168 Ga0075428_100973148 3300006844 Bacteria 899
169 Ga0075430_101034412 3300006846 Bacteria 677
170 Ga0075429_100017742 3300006880 Bacteria 6154
171 Ga0068865_100283048 3300006881 Bacteria 1321
172 Ga0068865_101202321 3300006881 Bacteria 671
173 Ga0068865_101993136 3300006881 Unclassified 527
174 Ga0075436_100020045 3300006914 Bacteria 4589
175 Ga0097620_100116618 3300006931 Bacteria 2735
176 Ga0097620_100137076 3300006931 Bacteria 2521
177 Ga0097620_100155703 3300006931 Unclassified 2362
178 Ga0097620_100291579 3300006931 Bacteria 1725
179 Ga0097620_100551141 3300006931 Bacteria 1247
180 Ga0097620_100784798 3300006931 Bacteria 1041
181 Ga0075435_100691635 3300007076 Bacteria 886
182 Ga0105240_10004314 3300009093 Bacteria 21713
183 Ga0105240_10015110 3300009093 Bacteria 10508
184 Ga0105240_10026349 3300009093 Bacteria 7627
185 Ga0105240_10117551 3300009093 Bacteria 3205
186 Ga0105240_10186224 3300009093 Bacteria 2445
187 Ga0105240_10288061 3300009093 Bacteria 1884
188 Ga0105240_10484418 3300009093 Bacteria 1378
189 Ga0105240_11030582 3300009093 Bacteria 879
190 Ga0111539_10583424 3300009094 Bacteria 1302
191 Ga0111539_12398453 3300009094 Bacteria 612
192 Ga0105247_10007691 3300009101 Bacteria 6594
193 Ga0105247_10035454 3300009101 Bacteria 3041
194 Ga0114129_11477144 3300009147 Bacteria 836
195 Ga0105241_10009831 3300009174 Bacteria 7030
196 Ga0105241_10078395 3300009174 Bacteria 2581
197 Ga0105241_10114327 3300009174 Bacteria 2165
198 Ga0105241_10131077 3300009174 Bacteria 2030
199 Ga0105241_10256564 3300009174 Bacteria 1485
200 Ga0105241_10378856 3300009174 Bacteria 1236
201 Ga0105241_11140417 3300009174 Bacteria 736
202 Ga0105242_10069851 3300009176 Bacteria 2910
203 Ga0105248_10648470 3300009177 Bacteria 1191
204 Ga0105248_10915646 3300009177 Unclassified 990
205 Ga0105248_12162708 3300009177 Bacteria 633
206 Ga0105248_12673506 3300009177 Bacteria 569
207 Ga0105237_10035169 3300009545 Bacteria 5070
208 Ga0105237_10089762 3300009545 Bacteria 3062
209 Ga0105237_10107704 3300009545 Bacteria 2779
210 Ga0105237_10161812 3300009545 Bacteria 2237
211 Ga0105237_10240538 3300009545 Bacteria 1811
212 Ga0105237_10744899 3300009545 Bacteria 986
213 Ga0105238_10001137 3300009551 Bacteria 26839
214 Ga0105238_10008597 3300009551 Bacteria 10215
215 Ga0105238_10031322 3300009551 Bacteria 5413
216 Ga0105238_10101023 3300009551 Bacteria 2867
217 Ga0105238_10669675 3300009551 Bacteria 1049
218 Ga0105249_10003199 3300009553 Bacteria 14176
219 Ga0105249_10009092 3300009553 Bacteria 8688
220 Ga0105249_10045511 3300009553 Bacteria 3992
221 Ga0105249_10500425 3300009553 Bacteria 1260
222 Ga0105249_10612081 3300009553 Bacteria 1145
223 Ga0099796_10042712 3300010159 Bacteria 1541
224 Ga0105239_10016514 3300010375 Bacteria 8164
225 Ga0105239_10036415 3300010375 Bacteria 5402
226 Ga0105239_10090452 3300010375 Bacteria 3377
227 Ga0105239_10273515 3300010375 Bacteria 1900
228 Ga0105246_10145866 3300011119 Bacteria 1785
229 Ga0105246_10270137 3300011119 Bacteria 1359
230 Ga0105246_10480388 3300011119 Bacteria 1051
231 Ga0157373_10004071 3300013100 Bacteria 11016
232 Ga0157373_10186025 3300013100 Bacteria 1463
233 Ga0157373_10411871 3300013100 Bacteria 970
234 Ga0157371_10370173 3300013102 Bacteria 1045
235 Ga0157370_10013002 3300013104 Bacteria 8598
236 Ga0157370_10139812 3300013104 Bacteria 2256
237 Ga0157370_10432869 3300013104 Bacteria 1210
238 Ga0157369_10007484 3300013105 Bacteria 12567
239 Ga0157369_10163239 3300013105 Bacteria 2350
240 Ga0157369_10392689 3300013105 Bacteria 1439
241 Ga0157369_10796371 3300013105 Bacteria 971
242 Ga0157369_10842600 3300013105 Bacteria 941
243 Ga0157374_10006243 3300013296 Bacteria 10106
244 Ga0157374_10036265 3300013296 Bacteria 4515
245 Ga0157374_10197673 3300013296 Bacteria 1968
246 Ga0157374_10272124 3300013296 Bacteria 1670
247 Ga0157374_11369855 3300013296 Bacteria 730
248 Ga0157378_10111222 3300013297 Bacteria 2511
249 Ga0157378_10774444 3300013297 Unclassified 984
250 Ga0157378_11082950 3300013297 Bacteria 838
251 Ga0163162_10147148 3300013306 Unclassified 2472
252 Ga0163162_10273412 3300013306 Bacteria 1821
253 Ga0163162_10342250 3300013306 Unclassified 1628
254 Ga0163162_12751498 3300013306 Unclassified 566
255 Ga0157372_10006264 3300013307 Bacteria 12657
256 Ga0157372_10260709 3300013307 Bacteria 2013
257 Ga0157372_10549602 3300013307 Bacteria 1346
258 Ga0157372_10710172 3300013307 Bacteria 1170
259 Ga0157372_13141710 3300013307 Unclassified 527
260 Ga0157375_10018953 3300013308 Bacteria 6247
261 Ga0157375_10073852 3300013308 Bacteria 3430
262 Ga0163163_10005024 3300014325 Bacteria 11401
263 Ga0163163_10041679 3300014325 Bacteria 4491
264 Ga0163163_10596340 3300014325 Bacteria 1168
265 Ga0163163_11219135 3300014325 Unclassified 815
266 Ga0157380_10209597 3300014326 Bacteria 1735
267 Ga0157379_10162118 3300014968 Bacteria 2018
268 Ga0157379_10203809 3300014968 Unclassified 1789
269 Ga0157379_10391773 3300014968 Bacteria 1276
270 Ga0157379_10440606 3300014968 Unclassified 1201
271 Ga0157376_11023168 3300014969 Bacteria 849
272 Ga0157376_11367824 3300014969 Bacteria 739
273 Ga0163161_10137955 3300017792 Bacteria 1845
274 Ga0197907_10787107 3300020069 Bacteria 674
275 Ga0206356_10132939 3300020070 Bacteria 696
276 Ga0213872_10252446 3300021361 Bacteria 743
277 Ga0207697_10035593 3300025315 Bacteria 2038
278 Ga0207692_10115034 3300025898 Bacteria 1498
279 Ga0207710_10002424 3300025900 Bacteria 8684
280 Ga0207710_10034330 3300025900 Bacteria 2228
281 Ga0207710_10476052 3300025900 Unclassified 646
282 Ga0207680_10404464 3300025903 Bacteria 965
283 Ga0207647_10000685 3300025904 Bacteria 26588
284 Ga0207647_10042037 3300025904 Unclassified 2870
285 Ga0207647_10548496 3300025904 Unclassified 641
286 Ga0207685_10235209 3300025905 Bacteria 878
287 Ga0207699_10306216 3300025906 Bacteria 1111
288 Ga0207699_10440680 3300025906 Bacteria 933
289 Ga0207699_10617645 3300025906 Bacteria 790
290 Ga0207699_10668940 3300025906 Bacteria 759
291 Ga0207645_10091003 3300025907 Bacteria 1962
292 Ga0207645_10640039 3300025907 Bacteria 722
293 Ga0207705_10021706 3300025909 Bacteria 4580
294 Ga0207705_10471162 3300025909 Bacteria 975
295 Ga0207684_10107810 3300025910 Bacteria 2383
296 Ga0207654_10076140 3300025911 Bacteria 2007
297 Ga0207654_10139945 3300025911 Bacteria 1542
298 Ga0207654_10212393 3300025911 Bacteria 1279
299 Ga0207707_10000570 3300025912 Bacteria 37419
300 Ga0207707_10211437 3300025912 Bacteria 1689
301 Ga0207707_10260093 3300025912 Bacteria 1506
302 Ga0207695_10020606 3300025913 Bacteria 7549
303 Ga0207695_10021907 3300025913 Bacteria 7274
304 Ga0207695_10046485 3300025913 Bacteria 4602
305 Ga0207695_10059410 3300025913 Bacteria 3964
306 Ga0207695_10153320 3300025913 Bacteria 2241
307 Ga0207695_10156005 3300025913 Bacteria 2217
308 Ga0207671_10053393 3300025914 Bacteria 2994
309 Ga0207671_10103648 3300025914 Bacteria 2157
310 Ga0207671_10129941 3300025914 Bacteria 1933
311 Ga0207671_11102178 3300025914 Bacteria 624
312 Ga0207693_10183371 3300025915 Bacteria 1647
313 Ga0207693_10477567 3300025915 Bacteria 973
314 Ga0207693_10854466 3300025915 Bacteria 700
315 Ga0207663_10372211 3300025916 Bacteria 1086
316 Ga0207660_10012565 3300025917 Bacteria 5545
317 Ga0207657_10007975 3300025919 Bacteria 10794
318 Ga0207649_10005003 3300025920 Bacteria 7165
319 Ga0207649_10010573 3300025920 Bacteria 5076
320 Ga0207649_10023904 3300025920 Unclassified 3545
321 Ga0207649_10357769 3300025920 Bacteria 1082
322 Ga0207652_10053166 3300025921 Bacteria 3478
323 Ga0207652_10101259 3300025921 Bacteria 2544
324 Ga0207652_10164834 3300025921 Bacteria 1987
325 Ga0207652_10357636 3300025921 Bacteria 1318
326 Ga0207646_10013658 3300025922 Bacteria 7756
327 Ga0207681_11105266 3300025923 Unclassified 666
328 Ga0207694_10004254 3300025924 Bacteria 11217
329 Ga0207694_10573187 3300025924 Bacteria 948
330 Ga0207694_10916804 3300025924 Bacteria 741
331 Ga0207650_10406838 3300025925 Bacteria 1127
332 Ga0207650_10681030 3300025925 Bacteria 868
333 Ga0207700_10007850 3300025928 Bacteria 6562
334 Ga0207700_11459780 3300025928 Bacteria 607
335 Ga0207664_10001915 3300025929 Bacteria 13663
336 Ga0207664_10047300 3300025929 Bacteria 3378
337 Ga0207664_10413576 3300025929 Bacteria 1201
338 Ga0207644_10861302 3300025931 Unclassified 759
339 Ga0207644_10887655 3300025931 Bacteria 747
340 Ga0207644_11134706 3300025931 Bacteria 657
341 Ga0207690_10026270 3300025932 Bacteria 3666
342 Ga0207690_10074575 3300025932 Bacteria 2350
343 Ga0207690_10804679 3300025932 Bacteria 777
344 Ga0207690_10913729 3300025932 Bacteria 728
345 Ga0207706_10095679 3300025933 Bacteria 2612
346 Ga0207706_10130479 3300025933 Unclassified 2210
347 Ga0207706_10633205 3300025933 Bacteria 917
348 Ga0207706_11085158 3300025933 Unclassified 669
349 Ga0207686_10088110 3300025934 Bacteria 2043
350 Ga0207686_10598028 3300025934 Unclassified 868
351 Ga0207670_10007419 3300025936 Bacteria 6118
352 Ga0207670_10027763 3300025936 Unclassified 3584
353 Ga0207670_10465185 3300025936 Bacteria 1022
354 Ga0207670_10650303 3300025936 Bacteria 869
355 Ga0207669_11593593 3300025937 Bacteria 557
356 Ga0207704_10188645 3300025938 Unclassified 1497
357 Ga0207704_11203451 3300025938 Bacteria 646
358 Ga0207665_10484409 3300025939 Bacteria 953
359 Ga0207691_10061982 3300025940 Unclassified 3396
360 Ga0207691_10416418 3300025940 Bacteria 1145
361 Ga0207689_10003767 3300025942 Bacteria 13815
362 Ga0207689_10043742 3300025942 Bacteria 3702
363 Ga0207661_10000392 3300025944 Bacteria 28407
364 Ga0207661_10022874 3300025944 Bacteria 4714
365 Ga0207661_10051028 3300025944 Unclassified 3299
366 Ga0207661_10058236 3300025944 Bacteria 3109
367 Ga0207661_10176822 3300025944 Bacteria 1861
368 Ga0207679_10001465 3300025945 Bacteria 14786
369 Ga0207679_10001859 3300025945 Bacteria 13118
370 Ga0207679_10458710 3300025945 Bacteria 1131
371 Ga0207679_11656533 3300025945 Unclassified 586
372 Ga0207667_10031999 3300025949 Bacteria 5673
373 Ga0207667_10033361 3300025949 Bacteria 5535
374 Ga0207667_10071701 3300025949 Bacteria 3601
375 Ga0207667_10805909 3300025949 Bacteria 935
376 Ga0207667_11065841 3300025949 Bacteria 793
377 Ga0207667_11637949 3300025949 Bacteria 611
378 Ga0207712_10002412 3300025961 Bacteria 12085
379 Ga0207712_10009047 3300025961 Bacteria 6301
380 Ga0207712_10065117 3300025961 Bacteria 2600
381 Ga0207712_10280007 3300025961 Bacteria 1361
382 Ga0207712_10336921 3300025961 Bacteria 1250
383 Ga0207668_10978585 3300025972 Unclassified 755
384 Ga0207640_10011681 3300025981 Bacteria 4978
385 Ga0207640_10224805 3300025981 Bacteria 1439
386 Ga0207640_10337907 3300025981 Bacteria 1205
387 Ga0207658_10490975 3300025986 Bacteria 1092
388 Ga0207677_10017200 3300026023 Unclassified 4305
389 Ga0207677_10395374 3300026023 Bacteria 1171
390 Ga0207677_12070497 3300026023 Bacteria 529
391 Ga0207703_10072251 3300026035 Bacteria 2852
392 Ga0207703_10449464 3300026035 Bacteria 1203
393 Ga0207703_10592041 3300026035 Bacteria 1048
394 Ga0207639_10003536 3300026041 Bacteria 10494
395 Ga0207639_10006299 3300026041 Bacteria 8061
396 Ga0207639_10040707 3300026041 Bacteria 3470
397 Ga0207639_10174266 3300026041 Bacteria 1824
398 Ga0207639_10264318 3300026041 Bacteria 1506
399 Ga0207639_11141608 3300026041 Bacteria 731
400 Ga0207678_10329650 3300026067 Bacteria 1314
401 Ga0207678_10636980 3300026067 Bacteria 936
402 Ga0207708_10146882 3300026075 Bacteria 1853
403 Ga0207708_10392807 3300026075 Bacteria 1146
404 Ga0207702_10004005 3300026078 Bacteria 13233
405 Ga0207702_10044939 3300026078 Bacteria 3714
406 Ga0207702_10568936 3300026078 Bacteria 1110
407 Ga0207702_10619772 3300026078 Bacteria 1062
408 Ga0207641_10306079 3300026088 Unclassified 1503
409 Ga0207641_10625403 3300026088 Bacteria 1056
410 Ga0207641_10701429 3300026088 Bacteria 997
411 Ga0207648_10015367 3300026089 Bacteria 7043
412 Ga0207648_10338924 3300026089 Bacteria 1354
413 Ga0207676_10049620 3300026095 Unclassified 3266
414 Ga0207676_10139909 3300026095 Bacteria 2071
415 Ga0207676_10412658 3300026095 Bacteria 1265
416 Ga0207674_10004712 3300026116 Bacteria 16356
417 Ga0207674_10006966 3300026116 Bacteria 13232
418 Ga0207674_10015148 3300026116 Bacteria 8485
419 Ga0207674_10034943 3300026116 Bacteria 5249
420 Ga0207674_10044733 3300026116 Bacteria 4560
421 Ga0207674_10081159 3300026116 Bacteria 3245
422 Ga0207674_10495951 3300026116 Bacteria 1180
423 Ga0207674_11102050 3300026116 Bacteria 763
424 Ga0207675_100005780 3300026118 Bacteria 11828
425 Ga0207675_100076379 3300026118 Bacteria 3137
426 Ga0207675_101466047 3300026118 Bacteria 703
427 Ga0207675_102000917 3300026118 Unclassified 597
428 Ga0207683_11688598 3300026121 Bacteria 583
429 Ga0207698_10013808 3300026142 Bacteria 5345
430 Ga0207698_10105083 3300026142 Bacteria 2352
431 Ga0207698_10281553 3300026142 Bacteria 1538
432 Ga0207698_10501413 3300026142 Bacteria 1181
433 Ga0207698_11359374 3300026142 Bacteria 725
434 Ga0209179_1008569 3300027512 Bacteria 1727
435 Ga0209813_10047796 3300027866 Bacteria 1326
436 Ga0268266_10461551 3300028379 Bacteria 1208
437 Ga0268266_10718803 3300028379 Bacteria 963
438 Ga0268265_10058694 3300028380 Bacteria 2939
439 Ga0268264_10000447 3300028381 Bacteria 56371
440 Ga0268264_10220455 3300028381 Bacteria 1746
441 Ga0268264_10388456 3300028381 Unclassified 1338
442 Ga0265334_10047500 3300028573 Bacteria 1656
443 Ga0265330_10115955 3300031235 Bacteria 1142
444 Ga0265332_10037701 3300031238 Bacteria 2096
445 Ga0265328_10010377 3300031239 Bacteria 3753
446 Ga0265325_10012028 3300031241 Bacteria 4958
447 Ga0265325_10041753 3300031241 Bacteria 2402
448 Ga0265339_10008736 3300031249 Bacteria 6422
449 Ga0265339_10074737 3300031249 Bacteria 1800
450 Ga0307509_10078803 3300031507 Bacteria 3412
451 Ga0307509_10346687 3300031507 Bacteria 1210
452 Ga0265313_10118653 3300031595 Bacteria 1156
453 Ga0307508_10059545 3300031616 Bacteria 3378
454 Ga0307413_10066749 3300031824 Bacteria 2246
455 Ga0307410_10151098 3300031852 Bacteria 1729
456 Ga0307410_11183907 3300031852 Bacteria 665
457 Ga0307414_11559866 3300032004 Bacteria 615
458 Ga0373926_0065811 3300035083 Bacteria 1326
459 Ga0373934_0001254 3300035086 Bacteria 9244
460 Ga0373923_0002592 3300035111 Bacteria 5606
461 Ga0373923_0003206 3300035111 Bacteria 5201
462 Ga0373936_0000357 3300035113 Bacteria 15537
463 Ga0373945_0010231 3300035116 Bacteria 3086
464 Ga0373953_0001405 3300035117 Bacteria 6949
465 Ga0373953_0008757 3300035117 Bacteria 3449
466 Ga0373954_0002033 3300035118 Bacteria 8407
467 Ga0373954_0002625 3300035118 Bacteria 7566
468 Ga0373956_0001441 3300035119 Bacteria 9830
469 Ga0373957_0006390 3300035120 Bacteria 3709
470 Ga0373957_0016029 3300035120 Bacteria 2589
471 Ga0373943_0000664 3300035170 Bacteria 14926
472 Ga0373946_0001722 3300035171 Bacteria 7628
473 Ga0373955_0002159 3300035172 Bacteria 8506
474 Ga0373955_0003007 3300035172 Bacteria 7388
475 Ga0373924_0001935 3300035410 Bacteria 6884
476 Ga0373924_0007514 3300035410 Bacteria 3937
477 Ga0373935_0000224 3300035692 Bacteria 27599
478 Ga0373935_0380189 3300035692 Bacteria 1011
479 Ga0373927_0021415 3300035695 Bacteria 4237
480 Ga0373933_0000017 3300035724 Bacteria 100816
481 Ga0373933_0004005 3300035724 Bacteria 8119
482 Ga0373933_0025276 3300035724 Bacteria 3405
483 Ga0373947_0011148 3300035725 Bacteria 5162
484 Ga0373947_0093237 3300035725 Bacteria 1882
485 Ga0373937_0001096 3300036401 Bacteria 22797
486 Ga0373937_0079220 3300036401 Bacteria 3036
487 Ga0373925_0000016 3300037068 Bacteria 176830
488 Ga0395899_0682219 3300037312 Unclassified 646
489 Ga0395900_1203945 3300037418 Bacteria 673
490 Ga0395898_0107845 3300037466 Bacteria 2671
491 Ga0395905_0388339 3300037471 Bacteria 1290
492 Ga0395905_0655814 3300037471 Bacteria 951
493 Ga0395901_0095046 3300038443 Bacteria 3123
494 Ga0395901_0517507 3300038443 Bacteria 1213
495 Ga0395901_0986358 3300038443 Bacteria 819
496 Ga0436360_0205661 3300039438 Bacteria 740
497 Ga0436361_0683511 3300039447 Bacteria 932
498 Ga0451804_0654551 3300041463 Bacteria 777
499 Ga0451807_1517432 3300041486 Bacteria 1414
500 Ga0439435_0128685 3300042436 Bacteria 798
501 Ga0451577_0872651 3300042876 Bacteria 811
502 Ga0466961_0230819 3300044693 Bacteria 1139
503 Ga0466963_0464256 3300044694 Bacteria 893
504 Ga0453684_0140750 3300044712 Bacteria 2881
505 Ga0466971_0089837 3300044719 Bacteria 1406
506 Ga0466957_0379686 3300044842 Bacteria 963
507 Ga0466960_0017393 3300044901 Bacteria 3134
508 Ga0466960_0089253 3300044901 Bacteria 1568
509 Ga0466959_0110346 3300045049 Bacteria 1964
510 Ga0466959_0373679 3300045049 Bacteria 971
511 Ga0451576_1137976 3300045051 Bacteria 816
512 Ga0466958_0010359 3300045836 Bacteria 5221
513 Ga0466958_0306486 3300045836 Bacteria 1020
514 Ga0466967_1920476 3300045976 Bacteria 589
515 Ga0495592_0000658 3300046454 Bacteria 24004
516 Ga0495592_0027451 3300046454 Bacteria 4316
517 Ga0495629_0001206 3300046459 Bacteria 20341
518 Ga0495629_0011770 3300046459 Bacteria 6349
519 Ga0495651_0000253 3300046462 Bacteria 41413
520 Ga0495651_0221355 3300046462 Bacteria 1309
521 Ga0495653_0000045 3300046463 Bacteria 115410
522 Ga0495653_0007406 3300046463 Bacteria 8989
523 Ga0495580_0415803 3300046472 Bacteria 905
524 Ga0495662_0020376 3300046476 Bacteria 3207
525 Ga0495664_0000004 3300046477 Bacteria 489411
526 Ga0495664_0102623 3300046477 Bacteria 1724
527 Ga0495608_0000017 3300046511 Bacteria 192929
528 Ga0495608_0031076 3300046511 Bacteria 3612
529 Ga0495618_0000350 3300046514 Bacteria 33025
530 Ga0495628_0000001 3300046516 Bacteria 917742
531 Ga0495628_0011177 3300046516 Bacteria 7597
532 Ga0495630_0006902 3300046517 Bacteria 8095
533 Ga0495663_0044398 3300046525 Bacteria 1360
534 Ga0495652_0000002 3300046529 Bacteria 946606
535 Ga0495652_0023745 3300046529 Bacteria 5434
536 Ga0495640_0000001 3300046533 Bacteria 853827
537 Ga0495640_0080679 3300046533 Bacteria 2163
538 Ga0495587_0000008 3300046536 Bacteria 271097
539 Ga0495587_0011834 3300046536 Bacteria 5515
540 Ga0495645_0000002 3300046543 Bacteria 651644
541 Ga0495645_0019910 3300046543 Bacteria 4837
542 Ga0495667_0000029 3300046559 Bacteria 151568
543 Ga0495667_0056834 3300046559 Bacteria 2572
544 Ga0495634_0000339 3300046642 Bacteria 45231
545 Ga0495634_0012302 3300046642 Bacteria 6201
546 Ga0495625_0012614 3300046660 Bacteria 6839
547 Ga0495635_0000002 3300046663 Bacteria 490490
548 Ga0495635_0002216 3300046663 Bacteria 13218
549 Ga0495657_0000064 3300046675 Bacteria 94324
550 Ga0495657_0034350 3300046675 Bacteria 3522
551 Ga0495599_0000064 3300046678 Bacteria 73422
552 Ga0495599_0056876 3300046678 Bacteria 2447
553 Ga0495623_0000065 3300046679 Bacteria 65151
554 Ga0495623_0026792 3300046679 Bacteria 3709
555 Ga0495646_0000023 3300046680 Bacteria 110212
556 Ga0495646_0019235 3300046680 Bacteria 4325
557 Ga0495613_0017402 3300046689 Bacteria 5355
558 Ga0495613_0025125 3300046689 Bacteria 4439
559 Ga0495600_0000010 3300046809 Bacteria 143675
560 Ga0495600_0051002 3300046809 Bacteria 2700
561 Ga0495604_0000009 3300047317 Bacteria 326341
562 Ga0495604_0026169 3300047317 Bacteria 4644
563 Ga0495674_0000002 3300047319 Bacteria 642785
564 Ga0495674_0273479 3300047319 Bacteria 1385
565 Ga0495676_0630418 3300047321 Bacteria 697
566 Ga0495680_0002286 3300047322 Bacteria 19735
567 Ga0495680_0034917 3300047322 Bacteria 4055
568 Ga0495675_0000388 3300047444 Bacteria 30389
569 Ga0495675_0002252 3300047444 Bacteria 11525
570 Ga0495684_0000006 3300047471 Bacteria 247568
571 Ga0495684_0000954 3300047471 Bacteria 23525
572 Ga0495593_0003081 3300047673 Bacteria 10023
573 Ga0495593_0004012 3300047673 Bacteria 8773
574 Ga0495602_0002184 3300048088 Bacteria 19759
575 Ga0495602_0042607 3300048088 Bacteria 4133
576 Ga0496100_0347094 3300048903 Bacteria 1120
577 Ga0496105_0031676 3300048908 Bacteria 4336
578 Ga0496106_0142059 3300048909 Bacteria 1889
579 Ga0496107_0407465 3300048910 Bacteria 1011
580 Ga0496108_0736460 3300048911 Bacteria 853
581 Ga0496109_0407018 3300048912 Bacteria 1285
582 Ga0496110_0029315 3300048913 Bacteria 4735
583 Ga0496111_0302365 3300048914 Bacteria 1186
584 Ga0496112_0206704 3300048915 Bacteria 1921
585 Ga0496113_0221839 3300048916 Bacteria 1507
586 Ga0496113_0588596 3300048916 Bacteria 891
587 Ga0496114_0684657 3300048917 Bacteria 900
588 Ga0496115_0033724 3300048918 Bacteria 4043
589 Ga0496115_0072884 3300048918 Bacteria 2787
590 Ga0496121_0062150 3300048924 Bacteria 3061
591 Ga0496126_0160370 3300048929 Bacteria 1922
592 Ga0501031_0284787 3300049568 Bacteria 1072
593 Ga0501034_0041732 3300049571 Bacteria 4642
594 Ga0501069_0000165 3300049585 Bacteria 29318
595 Ga0501069_0157344 3300049585 Bacteria 1308
596 Ga0501070_0013009 3300049586 Bacteria 7013
597 Ga0501071_0999108 3300049587 Bacteria 646
598 nmdc:mga0k408_347444_c1 3300050493 Bacteria 884
599 nmdc:mga09592_235999_c1 3300050508 Bacteria 1584
600 nmdc:mga0rr50_1098180_c1 3300050513 Bacteria 677
601 nmdc:mga08x19_26776_c1 3300050514 Bacteria 3600
602 Ga0495601_0000002 3300053077 Bacteria 528704
603 Ga0495601_0013360 3300053077 Bacteria 4937
604 Ga0495601_0559241 3300053077 Bacteria 736
605 Ga0495612_0000310 3300053078 Bacteria 19769
606 Ga0495595_0000020 3300053084 Bacteria 115983
607 Ga0495595_0002427 3300053084 Bacteria 7285
608 Ga0495619_0000110 3300053085 Bacteria 61419
609 Ga0495619_0003494 3300053085 Bacteria 10138
610 Ga0500651_0323538 3300053093 Bacteria 880
611 Ga0500658_0000279 3300053134 Bacteria 23195
612 Ga0500590_246810 3300053148 Bacteria 713
613 Ga0500619_165388 3300053154 Bacteria 750
614 Ga0500639_063035 3300053163 Bacteria 1907
615 Ga0500637_0008565 3300053178 Bacteria 5167
616 Ga0500637_0377588 3300053178 Bacteria 744
617 Ga0501084_0828299 3300054114 Bacteria 779

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0205661 Ga0436360_0205661_291_728 140
2 3300011119 Ga0105246_10145866 Ga0105246_101458662 143
3 3300035086 Ga0373934_0001254 Ga0373934_0001254_3225_3671 143
4 3300035111 Ga0373923_0002592 Ga0373923_0002592_260_706 143
5 3300035117 Ga0373953_0001405 Ga0373953_0001405_6407_6853 143
6 3300035118 Ga0373954_0002625 Ga0373954_0002625_1262_1708 143
7 3300035119 Ga0373956_0001441 Ga0373956_0001441_5266_5712 143
8 3300035120 Ga0373957_0006390 Ga0373957_0006390_1583_2029 143
9 3300035172 Ga0373955_0003007 Ga0373955_0003007_6270_6716 143
10 3300035410 Ga0373924_0007514 Ga0373924_0007514_1900_2346 143
11 3300035724 Ga0373933_0000017 Ga0373933_0000017_33743_34189 143
12 3300035724 Ga0373933_0004005 Ga0373933_0004005_6540_6986 143
13 3300036401 Ga0373937_0079220 Ga0373937_0079220_1457_1903 143
14 3300039447 Ga0436361_0683511 Ga0436361_0683511_69_521 143
15 3300046454 Ga0495592_0027451 Ga0495592_0027451_2157_2603 143
16 3300046459 Ga0495629_0001206 Ga0495629_0001206_16435_16881 143
17 3300046462 Ga0495651_0221355 Ga0495651_0221355_63_509 143
18 3300046463 Ga0495653_0007406 Ga0495653_0007406_6259_6705 143
19 3300046511 Ga0495608_0031076 Ga0495608_0031076_1710_2156 143
20 3300046516 Ga0495628_0011177 Ga0495628_0011177_4868_5314 143
21 3300046529 Ga0495652_0023745 Ga0495652_0023745_1652_2098 143
22 3300046533 Ga0495640_0080679 Ga0495640_0080679_1095_1541 143
23 3300046536 Ga0495587_0011834 Ga0495587_0011834_673_1119 143
24 3300046543 Ga0495645_0019910 Ga0495645_0019910_2418_2864 143
25 3300046559 Ga0495667_0056834 Ga0495667_0056834_1912_2358 143
26 3300046642 Ga0495634_0012302 Ga0495634_0012302_5430_5876 143
27 3300046663 Ga0495635_0002216 Ga0495635_0002216_7600_8046 143
28 3300046675 Ga0495657_0034350 Ga0495657_0034350_1262_1708 143
29 3300046678 Ga0495599_0056876 Ga0495599_0056876_673_1119 143
30 3300046679 Ga0495623_0026792 Ga0495623_0026792_1807_2253 143
31 3300046680 Ga0495646_0019235 Ga0495646_0019235_3819_4265 143
32 3300046689 Ga0495613_0025125 Ga0495613_0025125_2976_3422 143
33 3300046809 Ga0495600_0051002 Ga0495600_0051002_2040_2486 143
34 3300047317 Ga0495604_0026169 Ga0495604_0026169_2937_3383 143
35 3300047319 Ga0495674_0273479 Ga0495674_0273479_62_508 143
36 3300047322 Ga0495680_0034917 Ga0495680_0034917_2937_3383 143
37 3300047444 Ga0495675_0002252 Ga0495675_0002252_4315_4761 143
38 3300047471 Ga0495684_0000954 Ga0495684_0000954_11539_11985 143
39 3300047673 Ga0495593_0003081 Ga0495593_0003081_5432_5878 143
40 3300048088 Ga0495602_0042607 Ga0495602_0042607_1978_2424 143
41 3300048918 Ga0496115_0072884 Ga0496115_0072884_785_1234 143
42 3300053077 Ga0495601_0013360 Ga0495601_0013360_2791_3237 143
43 3300053077 Ga0495601_0559241 Ga0495601_0559241_221_670 143
44 3300053084 Ga0495595_0002427 Ga0495595_0002427_1683_2129 143
45 3300053085 Ga0495619_0003494 Ga0495619_0003494_6539_6985 143
46 3300053148 Ga0500590_246810 Ga0500590_246810_38_490 143
47 3300053154 Ga0500619_165388 Ga0500619_165388_176_625 143
48 3300053163 Ga0500639_063035 Ga0500639_063035_547_999 143
49 3300053178 Ga0500637_0008565 Ga0500637_0008565_1780_2232 143
50 3300053178 Ga0500637_0377588 Ga0500637_0377588_281_730 143
51 3300005338 Ga0068868_100636693 Ga0068868_1006366932 146
52 3300026023 Ga0207677_12070497 Ga0207677_120704971 146
53 3300005340 Ga0070689_100440698 Ga0070689_1004406981 147
54 3300005435 Ga0070714_100053931 Ga0070714_1000539314 147
55 3300005436 Ga0070713_100002481 Ga0070713_1000024812 147
56 3300005436 Ga0070713_100623328 Ga0070713_1006233282 147
57 3300005439 Ga0070711_100622198 Ga0070711_1006221981 147
58 3300005457 Ga0070662_100666216 Ga0070662_1006662161 147
59 3300005457 Ga0070662_100784822 Ga0070662_1007848221 147
60 3300005471 Ga0070698_100606745 Ga0070698_1006067452 147
61 3300005471 Ga0070698_101113685 Ga0070698_1011136851 147
62 3300005539 Ga0068853_100416470 Ga0068853_1004164701 147
63 3300005545 Ga0070695_100890007 Ga0070695_1008900071 147
64 3300005563 Ga0068855_100057107 Ga0068855_1000571077 147
65 3300005563 Ga0068855_100085417 Ga0068855_1000854172 147
66 3300005577 Ga0068857_100029668 Ga0068857_1000296682 147
67 3300005578 Ga0068854_100013235 Ga0068854_1000132352 147
68 3300005578 Ga0068854_100174763 Ga0068854_1001747632 147
69 3300005614 Ga0068856_100055230 Ga0068856_1000552302 147
70 3300005614 Ga0068856_100115026 Ga0068856_1001150262 147
71 3300005614 Ga0068856_100554271 Ga0068856_1005542712 147
72 3300005616 Ga0068852_100024160 Ga0068852_1000241605 147
73 3300005617 Ga0068859_100291569 Ga0068859_1002915692 147
74 3300005719 Ga0068861_100992394 Ga0068861_1009923942 147
75 3300005834 Ga0068851_10022338 Ga0068851_100223383 147
76 3300005981 Ga0081538_10009408 Ga0081538_100094082 147
77 3300005981 Ga0081538_10124458 Ga0081538_101244583 147
78 3300006028 Ga0070717_10000329 Ga0070717_1000032923 147
79 3300006028 Ga0070717_11489515 Ga0070717_114895151 147
80 3300006175 Ga0070712_100865779 Ga0070712_1008657792 147
81 3300006195 Ga0075366_10570920 Ga0075366_105709202 147
82 3300006358 Ga0068871_100237352 Ga0068871_1002373522 147
83 3300006844 Ga0075428_100973148 Ga0075428_1009731481 147
84 3300006881 Ga0068865_101202321 Ga0068865_1012023212 147
85 3300006931 Ga0097620_100291579 Ga0097620_1002915792 147
86 3300009093 Ga0105240_10015110 Ga0105240_100151108 147
87 3300009093 Ga0105240_11030582 Ga0105240_110305822 147
88 3300009094 Ga0111539_12398453 Ga0111539_123984531 147
89 3300009101 Ga0105247_10035454 Ga0105247_100354543 147
90 3300009147 Ga0114129_11477144 Ga0114129_114771442 147
91 3300009174 Ga0105241_10009831 Ga0105241_100098315 147
92 3300009174 Ga0105241_11140417 Ga0105241_111404171 147
93 3300009176 Ga0105242_10069851 Ga0105242_100698513 147
94 3300009545 Ga0105237_10035169 Ga0105237_100351692 147
95 3300009545 Ga0105237_10107704 Ga0105237_101077044 147
96 3300009545 Ga0105237_10161812 Ga0105237_101618123 147
97 3300009551 Ga0105238_10008597 Ga0105238_100085977 147
98 3300009551 Ga0105238_10031322 Ga0105238_100313227 147
99 3300010375 Ga0105239_10016514 Ga0105239_100165146 147
100 3300010375 Ga0105239_10036415 Ga0105239_100364152 147
101 3300011119 Ga0105246_10480388 Ga0105246_104803882 147
102 3300013296 Ga0157374_10272124 Ga0157374_102721243 147
103 3300013297 Ga0157378_11082950 Ga0157378_110829502 147
104 3300014325 Ga0163163_10041679 Ga0163163_100416795 147
105 3300014968 Ga0157379_10391773 Ga0157379_103917732 147
106 3300020069 Ga0197907_10787107 Ga0197907_107871072 147
107 3300021361 Ga0213872_10252446 Ga0213872_102524462 147
108 3300025898 Ga0207692_10115034 Ga0207692_101150342 147
109 3300025900 Ga0207710_10034330 Ga0207710_100343302 147
110 3300025904 Ga0207647_10000685 Ga0207647_1000068526 147
111 3300025905 Ga0207685_10235209 Ga0207685_102352092 147
112 3300025906 Ga0207699_10306216 Ga0207699_103062162 147
113 3300025914 Ga0207671_10103648 Ga0207671_101036484 147
114 3300025914 Ga0207671_10129941 Ga0207671_101299412 147
115 3300025914 Ga0207671_11102178 Ga0207671_111021781 147
116 3300025915 Ga0207693_10183371 Ga0207693_101833712 147
117 3300025915 Ga0207693_10477567 Ga0207693_104775672 147
118 3300025916 Ga0207663_10372211 Ga0207663_103722112 147
119 3300025928 Ga0207700_10007850 Ga0207700_100078506 147
120 3300025929 Ga0207664_10047300 Ga0207664_100473002 147
121 3300025931 Ga0207644_11134706 Ga0207644_111347062 147
122 3300025932 Ga0207690_10804679 Ga0207690_108046791 147
123 3300025933 Ga0207706_10633205 Ga0207706_106332052 147
124 3300025934 Ga0207686_10088110 Ga0207686_100881102 147
125 3300025936 Ga0207670_10650303 Ga0207670_106503031 147
126 3300025949 Ga0207667_10805909 Ga0207667_108059092 147
127 3300025981 Ga0207640_10224805 Ga0207640_102248051 147
128 3300026095 Ga0207676_10139909 Ga0207676_101399093 147
129 3300026116 Ga0207674_10015148 Ga0207674_100151487 147
130 3300026116 Ga0207674_10044733 Ga0207674_100447337 147
131 3300026116 Ga0207674_11102050 Ga0207674_111020501 147
132 3300026118 Ga0207675_100076379 Ga0207675_1000763793 147
133 3300026121 Ga0207683_11688598 Ga0207683_116885981 147
134 3300027512 Ga0209179_1008569 Ga0209179_10085692 147
135 3300028573 Ga0265334_10047500 Ga0265334_100475002 147
136 3300031235 Ga0265330_10115955 Ga0265330_101159552 147
137 3300031238 Ga0265332_10037701 Ga0265332_100377012 147
138 3300031239 Ga0265328_10010377 Ga0265328_100103773 147
139 3300031241 Ga0265325_10041753 Ga0265325_100417533 147
140 3300031249 Ga0265339_10008736 Ga0265339_100087362 147
141 3300031249 Ga0265339_10074737 Ga0265339_100747372 147
142 3300031507 Ga0307509_10078803 Ga0307509_100788032 147
143 3300031507 Ga0307509_10346687 Ga0307509_103466873 147
144 3300031595 Ga0265313_10118653 Ga0265313_101186531 147
145 3300031616 Ga0307508_10059545 Ga0307508_100595453 147
146 3300035692 Ga0373935_0380189 Ga0373935_0380189_402_863 147
147 3300037466 Ga0395898_0107845 Ga0395898_0107845_805_1263 147
148 3300038443 Ga0395901_0095046 Ga0395901_0095046_852_1310 147
149 3300038443 Ga0395901_0517507 Ga0395901_0517507_212_670 147
150 3300044694 Ga0466963_0464256 Ga0466963_0464256_71_532 147
151 3300044901 Ga0466960_0089253 Ga0466960_0089253_652_1110 147
152 3300046472 Ga0495580_0415803 Ga0495580_0415803_194_664 147
153 3300046477 Ga0495664_0102623 Ga0495664_0102623_629_1087 147
154 3300047321 Ga0495676_0630418 Ga0495676_0630418_133_591 147
155 3300048903 Ga0496100_0347094 Ga0496100_0347094_261_725 147
156 3300048908 Ga0496105_0031676 Ga0496105_0031676_385_849 147
157 3300048909 Ga0496106_0142059 Ga0496106_0142059_1331_1795 147
158 3300048911 Ga0496108_0736460 Ga0496108_0736460_33_494 147
159 3300048912 Ga0496109_0407018 Ga0496109_0407018_67_531 147
160 3300048915 Ga0496112_0206704 Ga0496112_0206704_183_647 147
161 3300048916 Ga0496113_0588596 Ga0496113_0588596_401_865 147
162 3300048924 Ga0496121_0062150 Ga0496121_0062150_402_863 147
163 3300048929 Ga0496126_0160370 Ga0496126_0160370_1443_1904 147
164 3300049585 Ga0501069_0157344 Ga0501069_0157344_310_771 147
165 3300044901 Ga0466960_0017393 Ga0466960_0017393_665_1129 148
166 3300045049 Ga0466959_0110346 Ga0466959_0110346_1366_1821 148
167 3300005563 Ga0068855_100019058 Ga0068855_1000190583 149
168 3300005614 Ga0068856_100044482 Ga0068856_1000444826 149
169 3300009093 Ga0105240_10117551 Ga0105240_101175514 149
170 3300009177 Ga0105248_12162708 Ga0105248_121627082 149
171 3300009551 Ga0105238_10101023 Ga0105238_101010232 149
172 3300025913 Ga0207695_10156005 Ga0207695_101560052 149
173 3300025924 Ga0207694_10573187 Ga0207694_105731872 149
174 3300025949 Ga0207667_10033361 Ga0207667_100333613 149
175 3300026078 Ga0207702_10619772 Ga0207702_106197722 149
176 3300045836 Ga0466958_0306486 Ga0466958_0306486_146_619 149
177 3300046525 Ga0495663_0044398 Ga0495663_0044398_303_776 149
178 3300046660 Ga0495625_0012614 Ga0495625_0012614_3958_4431 149
179 3300053134 Ga0500658_0000279 Ga0500658_0000279_20117_20590 149
180 3300005329 Ga0070683_100008457 Ga0070683_1000084575 150
181 3300005329 Ga0070683_100350869 Ga0070683_1003508693 150
182 3300005344 Ga0070661_100125931 Ga0070661_1001259311 150
183 3300005535 Ga0070684_100124582 Ga0070684_1001245823 150
184 3300005563 Ga0068855_101204706 Ga0068855_1012047062 150
185 3300005614 Ga0068856_100062875 Ga0068856_1000628754 150
186 3300009093 Ga0105240_10004314 Ga0105240_100043143 150
187 3300009093 Ga0105240_10186224 Ga0105240_101862244 150
188 3300009174 Ga0105241_10256564 Ga0105241_102565641 150
189 3300010159 Ga0099796_10042712 Ga0099796_100427122 150
190 3300013105 Ga0157369_10163239 Ga0157369_101632392 150
191 3300013307 Ga0157372_10260709 Ga0157372_102607092 150
192 3300025906 Ga0207699_10440680 Ga0207699_104406802 150
193 3300025913 Ga0207695_10020606 Ga0207695_100206064 150
194 3300025913 Ga0207695_10153320 Ga0207695_101533204 150
195 3300025920 Ga0207649_10357769 Ga0207649_103577692 150
196 3300025944 Ga0207661_10058236 Ga0207661_100582362 150
197 3300025949 Ga0207667_11065841 Ga0207667_110658412 150
198 3300026078 Ga0207702_10044939 Ga0207702_100449392 150
199 3300005290 Ga0065712_10574782 Ga0065712_105747821 151
200 3300005328 Ga0070676_10518284 Ga0070676_105182842 151
201 3300005329 Ga0070683_100009334 Ga0070683_1000093346 151
202 3300005329 Ga0070683_100159810 Ga0070683_1001598105 151
203 3300005329 Ga0070683_100598883 Ga0070683_1005988833 151
204 3300005329 Ga0070683_100755779 Ga0070683_1007557792 151
205 3300005329 Ga0070683_100780607 Ga0070683_1007806071 151
206 3300005330 Ga0070690_101369986 Ga0070690_1013699861 151
207 3300005331 Ga0070670_100044499 Ga0070670_1000444991 151
208 3300005331 Ga0070670_100149869 Ga0070670_1001498693 151
209 3300005334 Ga0068869_100004563 Ga0068869_1000045632 151
210 3300005334 Ga0068869_100144297 Ga0068869_1001442972 151
211 3300005334 Ga0068869_101224435 Ga0068869_1012244351 151
212 3300005335 Ga0070666_10507878 Ga0070666_105078781 151
213 3300005336 Ga0070680_100719430 Ga0070680_1007194301 151
214 3300005337 Ga0070682_100940450 Ga0070682_1009404501 151
215 3300005338 Ga0068868_100136128 Ga0068868_1001361283 151
216 3300005339 Ga0070660_100016825 Ga0070660_1000168253 151
217 3300005340 Ga0070689_100331625 Ga0070689_1003316253 151
218 3300005340 Ga0070689_100404122 Ga0070689_1004041222 151
219 3300005343 Ga0070687_100567922 Ga0070687_1005679221 151
220 3300005344 Ga0070661_100002712 Ga0070661_1000027129 151
221 3300005344 Ga0070661_100032923 Ga0070661_1000329236 151
222 3300005344 Ga0070661_100037766 Ga0070661_1000377664 151
223 3300005354 Ga0070675_100391475 Ga0070675_1003914752 151
224 3300005354 Ga0070675_100412247 Ga0070675_1004122472 151
225 3300005355 Ga0070671_100530996 Ga0070671_1005309961 151
226 3300005364 Ga0070673_100180459 Ga0070673_1001804592 151
227 3300005364 Ga0070673_100497668 Ga0070673_1004976681 151
228 3300005365 Ga0070688_100142140 Ga0070688_1001421403 151
229 3300005366 Ga0070659_100010732 Ga0070659_1000107323 151
230 3300005366 Ga0070659_100141447 Ga0070659_1001414473 151
231 3300005367 Ga0070667_100202460 Ga0070667_1002024602 151
232 3300005367 Ga0070667_100558313 Ga0070667_1005583131 151
233 3300005434 Ga0070709_10840181 Ga0070709_108401811 151
234 3300005435 Ga0070714_100036717 Ga0070714_1000367174 151
235 3300005436 Ga0070713_100218040 Ga0070713_1002180401 151
236 3300005438 Ga0070701_10199215 Ga0070701_101992152 151
237 3300005441 Ga0070700_100045595 Ga0070700_1000455954 151
238 3300005441 Ga0070700_100186904 Ga0070700_1001869042 151
239 3300005444 Ga0070694_100932019 Ga0070694_1009320191 151
240 3300005445 Ga0070708_100226777 Ga0070708_1002267772 151
241 3300005455 Ga0070663_100275927 Ga0070663_1002759272 151
242 3300005455 Ga0070663_100519704 Ga0070663_1005197041 151
243 3300005456 Ga0070678_100169033 Ga0070678_1001690331 151
244 3300005457 Ga0070662_100038573 Ga0070662_1000385733 151
245 3300005457 Ga0070662_100255684 Ga0070662_1002556841 151
246 3300005459 Ga0068867_100307440 Ga0068867_1003074402 151
247 3300005459 Ga0068867_100507189 Ga0068867_1005071892 151
248 3300005466 Ga0070685_10270745 Ga0070685_102707451 151
249 3300005467 Ga0070706_100005867 Ga0070706_1000058678 151
250 3300005468 Ga0070707_100004630 Ga0070707_10000463014 151
251 3300005471 Ga0070698_100010297 Ga0070698_1000102979 151
252 3300005471 Ga0070698_100076895 Ga0070698_1000768953 151
253 3300005518 Ga0070699_100465083 Ga0070699_1004650832 151
254 3300005530 Ga0070679_100120267 Ga0070679_1001202672 151
255 3300005530 Ga0070679_100362678 Ga0070679_1003626781 151
256 3300005535 Ga0070684_100000866 Ga0070684_10000086618 151
257 3300005535 Ga0070684_100005712 Ga0070684_1000057123 151
258 3300005535 Ga0070684_100019112 Ga0070684_1000191126 151
259 3300005535 Ga0070684_100156853 Ga0070684_1001568533 151
260 3300005535 Ga0070684_100215665 Ga0070684_1002156652 151
261 3300005535 Ga0070684_101704559 Ga0070684_1017045591 151
262 3300005539 Ga0068853_100007014 Ga0068853_1000070142 151
263 3300005539 Ga0068853_100009281 Ga0068853_1000092813 151
264 3300005539 Ga0068853_100039529 Ga0068853_1000395293 151
265 3300005539 Ga0068853_100055051 Ga0068853_1000550513 151
266 3300005539 Ga0068853_100171621 Ga0068853_1001716212 151
267 3300005539 Ga0068853_101302452 Ga0068853_1013024521 151
268 3300005543 Ga0070672_100279205 Ga0070672_1002792053 151
269 3300005545 Ga0070695_100906054 Ga0070695_1009060541 151
270 3300005547 Ga0070693_100879314 Ga0070693_1008793141 151
271 3300005548 Ga0070665_100531980 Ga0070665_1005319803 151
272 3300005548 Ga0070665_101153613 Ga0070665_1011536132 151
273 3300005549 Ga0070704_102092984 Ga0070704_1020929841 151
274 3300005563 Ga0068855_100013376 Ga0068855_1000133763 151
275 3300005563 Ga0068855_100311330 Ga0068855_1003113302 151
276 3300005564 Ga0070664_100001013 Ga0070664_10000101318 151
277 3300005564 Ga0070664_100001091 Ga0070664_1000010916 151
278 3300005564 Ga0070664_100030545 Ga0070664_1000305455 151
279 3300005564 Ga0070664_100071638 Ga0070664_1000716385 151
280 3300005564 Ga0070664_100096829 Ga0070664_1000968293 151
281 3300005564 Ga0070664_101084175 Ga0070664_1010841751 151
282 3300005577 Ga0068857_100003966 Ga0068857_1000039666 151
283 3300005577 Ga0068857_100035926 Ga0068857_1000359265 151
284 3300005577 Ga0068857_100190602 Ga0068857_1001906022 151
285 3300005577 Ga0068857_100278147 Ga0068857_1002781472 151
286 3300005577 Ga0068857_100297688 Ga0068857_1002976881 151
287 3300005577 Ga0068857_100498659 Ga0068857_1004986592 151
288 3300005578 Ga0068854_100004399 Ga0068854_1000043996 151
289 3300005578 Ga0068854_100395923 Ga0068854_1003959232 151
290 3300005578 Ga0068854_100643426 Ga0068854_1006434262 151
291 3300005614 Ga0068856_100004251 Ga0068856_10000425113 151
292 3300005614 Ga0068856_100690751 Ga0068856_1006907511 151
293 3300005614 Ga0068856_100782045 Ga0068856_1007820451 151
294 3300005616 Ga0068852_100002382 Ga0068852_10000238212 151
295 3300005616 Ga0068852_100070073 Ga0068852_1000700733 151
296 3300005616 Ga0068852_100492678 Ga0068852_1004926782 151
297 3300005616 Ga0068852_100869714 Ga0068852_1008697141 151
298 3300005617 Ga0068859_100116618 Ga0068859_1001166184 151
299 3300005617 Ga0068859_100137080 Ga0068859_1001370801 151
300 3300005617 Ga0068859_100155691 Ga0068859_1001556913 151
301 3300005617 Ga0068859_100551144 Ga0068859_1005511442 151
302 3300005617 Ga0068859_100784776 Ga0068859_1007847761 151
303 3300005618 Ga0068864_100039887 Ga0068864_1000398874 151
304 3300005618 Ga0068864_100578909 Ga0068864_1005789092 151
305 3300005618 Ga0068864_100657608 Ga0068864_1006576082 151
306 3300005719 Ga0068861_100040137 Ga0068861_1000401378 151
307 3300005719 Ga0068861_100048268 Ga0068861_1000482682 151
308 3300005834 Ga0068851_10008128 Ga0068851_100081285 151
309 3300005841 Ga0068863_100395505 Ga0068863_1003955052 151
310 3300005841 Ga0068863_100567498 Ga0068863_1005674981 151
311 3300005842 Ga0068858_100170097 Ga0068858_1001700972 151
312 3300005842 Ga0068858_100841792 Ga0068858_1008417921 151
313 3300005843 Ga0068860_100010741 Ga0068860_1000107415 151
314 3300005844 Ga0068862_100081350 Ga0068862_1000813503 151
315 3300005844 Ga0068862_100545506 Ga0068862_1005455061 151
316 3300006028 Ga0070717_10592057 Ga0070717_105920571 151
317 3300006042 Ga0075368_10042008 Ga0075368_100420082 151
318 3300006175 Ga0070712_100852315 Ga0070712_1008523151 151
319 3300006195 Ga0075366_10679661 Ga0075366_106796612 151
320 3300006237 Ga0097621_100034307 Ga0097621_1000343071 151
321 3300006358 Ga0068871_100111737 Ga0068871_1001117372 151
322 3300006358 Ga0068871_100174289 Ga0068871_1001742893 151
323 3300006358 Ga0068871_100488112 Ga0068871_1004881123 151
324 3300006844 Ga0075428_100057010 Ga0075428_1000570105 151
325 3300006846 Ga0075430_101034412 Ga0075430_1010344121 151
326 3300006880 Ga0075429_100017742 Ga0075429_1000177423 151
327 3300006881 Ga0068865_100283048 Ga0068865_1002830482 151
328 3300006881 Ga0068865_101993136 Ga0068865_1019931361 151
329 3300006914 Ga0075436_100020045 Ga0075436_1000200452 151
330 3300006931 Ga0097620_100116618 Ga0097620_1001166184 151
331 3300006931 Ga0097620_100137076 Ga0097620_1001370763 151
332 3300006931 Ga0097620_100155703 Ga0097620_1001557033 151
333 3300006931 Ga0097620_100551141 Ga0097620_1005511412 151
334 3300006931 Ga0097620_100784798 Ga0097620_1007847982 151
335 3300007076 Ga0075435_100691635 Ga0075435_1006916352 151
336 3300009093 Ga0105240_10026349 Ga0105240_100263497 151
337 3300009093 Ga0105240_10288061 Ga0105240_102880612 151
338 3300009093 Ga0105240_10484418 Ga0105240_104844182 151
339 3300009094 Ga0111539_10583424 Ga0111539_105834242 151
340 3300009101 Ga0105247_10007691 Ga0105247_100076916 151
341 3300009174 Ga0105241_10078395 Ga0105241_100783955 151
342 3300009174 Ga0105241_10114327 Ga0105241_101143271 151
343 3300009174 Ga0105241_10131077 Ga0105241_101310772 151
344 3300009174 Ga0105241_10378856 Ga0105241_103788562 151
345 3300009177 Ga0105248_10648470 Ga0105248_106484701 151
346 3300009177 Ga0105248_10915646 Ga0105248_109156461 151
347 3300009177 Ga0105248_12673506 Ga0105248_126735061 151
348 3300009545 Ga0105237_10089762 Ga0105237_100897622 151
349 3300009545 Ga0105237_10240538 Ga0105237_102405381 151
350 3300009545 Ga0105237_10744899 Ga0105237_107448991 151
351 3300009551 Ga0105238_10001137 Ga0105238_1000113717 151
352 3300009551 Ga0105238_10669675 Ga0105238_106696752 151
353 3300009553 Ga0105249_10003199 Ga0105249_100031995 151
354 3300009553 Ga0105249_10009092 Ga0105249_100090924 151
355 3300009553 Ga0105249_10045511 Ga0105249_100455113 151
356 3300009553 Ga0105249_10500425 Ga0105249_105004252 151
357 3300009553 Ga0105249_10612081 Ga0105249_106120811 151
358 3300010375 Ga0105239_10090452 Ga0105239_100904523 151
359 3300010375 Ga0105239_10273515 Ga0105239_102735152 151
360 3300011119 Ga0105246_10270137 Ga0105246_102701372 151
361 3300013100 Ga0157373_10004071 Ga0157373_100040711 151
362 3300013100 Ga0157373_10186025 Ga0157373_101860251 151
363 3300013100 Ga0157373_10411871 Ga0157373_104118712 151
364 3300013102 Ga0157371_10370173 Ga0157371_103701732 151
365 3300013104 Ga0157370_10013002 Ga0157370_100130029 151
366 3300013104 Ga0157370_10139812 Ga0157370_101398122 151
367 3300013105 Ga0157369_10007484 Ga0157369_100074843 151
368 3300013105 Ga0157369_10392689 Ga0157369_103926892 151
369 3300013105 Ga0157369_10796371 Ga0157369_107963711 151
370 3300013105 Ga0157369_10842600 Ga0157369_108426002 151
371 3300013296 Ga0157374_10006243 Ga0157374_100062433 151
372 3300013296 Ga0157374_10036265 Ga0157374_100362655 151
373 3300013296 Ga0157374_10197673 Ga0157374_101976731 151
374 3300013296 Ga0157374_11369855 Ga0157374_113698552 151
375 3300013297 Ga0157378_10111222 Ga0157378_101112223 151
376 3300013297 Ga0157378_10774444 Ga0157378_107744441 151
377 3300013306 Ga0163162_10147148 Ga0163162_101471482 151
378 3300013306 Ga0163162_10273412 Ga0163162_102734122 151
379 3300013306 Ga0163162_10342250 Ga0163162_103422502 151
380 3300013306 Ga0163162_12751498 Ga0163162_127514981 151
381 3300013307 Ga0157372_10006264 Ga0157372_1000626411 151
382 3300013307 Ga0157372_10549602 Ga0157372_105496021 151
383 3300013307 Ga0157372_13141710 Ga0157372_131417101 151
384 3300013308 Ga0157375_10018953 Ga0157375_100189533 151
385 3300013308 Ga0157375_10073852 Ga0157375_100738523 151
386 3300014325 Ga0163163_10005024 Ga0163163_1000502412 151
387 3300014325 Ga0163163_10596340 Ga0163163_105963401 151
388 3300014325 Ga0163163_11219135 Ga0163163_112191351 151
389 3300014326 Ga0157380_10209597 Ga0157380_102095972 151
390 3300014968 Ga0157379_10162118 Ga0157379_101621181 151
391 3300014968 Ga0157379_10203809 Ga0157379_102038092 151
392 3300014968 Ga0157379_10440606 Ga0157379_104406061 151
393 3300014969 Ga0157376_11023168 Ga0157376_110231681 151
394 3300014969 Ga0157376_11367824 Ga0157376_113678241 151
395 3300017792 Ga0163161_10137955 Ga0163161_101379552 151
396 3300020070 Ga0206356_10132939 Ga0206356_101329391 151
397 3300025315 Ga0207697_10035593 Ga0207697_100355933 151
398 3300025900 Ga0207710_10002424 Ga0207710_100024246 151
399 3300025900 Ga0207710_10476052 Ga0207710_104760522 151
400 3300025903 Ga0207680_10404464 Ga0207680_104044641 151
401 3300025904 Ga0207647_10042037 Ga0207647_100420372 151
402 3300025904 Ga0207647_10548496 Ga0207647_105484961 151
403 3300025906 Ga0207699_10617645 Ga0207699_106176451 151
404 3300025906 Ga0207699_10668940 Ga0207699_106689402 151
405 3300025907 Ga0207645_10091003 Ga0207645_100910032 151
406 3300025907 Ga0207645_10640039 Ga0207645_106400392 151
407 3300025909 Ga0207705_10021706 Ga0207705_100217064 151
408 3300025909 Ga0207705_10471162 Ga0207705_104711622 151
409 3300025910 Ga0207684_10107810 Ga0207684_101078102 151
410 3300025911 Ga0207654_10076140 Ga0207654_100761402 151
411 3300025911 Ga0207654_10139945 Ga0207654_101399451 151
412 3300025911 Ga0207654_10212393 Ga0207654_102123932 151
413 3300025912 Ga0207707_10000570 Ga0207707_1000057031 151
414 3300025912 Ga0207707_10211437 Ga0207707_102114372 151
415 3300025912 Ga0207707_10260093 Ga0207707_102600932 151
416 3300025913 Ga0207695_10021907 Ga0207695_100219076 151
417 3300025913 Ga0207695_10046485 Ga0207695_100464854 151
418 3300025913 Ga0207695_10059410 Ga0207695_100594101 151
419 3300025914 Ga0207671_10053393 Ga0207671_100533934 151
420 3300025915 Ga0207693_10854466 Ga0207693_108544661 151
421 3300025917 Ga0207660_10012565 Ga0207660_100125657 151
422 3300025919 Ga0207657_10007975 Ga0207657_100079759 151
423 3300025920 Ga0207649_10005003 Ga0207649_100050034 151
424 3300025920 Ga0207649_10010573 Ga0207649_100105736 151
425 3300025920 Ga0207649_10023904 Ga0207649_100239044 151
426 3300025921 Ga0207652_10053166 Ga0207652_100531663 151
427 3300025921 Ga0207652_10101259 Ga0207652_101012595 151
428 3300025921 Ga0207652_10164834 Ga0207652_101648342 151
429 3300025921 Ga0207652_10357636 Ga0207652_103576362 151
430 3300025922 Ga0207646_10013658 Ga0207646_100136588 151
431 3300025923 Ga0207681_11105266 Ga0207681_111052661 151
432 3300025924 Ga0207694_10004254 Ga0207694_100042542 151
433 3300025924 Ga0207694_10916804 Ga0207694_109168042 151
434 3300025925 Ga0207650_10406838 Ga0207650_104068382 151
435 3300025925 Ga0207650_10681030 Ga0207650_106810301 151
436 3300025928 Ga0207700_11459780 Ga0207700_114597801 151
437 3300025929 Ga0207664_10001915 Ga0207664_100019153 151
438 3300025929 Ga0207664_10413576 Ga0207664_104135762 151
439 3300025931 Ga0207644_10861302 Ga0207644_108613021 151
440 3300025931 Ga0207644_10887655 Ga0207644_108876551 151
441 3300025932 Ga0207690_10026270 Ga0207690_100262703 151
442 3300025932 Ga0207690_10074575 Ga0207690_100745752 151
443 3300025932 Ga0207690_10913729 Ga0207690_109137292 151
444 3300025933 Ga0207706_10095679 Ga0207706_100956793 151
445 3300025933 Ga0207706_10130479 Ga0207706_101304792 151
446 3300025933 Ga0207706_11085158 Ga0207706_110851581 151
447 3300025934 Ga0207686_10598028 Ga0207686_105980281 151
448 3300025936 Ga0207670_10007419 Ga0207670_100074193 151
449 3300025936 Ga0207670_10027763 Ga0207670_100277634 151
450 3300025936 Ga0207670_10465185 Ga0207670_104651851 151
451 3300025937 Ga0207669_11593593 Ga0207669_115935931 151
452 3300025938 Ga0207704_10188645 Ga0207704_101886452 151
453 3300025938 Ga0207704_11203451 Ga0207704_112034511 151
454 3300025939 Ga0207665_10484409 Ga0207665_104844091 151
455 3300025940 Ga0207691_10061982 Ga0207691_100619823 151
456 3300025940 Ga0207691_10416418 Ga0207691_104164181 151
457 3300025942 Ga0207689_10003767 Ga0207689_100037672 151
458 3300025942 Ga0207689_10043742 Ga0207689_100437423 151
459 3300025944 Ga0207661_10000392 Ga0207661_100003925 151
460 3300025944 Ga0207661_10022874 Ga0207661_100228745 151
461 3300025944 Ga0207661_10051028 Ga0207661_100510283 151
462 3300025944 Ga0207661_10176822 Ga0207661_101768222 151
463 3300025945 Ga0207679_10001465 Ga0207679_100014652 151
464 3300025945 Ga0207679_10001859 Ga0207679_100018593 151
465 3300025945 Ga0207679_10458710 Ga0207679_104587101 151
466 3300025945 Ga0207679_11656533 Ga0207679_116565331 151
467 3300025949 Ga0207667_10031999 Ga0207667_100319997 151
468 3300025949 Ga0207667_10071701 Ga0207667_100717014 151
469 3300025949 Ga0207667_11637949 Ga0207667_116379491 151
470 3300025961 Ga0207712_10002412 Ga0207712_1000241210 151
471 3300025961 Ga0207712_10009047 Ga0207712_100090474 151
472 3300025961 Ga0207712_10065117 Ga0207712_100651174 151
473 3300025961 Ga0207712_10280007 Ga0207712_102800072 151
474 3300025961 Ga0207712_10336921 Ga0207712_103369211 151
475 3300025972 Ga0207668_10978585 Ga0207668_109785851 151
476 3300025981 Ga0207640_10011681 Ga0207640_100116812 151
477 3300025981 Ga0207640_10337907 Ga0207640_103379072 151
478 3300025986 Ga0207658_10490975 Ga0207658_104909751 151
479 3300026023 Ga0207677_10017200 Ga0207677_100172004 151
480 3300026023 Ga0207677_10395374 Ga0207677_103953742 151
481 3300026035 Ga0207703_10072251 Ga0207703_100722513 151
482 3300026035 Ga0207703_10449464 Ga0207703_104494642 151
483 3300026035 Ga0207703_10592041 Ga0207703_105920411 151
484 3300026041 Ga0207639_10003536 Ga0207639_100035365 151
485 3300026041 Ga0207639_10006299 Ga0207639_100062993 151
486 3300026041 Ga0207639_10040707 Ga0207639_100407072 151
487 3300026041 Ga0207639_10174266 Ga0207639_101742662 151
488 3300026041 Ga0207639_10264318 Ga0207639_102643182 151
489 3300026041 Ga0207639_11141608 Ga0207639_111416081 151
490 3300026067 Ga0207678_10329650 Ga0207678_103296501 151
491 3300026067 Ga0207678_10636980 Ga0207678_106369801 151
492 3300026075 Ga0207708_10146882 Ga0207708_101468823 151
493 3300026075 Ga0207708_10392807 Ga0207708_103928072 151
494 3300026078 Ga0207702_10004005 Ga0207702_1000400512 151
495 3300026078 Ga0207702_10568936 Ga0207702_105689361 151
496 3300026088 Ga0207641_10306079 Ga0207641_103060792 151
497 3300026088 Ga0207641_10625403 Ga0207641_106254031 151
498 3300026088 Ga0207641_10701429 Ga0207641_107014292 151
499 3300026089 Ga0207648_10015367 Ga0207648_100153673 151
500 3300026089 Ga0207648_10338924 Ga0207648_103389242 151
501 3300026095 Ga0207676_10049620 Ga0207676_100496204 151
502 3300026095 Ga0207676_10412658 Ga0207676_104126582 151
503 3300026116 Ga0207674_10004712 Ga0207674_1000471213 151
504 3300026116 Ga0207674_10006966 Ga0207674_1000696613 151
505 3300026116 Ga0207674_10034943 Ga0207674_100349432 151
506 3300026116 Ga0207674_10495951 Ga0207674_104959511 151
507 3300026118 Ga0207675_100005780 Ga0207675_1000057805 151
508 3300026118 Ga0207675_101466047 Ga0207675_1014660471 151
509 3300026118 Ga0207675_102000917 Ga0207675_1020009172 151
510 3300026142 Ga0207698_10013808 Ga0207698_100138085 151
511 3300026142 Ga0207698_10105083 Ga0207698_101050832 151
512 3300026142 Ga0207698_10281553 Ga0207698_102815531 151
513 3300026142 Ga0207698_10501413 Ga0207698_105014132 151
514 3300026142 Ga0207698_11359374 Ga0207698_113593742 151
515 3300027866 Ga0209813_10047796 Ga0209813_100477962 151
516 3300028379 Ga0268266_10461551 Ga0268266_104615512 151
517 3300028379 Ga0268266_10718803 Ga0268266_107188032 151
518 3300028380 Ga0268265_10058694 Ga0268265_100586944 151
519 3300028381 Ga0268264_10000447 Ga0268264_1000044739 151
520 3300028381 Ga0268264_10220455 Ga0268264_102204552 151
521 3300028381 Ga0268264_10388456 Ga0268264_103884562 151
522 3300031241 Ga0265325_10012028 Ga0265325_100120282 151
523 3300031824 Ga0307413_10066749 Ga0307413_100667492 151
524 3300031852 Ga0307410_10151098 Ga0307410_101510982 151
525 3300031852 Ga0307410_11183907 Ga0307410_111839071 151
526 3300032004 Ga0307414_11559866 Ga0307414_115598661 151
527 3300035083 Ga0373926_0065811 Ga0373926_0065811_673_1140 151
528 3300035111 Ga0373923_0003206 Ga0373923_0003206_2269_2736 151
529 3300035113 Ga0373936_0000357 Ga0373936_0000357_2477_2944 151
530 3300035116 Ga0373945_0010231 Ga0373945_0010231_2171_2638 151
531 3300035117 Ga0373953_0008757 Ga0373953_0008757_1127_1594 151
532 3300035118 Ga0373954_0002033 Ga0373954_0002033_5133_5600 151
533 3300035120 Ga0373957_0016029 Ga0373957_0016029_1130_1597 151
534 3300035170 Ga0373943_0000664 Ga0373943_0000664_1623_2090 151
535 3300035171 Ga0373946_0001722 Ga0373946_0001722_2032_2499 151
536 3300035172 Ga0373955_0002159 Ga0373955_0002159_5116_5583 151
537 3300035410 Ga0373924_0001935 Ga0373924_0001935_3175_3642 151
538 3300035692 Ga0373935_0000224 Ga0373935_0000224_22027_22494 151
539 3300035695 Ga0373927_0021415 Ga0373927_0021415_429_896 151
540 3300035724 Ga0373933_0025276 Ga0373933_0025276_542_1009 151
541 3300035725 Ga0373947_0011148 Ga0373947_0011148_4160_4627 151
542 3300035725 Ga0373947_0093237 Ga0373947_0093237_691_1158 151
543 3300036401 Ga0373937_0001096 Ga0373937_0001096_21123_21590 151
544 3300037068 Ga0373925_0000016 Ga0373925_0000016_25908_26375 151
545 3300037312 Ga0395899_0682219 Ga0395899_0682219_153_626 151
546 3300037418 Ga0395900_1203945 Ga0395900_1203945_12_488 151
547 3300037471 Ga0395905_0388339 Ga0395905_0388339_127_606 151
548 3300037471 Ga0395905_0655814 Ga0395905_0655814_364_840 151
549 3300038443 Ga0395901_0986358 Ga0395901_0986358_302_778 151
550 3300041463 Ga0451804_0654551 Ga0451804_0654551_35_508 151
551 3300041486 Ga0451807_1517432 Ga0451807_1517432_800_1273 151
552 3300042436 Ga0439435_0128685 Ga0439435_0128685_146_619 151
553 3300042876 Ga0451577_0872651 Ga0451577_0872651_64_537 151
554 3300044693 Ga0466961_0230819 Ga0466961_0230819_422_898 151
555 3300044712 Ga0453684_0140750 Ga0453684_0140750_1048_1521 151
556 3300044719 Ga0466971_0089837 Ga0466971_0089837_399_875 151
557 3300044842 Ga0466957_0379686 Ga0466957_0379686_212_688 151
558 3300045049 Ga0466959_0373679 Ga0466959_0373679_350_826 151
559 3300045051 Ga0451576_1137976 Ga0451576_1137976_163_639 151
560 3300045836 Ga0466958_0010359 Ga0466958_0010359_1843_2319 151
561 3300046454 Ga0495592_0000658 Ga0495592_0000658_5120_5587 151
562 3300046459 Ga0495629_0011770 Ga0495629_0011770_1807_2274 151
563 3300046462 Ga0495651_0000253 Ga0495651_0000253_32229_32696 151
564 3300046463 Ga0495653_0000045 Ga0495653_0000045_5124_5591 151
565 3300046476 Ga0495662_0020376 Ga0495662_0020376_1506_1973 151
566 3300046477 Ga0495664_0000004 Ga0495664_0000004_5135_5602 151
567 3300046511 Ga0495608_0000017 Ga0495608_0000017_5122_5589 151
568 3300046514 Ga0495618_0000350 Ga0495618_0000350_27433_27900 151
569 3300046516 Ga0495628_0000001 Ga0495628_0000001_5124_5591 151
570 3300046517 Ga0495630_0006902 Ga0495630_0006902_5141_5608 151
571 3300046529 Ga0495652_0000002 Ga0495652_0000002_219658_220125 151
572 3300046533 Ga0495640_0000001 Ga0495640_0000001_313662_314129 151
573 3300046536 Ga0495587_0000008 Ga0495587_0000008_5342_5809 151
574 3300046543 Ga0495645_0000002 Ga0495645_0000002_5137_5604 151
575 3300046559 Ga0495667_0000029 Ga0495667_0000029_5133_5600 151
576 3300046642 Ga0495634_0000339 Ga0495634_0000339_5091_5558 151
577 3300046663 Ga0495635_0000002 Ga0495635_0000002_481333_481800 151
578 3300046675 Ga0495657_0000064 Ga0495657_0000064_88723_89190 151
579 3300046678 Ga0495599_0000064 Ga0495599_0000064_5136_5603 151
580 3300046679 Ga0495623_0000065 Ga0495623_0000065_5151_5618 151
581 3300046680 Ga0495646_0000023 Ga0495646_0000023_5011_5478 151
582 3300046689 Ga0495613_0017402 Ga0495613_0017402_2811_3278 151
583 3300046809 Ga0495600_0000010 Ga0495600_0000010_10373_10840 151
584 3300047317 Ga0495604_0000009 Ga0495604_0000009_320701_321168 151
585 3300047319 Ga0495674_0000002 Ga0495674_0000002_5125_5592 151
586 3300047322 Ga0495680_0002286 Ga0495680_0002286_14141_14608 151
587 3300047444 Ga0495675_0000388 Ga0495675_0000388_5118_5585 151
588 3300047471 Ga0495684_0000006 Ga0495684_0000006_5084_5551 151
589 3300047673 Ga0495593_0004012 Ga0495593_0004012_3241_3708 151
590 3300048088 Ga0495602_0002184 Ga0495602_0002184_5131_5598 151
591 3300048910 Ga0496107_0407465 Ga0496107_0407465_376_843 151
592 3300048913 Ga0496110_0029315 Ga0496110_0029315_1936_2409 151
593 3300048914 Ga0496111_0302365 Ga0496111_0302365_105_581 151
594 3300048916 Ga0496113_0221839 Ga0496113_0221839_951_1424 151
595 3300048917 Ga0496114_0684657 Ga0496114_0684657_302_769 151
596 3300048918 Ga0496115_0033724 Ga0496115_0033724_3545_4012 151
597 3300049568 Ga0501031_0284787 Ga0501031_0284787_141_611 151
598 3300049571 Ga0501034_0041732 Ga0501034_0041732_3835_4302 151
599 3300049585 Ga0501069_0000165 Ga0501069_0000165_20969_21442 151
600 3300049586 Ga0501070_0013009 Ga0501070_0013009_450_923 151
601 3300049587 Ga0501071_0999108 Ga0501071_0999108_130_609 151
602 3300050493 nmdc:mga0k408_347444_c1 nmdc:mga0k408_347444_c1_52_519 151
603 3300050508 nmdc:mga09592_235999_c1 nmdc:mga09592_235999_c1_622_1101 151
604 3300050513 nmdc:mga0rr50_1098180_c1 nmdc:mga0rr50_1098180_c1_172_648 151
605 3300050514 nmdc:mga08x19_26776_c1 nmdc:mga08x19_26776_c1_1438_1914 151
606 3300053077 Ga0495601_0000002 Ga0495601_0000002_305870_306337 151
607 3300053078 Ga0495612_0000310 Ga0495612_0000310_5136_5603 151
608 3300053084 Ga0495595_0000020 Ga0495595_0000020_5134_5601 151
609 3300053085 Ga0495619_0000110 Ga0495619_0000110_55839_56306 151
610 3300053093 Ga0500651_0323538 Ga0500651_0323538_288_761 151
611 3300054114 Ga0501084_0828299 Ga0501084_0828299_280_750 151
612 3300045976 Ga0466967_1920476 Ga0466967_1920476_52_540 153
613 3300013104 Ga0157370_10432869 Ga0157370_104328692 154
614 3300026116 Ga0207674_10081159 Ga0207674_100811593 155
615 3300003322 rootL2_10108963 rootL2_101089636 157
616 3300003323 rootH1_10039019 rootH1_100390196 157
617 3300013307 Ga0157372_10710172 Ga0157372_107101722 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

32

114

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.978 20 144
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9578 7 147
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9355 8 150
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9256 7 147
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9134 20 144
ID Description Score Start End Superfamily
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9487 12 144 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9482 10 146 1.20.1290.10
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9381 10 147 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9333 8 151 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9283 10 146 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A7X6P6M7-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9855 34 141 GO:0051920
AF-A0A7V9HI84-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9851 18 154 GO:0051920
AF-A0A2N3TBP8-F1-model_v4 AhpD family alkylhydroperoxidase 0.9819 10 146 GO:0051920
AF-A0A846US39-F1-model_v4 deleted 0.9819 10 144
AF-A0A1E7RL96-F1-model_v4 Alkylhydroperoxidase 0.9813 10 141 GO:0051920

Feature Viewer

pLDDT pTM Quality
92.18 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map