F469644
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 617 | 286 | 617 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300025923|Ga0207681_11105266|Ga0207681_111052661 |
| Length | 177 |
| Sequence | MSVFVNAGRHWYVTKLNLSIMKQRVNYYEKGFKAIRPLFNLGAYLSKSPIEQSLLDLLSFRVSQINGCAYCLDMHSKDLRAHGETEQRLYMLDAWREAPLYTDRERAALAWAEAVTRLEKNNVPDDVYEQALTEFSEEELVDLTMAVNGINSWNRLNVAFQTPAGDYVPGQHAALVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 106 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 172 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 174 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 176 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 177 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 179 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 180 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 188 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 194 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 195 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 196 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 204 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 205 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 207 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 208 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 209 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 210 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 211 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 212 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 213 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 214 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 215 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 216 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 217 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 255 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 256 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 257 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 261 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 262 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 263 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 264 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 265 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 266 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 267 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 273 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 281 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 283 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 284 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 285 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 286 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.94 |
| Nodule | 0 |
| Rhizoplane | 2.59 |
| Rhizosphere | 94.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10108963 | 3300003322 | Bacteria | 6913 |
| 2 | rootH1_10039019 | 3300003323 | Bacteria | 22093 |
| 3 | Ga0065712_10574782 | 3300005290 | Bacteria | 604 |
| 4 | Ga0070676_10518284 | 3300005328 | Bacteria | 849 |
| 5 | Ga0070683_100008457 | 3300005329 | Bacteria | 8744 |
| 6 | Ga0070683_100009334 | 3300005329 | Bacteria | 8384 |
| 7 | Ga0070683_100159810 | 3300005329 | Bacteria | 2137 |
| 8 | Ga0070683_100350869 | 3300005329 | Bacteria | 1405 |
| 9 | Ga0070683_100598883 | 3300005329 | Unclassified | 1055 |
| 10 | Ga0070683_100755779 | 3300005329 | Bacteria | 931 |
| 11 | Ga0070683_100780607 | 3300005329 | Bacteria | 915 |
| 12 | Ga0070690_101369986 | 3300005330 | Unclassified | 568 |
| 13 | Ga0070670_100044499 | 3300005331 | Bacteria | 3817 |
| 14 | Ga0070670_100149869 | 3300005331 | Unclassified | 2019 |
| 15 | Ga0068869_100004563 | 3300005334 | Bacteria | 8627 |
| 16 | Ga0068869_100144297 | 3300005334 | Bacteria | 1841 |
| 17 | Ga0068869_101224435 | 3300005334 | Bacteria | 660 |
| 18 | Ga0070666_10507878 | 3300005335 | Bacteria | 874 |
| 19 | Ga0070680_100719430 | 3300005336 | Bacteria | 859 |
| 20 | Ga0070682_100940450 | 3300005337 | Bacteria | 713 |
| 21 | Ga0068868_100136128 | 3300005338 | Unclassified | 2014 |
| 22 | Ga0068868_100636693 | 3300005338 | Bacteria | 948 |
| 23 | Ga0070660_100016825 | 3300005339 | Bacteria | 5319 |
| 24 | Ga0070689_100331625 | 3300005340 | Unclassified | 1273 |
| 25 | Ga0070689_100404122 | 3300005340 | Bacteria | 1155 |
| 26 | Ga0070689_100440698 | 3300005340 | Bacteria | 1107 |
| 27 | Ga0070687_100567922 | 3300005343 | Bacteria | 774 |
| 28 | Ga0070661_100002712 | 3300005344 | Bacteria | 12141 |
| 29 | Ga0070661_100032923 | 3300005344 | Unclassified | 3754 |
| 30 | Ga0070661_100037766 | 3300005344 | Bacteria | 3514 |
| 31 | Ga0070661_100125931 | 3300005344 | Bacteria | 1922 |
| 32 | Ga0070675_100391475 | 3300005354 | Unclassified | 1238 |
| 33 | Ga0070675_100412247 | 3300005354 | Bacteria | 1207 |
| 34 | Ga0070671_100530996 | 3300005355 | Bacteria | 1014 |
| 35 | Ga0070673_100180459 | 3300005364 | Bacteria | 1807 |
| 36 | Ga0070673_100497668 | 3300005364 | Bacteria | 1102 |
| 37 | Ga0070688_100142140 | 3300005365 | Bacteria | 1632 |
| 38 | Ga0070659_100010732 | 3300005366 | Bacteria | 6751 |
| 39 | Ga0070659_100141447 | 3300005366 | Unclassified | 1959 |
| 40 | Ga0070667_100202460 | 3300005367 | Bacteria | 1762 |
| 41 | Ga0070667_100558313 | 3300005367 | Bacteria | 1053 |
| 42 | Ga0070709_10840181 | 3300005434 | Bacteria | 723 |
| 43 | Ga0070714_100036717 | 3300005435 | Bacteria | 4112 |
| 44 | Ga0070714_100053931 | 3300005435 | Bacteria | 3434 |
| 45 | Ga0070713_100002481 | 3300005436 | Bacteria | 12047 |
| 46 | Ga0070713_100218040 | 3300005436 | Bacteria | 1730 |
| 47 | Ga0070713_100623328 | 3300005436 | Bacteria | 1026 |
| 48 | Ga0070701_10199215 | 3300005438 | Bacteria | 1183 |
| 49 | Ga0070711_100622198 | 3300005439 | Bacteria | 903 |
| 50 | Ga0070700_100045595 | 3300005441 | Bacteria | 2705 |
| 51 | Ga0070700_100186904 | 3300005441 | Bacteria | 1446 |
| 52 | Ga0070694_100932019 | 3300005444 | Bacteria | 718 |
| 53 | Ga0070708_100226777 | 3300005445 | Bacteria | 1753 |
| 54 | Ga0070663_100275927 | 3300005455 | Bacteria | 1338 |
| 55 | Ga0070663_100519704 | 3300005455 | Unclassified | 991 |
| 56 | Ga0070678_100169033 | 3300005456 | Unclassified | 1779 |
| 57 | Ga0070662_100038573 | 3300005457 | Unclassified | 3393 |
| 58 | Ga0070662_100255684 | 3300005457 | Bacteria | 1410 |
| 59 | Ga0070662_100666216 | 3300005457 | Bacteria | 879 |
| 60 | Ga0070662_100784822 | 3300005457 | Bacteria | 809 |
| 61 | Ga0068867_100307440 | 3300005459 | Bacteria | 1309 |
| 62 | Ga0068867_100507189 | 3300005459 | Bacteria | 1038 |
| 63 | Ga0070685_10270745 | 3300005466 | Bacteria | 1133 |
| 64 | Ga0070706_100005867 | 3300005467 | Bacteria | 11645 |
| 65 | Ga0070707_100004630 | 3300005468 | Bacteria | 12875 |
| 66 | Ga0070698_100010297 | 3300005471 | Bacteria | 9983 |
| 67 | Ga0070698_100076895 | 3300005471 | Unclassified | 3339 |
| 68 | Ga0070698_100606745 | 3300005471 | Bacteria | 1035 |
| 69 | Ga0070698_101113685 | 3300005471 | Bacteria | 738 |
| 70 | Ga0070699_100465083 | 3300005518 | Bacteria | 1147 |
| 71 | Ga0070679_100120267 | 3300005530 | Bacteria | 2611 |
| 72 | Ga0070679_100362678 | 3300005530 | Bacteria | 1396 |
| 73 | Ga0070684_100000866 | 3300005535 | Bacteria | 21424 |
| 74 | Ga0070684_100005712 | 3300005535 | Bacteria | 9555 |
| 75 | Ga0070684_100019112 | 3300005535 | Bacteria | 5664 |
| 76 | Ga0070684_100124582 | 3300005535 | Bacteria | 2320 |
| 77 | Ga0070684_100156853 | 3300005535 | Bacteria | 2064 |
| 78 | Ga0070684_100215665 | 3300005535 | Bacteria | 1750 |
| 79 | Ga0070684_101704559 | 3300005535 | Bacteria | 595 |
| 80 | Ga0068853_100007014 | 3300005539 | Bacteria | 9005 |
| 81 | Ga0068853_100009281 | 3300005539 | Bacteria | 7933 |
| 82 | Ga0068853_100039529 | 3300005539 | Bacteria | 4024 |
| 83 | Ga0068853_100055051 | 3300005539 | Bacteria | 3428 |
| 84 | Ga0068853_100171621 | 3300005539 | Bacteria | 1962 |
| 85 | Ga0068853_100416470 | 3300005539 | Bacteria | 1259 |
| 86 | Ga0068853_101302452 | 3300005539 | Bacteria | 702 |
| 87 | Ga0070672_100279205 | 3300005543 | Unclassified | 1412 |
| 88 | Ga0070695_100890007 | 3300005545 | Bacteria | 718 |
| 89 | Ga0070695_100906054 | 3300005545 | Unclassified | 712 |
| 90 | Ga0070693_100879314 | 3300005547 | Bacteria | 670 |
| 91 | Ga0070665_100531980 | 3300005548 | Bacteria | 1187 |
| 92 | Ga0070665_101153613 | 3300005548 | Bacteria | 786 |
| 93 | Ga0070704_102092984 | 3300005549 | Bacteria | 526 |
| 94 | Ga0068855_100013376 | 3300005563 | Bacteria | 9898 |
| 95 | Ga0068855_100019058 | 3300005563 | Bacteria | 8249 |
| 96 | Ga0068855_100057107 | 3300005563 | Bacteria | 4576 |
| 97 | Ga0068855_100085417 | 3300005563 | Bacteria | 3651 |
| 98 | Ga0068855_100311330 | 3300005563 | Bacteria | 1742 |
| 99 | Ga0068855_101204706 | 3300005563 | Bacteria | 787 |
| 100 | Ga0070664_100001013 | 3300005564 | Bacteria | 22070 |
| 101 | Ga0070664_100001091 | 3300005564 | Bacteria | 21403 |
| 102 | Ga0070664_100030545 | 3300005564 | Bacteria | 4496 |
| 103 | Ga0070664_100071638 | 3300005564 | Bacteria | 2970 |
| 104 | Ga0070664_100096829 | 3300005564 | Unclassified | 2561 |
| 105 | Ga0070664_101084175 | 3300005564 | Unclassified | 754 |
| 106 | Ga0068857_100003966 | 3300005577 | Bacteria | 12461 |
| 107 | Ga0068857_100029668 | 3300005577 | Bacteria | 4827 |
| 108 | Ga0068857_100035926 | 3300005577 | Bacteria | 4390 |
| 109 | Ga0068857_100190602 | 3300005577 | Bacteria | 1867 |
| 110 | Ga0068857_100278147 | 3300005577 | Bacteria | 1539 |
| 111 | Ga0068857_100297688 | 3300005577 | Bacteria | 1487 |
| 112 | Ga0068857_100498659 | 3300005577 | Bacteria | 1142 |
| 113 | Ga0068854_100004399 | 3300005578 | Bacteria | 8890 |
| 114 | Ga0068854_100013235 | 3300005578 | Bacteria | 5407 |
| 115 | Ga0068854_100174763 | 3300005578 | Bacteria | 1673 |
| 116 | Ga0068854_100395923 | 3300005578 | Bacteria | 1142 |
| 117 | Ga0068854_100643426 | 3300005578 | Bacteria | 910 |
| 118 | Ga0068856_100004251 | 3300005614 | Bacteria | 14300 |
| 119 | Ga0068856_100044482 | 3300005614 | Bacteria | 4371 |
| 120 | Ga0068856_100055230 | 3300005614 | Bacteria | 3919 |
| 121 | Ga0068856_100062875 | 3300005614 | Bacteria | 3667 |
| 122 | Ga0068856_100115026 | 3300005614 | Bacteria | 2689 |
| 123 | Ga0068856_100554271 | 3300005614 | Bacteria | 1171 |
| 124 | Ga0068856_100690751 | 3300005614 | Bacteria | 1041 |
| 125 | Ga0068856_100782045 | 3300005614 | Bacteria | 974 |
| 126 | Ga0068852_100002382 | 3300005616 | Bacteria | 12948 |
| 127 | Ga0068852_100024160 | 3300005616 | Bacteria | 4908 |
| 128 | Ga0068852_100070073 | 3300005616 | Bacteria | 3075 |
| 129 | Ga0068852_100492678 | 3300005616 | Bacteria | 1219 |
| 130 | Ga0068852_100869714 | 3300005616 | Bacteria | 917 |
| 131 | Ga0068859_100116618 | 3300005617 | Bacteria | 2735 |
| 132 | Ga0068859_100137080 | 3300005617 | Bacteria | 2521 |
| 133 | Ga0068859_100155691 | 3300005617 | Unclassified | 2362 |
| 134 | Ga0068859_100291569 | 3300005617 | Bacteria | 1725 |
| 135 | Ga0068859_100551144 | 3300005617 | Bacteria | 1247 |
| 136 | Ga0068859_100784776 | 3300005617 | Bacteria | 1041 |
| 137 | Ga0068864_100039887 | 3300005618 | Unclassified | 4014 |
| 138 | Ga0068864_100578909 | 3300005618 | Bacteria | 1088 |
| 139 | Ga0068864_100657608 | 3300005618 | Bacteria | 1021 |
| 140 | Ga0068861_100040137 | 3300005719 | Bacteria | 3498 |
| 141 | Ga0068861_100048268 | 3300005719 | Bacteria | 3217 |
| 142 | Ga0068861_100992394 | 3300005719 | Bacteria | 801 |
| 143 | Ga0068851_10008128 | 3300005834 | Bacteria | 4842 |
| 144 | Ga0068851_10022338 | 3300005834 | Bacteria | 3080 |
| 145 | Ga0068863_100395505 | 3300005841 | Bacteria | 1351 |
| 146 | Ga0068863_100567498 | 3300005841 | Bacteria | 1121 |
| 147 | Ga0068858_100170097 | 3300005842 | Bacteria | 2054 |
| 148 | Ga0068858_100841792 | 3300005842 | Bacteria | 896 |
| 149 | Ga0068860_100010741 | 3300005843 | Bacteria | 9039 |
| 150 | Ga0068862_100081350 | 3300005844 | Bacteria | 2810 |
| 151 | Ga0068862_100545506 | 3300005844 | Unclassified | 1106 |
| 152 | Ga0081538_10009408 | 3300005981 | Bacteria | 8164 |
| 153 | Ga0081538_10124458 | 3300005981 | Bacteria | 1230 |
| 154 | Ga0070717_10000329 | 3300006028 | Bacteria | 30746 |
| 155 | Ga0070717_10592057 | 3300006028 | Bacteria | 1006 |
| 156 | Ga0070717_11489515 | 3300006028 | Bacteria | 614 |
| 157 | Ga0075368_10042008 | 3300006042 | Bacteria | 1798 |
| 158 | Ga0070712_100852315 | 3300006175 | Bacteria | 784 |
| 159 | Ga0070712_100865779 | 3300006175 | Bacteria | 778 |
| 160 | Ga0075366_10570920 | 3300006195 | Bacteria | 701 |
| 161 | Ga0075366_10679661 | 3300006195 | Bacteria | 639 |
| 162 | Ga0097621_100034307 | 3300006237 | Bacteria | 4047 |
| 163 | Ga0068871_100111737 | 3300006358 | Bacteria | 2299 |
| 164 | Ga0068871_100174289 | 3300006358 | Bacteria | 1845 |
| 165 | Ga0068871_100237352 | 3300006358 | Bacteria | 1584 |
| 166 | Ga0068871_100488112 | 3300006358 | Bacteria | 1109 |
| 167 | Ga0075428_100057010 | 3300006844 | Bacteria | 4278 |
| 168 | Ga0075428_100973148 | 3300006844 | Bacteria | 899 |
| 169 | Ga0075430_101034412 | 3300006846 | Bacteria | 677 |
| 170 | Ga0075429_100017742 | 3300006880 | Bacteria | 6154 |
| 171 | Ga0068865_100283048 | 3300006881 | Bacteria | 1321 |
| 172 | Ga0068865_101202321 | 3300006881 | Bacteria | 671 |
| 173 | Ga0068865_101993136 | 3300006881 | Unclassified | 527 |
| 174 | Ga0075436_100020045 | 3300006914 | Bacteria | 4589 |
| 175 | Ga0097620_100116618 | 3300006931 | Bacteria | 2735 |
| 176 | Ga0097620_100137076 | 3300006931 | Bacteria | 2521 |
| 177 | Ga0097620_100155703 | 3300006931 | Unclassified | 2362 |
| 178 | Ga0097620_100291579 | 3300006931 | Bacteria | 1725 |
| 179 | Ga0097620_100551141 | 3300006931 | Bacteria | 1247 |
| 180 | Ga0097620_100784798 | 3300006931 | Bacteria | 1041 |
| 181 | Ga0075435_100691635 | 3300007076 | Bacteria | 886 |
| 182 | Ga0105240_10004314 | 3300009093 | Bacteria | 21713 |
| 183 | Ga0105240_10015110 | 3300009093 | Bacteria | 10508 |
| 184 | Ga0105240_10026349 | 3300009093 | Bacteria | 7627 |
| 185 | Ga0105240_10117551 | 3300009093 | Bacteria | 3205 |
| 186 | Ga0105240_10186224 | 3300009093 | Bacteria | 2445 |
| 187 | Ga0105240_10288061 | 3300009093 | Bacteria | 1884 |
| 188 | Ga0105240_10484418 | 3300009093 | Bacteria | 1378 |
| 189 | Ga0105240_11030582 | 3300009093 | Bacteria | 879 |
| 190 | Ga0111539_10583424 | 3300009094 | Bacteria | 1302 |
| 191 | Ga0111539_12398453 | 3300009094 | Bacteria | 612 |
| 192 | Ga0105247_10007691 | 3300009101 | Bacteria | 6594 |
| 193 | Ga0105247_10035454 | 3300009101 | Bacteria | 3041 |
| 194 | Ga0114129_11477144 | 3300009147 | Bacteria | 836 |
| 195 | Ga0105241_10009831 | 3300009174 | Bacteria | 7030 |
| 196 | Ga0105241_10078395 | 3300009174 | Bacteria | 2581 |
| 197 | Ga0105241_10114327 | 3300009174 | Bacteria | 2165 |
| 198 | Ga0105241_10131077 | 3300009174 | Bacteria | 2030 |
| 199 | Ga0105241_10256564 | 3300009174 | Bacteria | 1485 |
| 200 | Ga0105241_10378856 | 3300009174 | Bacteria | 1236 |
| 201 | Ga0105241_11140417 | 3300009174 | Bacteria | 736 |
| 202 | Ga0105242_10069851 | 3300009176 | Bacteria | 2910 |
| 203 | Ga0105248_10648470 | 3300009177 | Bacteria | 1191 |
| 204 | Ga0105248_10915646 | 3300009177 | Unclassified | 990 |
| 205 | Ga0105248_12162708 | 3300009177 | Bacteria | 633 |
| 206 | Ga0105248_12673506 | 3300009177 | Bacteria | 569 |
| 207 | Ga0105237_10035169 | 3300009545 | Bacteria | 5070 |
| 208 | Ga0105237_10089762 | 3300009545 | Bacteria | 3062 |
| 209 | Ga0105237_10107704 | 3300009545 | Bacteria | 2779 |
| 210 | Ga0105237_10161812 | 3300009545 | Bacteria | 2237 |
| 211 | Ga0105237_10240538 | 3300009545 | Bacteria | 1811 |
| 212 | Ga0105237_10744899 | 3300009545 | Bacteria | 986 |
| 213 | Ga0105238_10001137 | 3300009551 | Bacteria | 26839 |
| 214 | Ga0105238_10008597 | 3300009551 | Bacteria | 10215 |
| 215 | Ga0105238_10031322 | 3300009551 | Bacteria | 5413 |
| 216 | Ga0105238_10101023 | 3300009551 | Bacteria | 2867 |
| 217 | Ga0105238_10669675 | 3300009551 | Bacteria | 1049 |
| 218 | Ga0105249_10003199 | 3300009553 | Bacteria | 14176 |
| 219 | Ga0105249_10009092 | 3300009553 | Bacteria | 8688 |
| 220 | Ga0105249_10045511 | 3300009553 | Bacteria | 3992 |
| 221 | Ga0105249_10500425 | 3300009553 | Bacteria | 1260 |
| 222 | Ga0105249_10612081 | 3300009553 | Bacteria | 1145 |
| 223 | Ga0099796_10042712 | 3300010159 | Bacteria | 1541 |
| 224 | Ga0105239_10016514 | 3300010375 | Bacteria | 8164 |
| 225 | Ga0105239_10036415 | 3300010375 | Bacteria | 5402 |
| 226 | Ga0105239_10090452 | 3300010375 | Bacteria | 3377 |
| 227 | Ga0105239_10273515 | 3300010375 | Bacteria | 1900 |
| 228 | Ga0105246_10145866 | 3300011119 | Bacteria | 1785 |
| 229 | Ga0105246_10270137 | 3300011119 | Bacteria | 1359 |
| 230 | Ga0105246_10480388 | 3300011119 | Bacteria | 1051 |
| 231 | Ga0157373_10004071 | 3300013100 | Bacteria | 11016 |
| 232 | Ga0157373_10186025 | 3300013100 | Bacteria | 1463 |
| 233 | Ga0157373_10411871 | 3300013100 | Bacteria | 970 |
| 234 | Ga0157371_10370173 | 3300013102 | Bacteria | 1045 |
| 235 | Ga0157370_10013002 | 3300013104 | Bacteria | 8598 |
| 236 | Ga0157370_10139812 | 3300013104 | Bacteria | 2256 |
| 237 | Ga0157370_10432869 | 3300013104 | Bacteria | 1210 |
| 238 | Ga0157369_10007484 | 3300013105 | Bacteria | 12567 |
| 239 | Ga0157369_10163239 | 3300013105 | Bacteria | 2350 |
| 240 | Ga0157369_10392689 | 3300013105 | Bacteria | 1439 |
| 241 | Ga0157369_10796371 | 3300013105 | Bacteria | 971 |
| 242 | Ga0157369_10842600 | 3300013105 | Bacteria | 941 |
| 243 | Ga0157374_10006243 | 3300013296 | Bacteria | 10106 |
| 244 | Ga0157374_10036265 | 3300013296 | Bacteria | 4515 |
| 245 | Ga0157374_10197673 | 3300013296 | Bacteria | 1968 |
| 246 | Ga0157374_10272124 | 3300013296 | Bacteria | 1670 |
| 247 | Ga0157374_11369855 | 3300013296 | Bacteria | 730 |
| 248 | Ga0157378_10111222 | 3300013297 | Bacteria | 2511 |
| 249 | Ga0157378_10774444 | 3300013297 | Unclassified | 984 |
| 250 | Ga0157378_11082950 | 3300013297 | Bacteria | 838 |
| 251 | Ga0163162_10147148 | 3300013306 | Unclassified | 2472 |
| 252 | Ga0163162_10273412 | 3300013306 | Bacteria | 1821 |
| 253 | Ga0163162_10342250 | 3300013306 | Unclassified | 1628 |
| 254 | Ga0163162_12751498 | 3300013306 | Unclassified | 566 |
| 255 | Ga0157372_10006264 | 3300013307 | Bacteria | 12657 |
| 256 | Ga0157372_10260709 | 3300013307 | Bacteria | 2013 |
| 257 | Ga0157372_10549602 | 3300013307 | Bacteria | 1346 |
| 258 | Ga0157372_10710172 | 3300013307 | Bacteria | 1170 |
| 259 | Ga0157372_13141710 | 3300013307 | Unclassified | 527 |
| 260 | Ga0157375_10018953 | 3300013308 | Bacteria | 6247 |
| 261 | Ga0157375_10073852 | 3300013308 | Bacteria | 3430 |
| 262 | Ga0163163_10005024 | 3300014325 | Bacteria | 11401 |
| 263 | Ga0163163_10041679 | 3300014325 | Bacteria | 4491 |
| 264 | Ga0163163_10596340 | 3300014325 | Bacteria | 1168 |
| 265 | Ga0163163_11219135 | 3300014325 | Unclassified | 815 |
| 266 | Ga0157380_10209597 | 3300014326 | Bacteria | 1735 |
| 267 | Ga0157379_10162118 | 3300014968 | Bacteria | 2018 |
| 268 | Ga0157379_10203809 | 3300014968 | Unclassified | 1789 |
| 269 | Ga0157379_10391773 | 3300014968 | Bacteria | 1276 |
| 270 | Ga0157379_10440606 | 3300014968 | Unclassified | 1201 |
| 271 | Ga0157376_11023168 | 3300014969 | Bacteria | 849 |
| 272 | Ga0157376_11367824 | 3300014969 | Bacteria | 739 |
| 273 | Ga0163161_10137955 | 3300017792 | Bacteria | 1845 |
| 274 | Ga0197907_10787107 | 3300020069 | Bacteria | 674 |
| 275 | Ga0206356_10132939 | 3300020070 | Bacteria | 696 |
| 276 | Ga0213872_10252446 | 3300021361 | Bacteria | 743 |
| 277 | Ga0207697_10035593 | 3300025315 | Bacteria | 2038 |
| 278 | Ga0207692_10115034 | 3300025898 | Bacteria | 1498 |
| 279 | Ga0207710_10002424 | 3300025900 | Bacteria | 8684 |
| 280 | Ga0207710_10034330 | 3300025900 | Bacteria | 2228 |
| 281 | Ga0207710_10476052 | 3300025900 | Unclassified | 646 |
| 282 | Ga0207680_10404464 | 3300025903 | Bacteria | 965 |
| 283 | Ga0207647_10000685 | 3300025904 | Bacteria | 26588 |
| 284 | Ga0207647_10042037 | 3300025904 | Unclassified | 2870 |
| 285 | Ga0207647_10548496 | 3300025904 | Unclassified | 641 |
| 286 | Ga0207685_10235209 | 3300025905 | Bacteria | 878 |
| 287 | Ga0207699_10306216 | 3300025906 | Bacteria | 1111 |
| 288 | Ga0207699_10440680 | 3300025906 | Bacteria | 933 |
| 289 | Ga0207699_10617645 | 3300025906 | Bacteria | 790 |
| 290 | Ga0207699_10668940 | 3300025906 | Bacteria | 759 |
| 291 | Ga0207645_10091003 | 3300025907 | Bacteria | 1962 |
| 292 | Ga0207645_10640039 | 3300025907 | Bacteria | 722 |
| 293 | Ga0207705_10021706 | 3300025909 | Bacteria | 4580 |
| 294 | Ga0207705_10471162 | 3300025909 | Bacteria | 975 |
| 295 | Ga0207684_10107810 | 3300025910 | Bacteria | 2383 |
| 296 | Ga0207654_10076140 | 3300025911 | Bacteria | 2007 |
| 297 | Ga0207654_10139945 | 3300025911 | Bacteria | 1542 |
| 298 | Ga0207654_10212393 | 3300025911 | Bacteria | 1279 |
| 299 | Ga0207707_10000570 | 3300025912 | Bacteria | 37419 |
| 300 | Ga0207707_10211437 | 3300025912 | Bacteria | 1689 |
| 301 | Ga0207707_10260093 | 3300025912 | Bacteria | 1506 |
| 302 | Ga0207695_10020606 | 3300025913 | Bacteria | 7549 |
| 303 | Ga0207695_10021907 | 3300025913 | Bacteria | 7274 |
| 304 | Ga0207695_10046485 | 3300025913 | Bacteria | 4602 |
| 305 | Ga0207695_10059410 | 3300025913 | Bacteria | 3964 |
| 306 | Ga0207695_10153320 | 3300025913 | Bacteria | 2241 |
| 307 | Ga0207695_10156005 | 3300025913 | Bacteria | 2217 |
| 308 | Ga0207671_10053393 | 3300025914 | Bacteria | 2994 |
| 309 | Ga0207671_10103648 | 3300025914 | Bacteria | 2157 |
| 310 | Ga0207671_10129941 | 3300025914 | Bacteria | 1933 |
| 311 | Ga0207671_11102178 | 3300025914 | Bacteria | 624 |
| 312 | Ga0207693_10183371 | 3300025915 | Bacteria | 1647 |
| 313 | Ga0207693_10477567 | 3300025915 | Bacteria | 973 |
| 314 | Ga0207693_10854466 | 3300025915 | Bacteria | 700 |
| 315 | Ga0207663_10372211 | 3300025916 | Bacteria | 1086 |
| 316 | Ga0207660_10012565 | 3300025917 | Bacteria | 5545 |
| 317 | Ga0207657_10007975 | 3300025919 | Bacteria | 10794 |
| 318 | Ga0207649_10005003 | 3300025920 | Bacteria | 7165 |
| 319 | Ga0207649_10010573 | 3300025920 | Bacteria | 5076 |
| 320 | Ga0207649_10023904 | 3300025920 | Unclassified | 3545 |
| 321 | Ga0207649_10357769 | 3300025920 | Bacteria | 1082 |
| 322 | Ga0207652_10053166 | 3300025921 | Bacteria | 3478 |
| 323 | Ga0207652_10101259 | 3300025921 | Bacteria | 2544 |
| 324 | Ga0207652_10164834 | 3300025921 | Bacteria | 1987 |
| 325 | Ga0207652_10357636 | 3300025921 | Bacteria | 1318 |
| 326 | Ga0207646_10013658 | 3300025922 | Bacteria | 7756 |
| 327 | Ga0207681_11105266 | 3300025923 | Unclassified | 666 |
| 328 | Ga0207694_10004254 | 3300025924 | Bacteria | 11217 |
| 329 | Ga0207694_10573187 | 3300025924 | Bacteria | 948 |
| 330 | Ga0207694_10916804 | 3300025924 | Bacteria | 741 |
| 331 | Ga0207650_10406838 | 3300025925 | Bacteria | 1127 |
| 332 | Ga0207650_10681030 | 3300025925 | Bacteria | 868 |
| 333 | Ga0207700_10007850 | 3300025928 | Bacteria | 6562 |
| 334 | Ga0207700_11459780 | 3300025928 | Bacteria | 607 |
| 335 | Ga0207664_10001915 | 3300025929 | Bacteria | 13663 |
| 336 | Ga0207664_10047300 | 3300025929 | Bacteria | 3378 |
| 337 | Ga0207664_10413576 | 3300025929 | Bacteria | 1201 |
| 338 | Ga0207644_10861302 | 3300025931 | Unclassified | 759 |
| 339 | Ga0207644_10887655 | 3300025931 | Bacteria | 747 |
| 340 | Ga0207644_11134706 | 3300025931 | Bacteria | 657 |
| 341 | Ga0207690_10026270 | 3300025932 | Bacteria | 3666 |
| 342 | Ga0207690_10074575 | 3300025932 | Bacteria | 2350 |
| 343 | Ga0207690_10804679 | 3300025932 | Bacteria | 777 |
| 344 | Ga0207690_10913729 | 3300025932 | Bacteria | 728 |
| 345 | Ga0207706_10095679 | 3300025933 | Bacteria | 2612 |
| 346 | Ga0207706_10130479 | 3300025933 | Unclassified | 2210 |
| 347 | Ga0207706_10633205 | 3300025933 | Bacteria | 917 |
| 348 | Ga0207706_11085158 | 3300025933 | Unclassified | 669 |
| 349 | Ga0207686_10088110 | 3300025934 | Bacteria | 2043 |
| 350 | Ga0207686_10598028 | 3300025934 | Unclassified | 868 |
| 351 | Ga0207670_10007419 | 3300025936 | Bacteria | 6118 |
| 352 | Ga0207670_10027763 | 3300025936 | Unclassified | 3584 |
| 353 | Ga0207670_10465185 | 3300025936 | Bacteria | 1022 |
| 354 | Ga0207670_10650303 | 3300025936 | Bacteria | 869 |
| 355 | Ga0207669_11593593 | 3300025937 | Bacteria | 557 |
| 356 | Ga0207704_10188645 | 3300025938 | Unclassified | 1497 |
| 357 | Ga0207704_11203451 | 3300025938 | Bacteria | 646 |
| 358 | Ga0207665_10484409 | 3300025939 | Bacteria | 953 |
| 359 | Ga0207691_10061982 | 3300025940 | Unclassified | 3396 |
| 360 | Ga0207691_10416418 | 3300025940 | Bacteria | 1145 |
| 361 | Ga0207689_10003767 | 3300025942 | Bacteria | 13815 |
| 362 | Ga0207689_10043742 | 3300025942 | Bacteria | 3702 |
| 363 | Ga0207661_10000392 | 3300025944 | Bacteria | 28407 |
| 364 | Ga0207661_10022874 | 3300025944 | Bacteria | 4714 |
| 365 | Ga0207661_10051028 | 3300025944 | Unclassified | 3299 |
| 366 | Ga0207661_10058236 | 3300025944 | Bacteria | 3109 |
| 367 | Ga0207661_10176822 | 3300025944 | Bacteria | 1861 |
| 368 | Ga0207679_10001465 | 3300025945 | Bacteria | 14786 |
| 369 | Ga0207679_10001859 | 3300025945 | Bacteria | 13118 |
| 370 | Ga0207679_10458710 | 3300025945 | Bacteria | 1131 |
| 371 | Ga0207679_11656533 | 3300025945 | Unclassified | 586 |
| 372 | Ga0207667_10031999 | 3300025949 | Bacteria | 5673 |
| 373 | Ga0207667_10033361 | 3300025949 | Bacteria | 5535 |
| 374 | Ga0207667_10071701 | 3300025949 | Bacteria | 3601 |
| 375 | Ga0207667_10805909 | 3300025949 | Bacteria | 935 |
| 376 | Ga0207667_11065841 | 3300025949 | Bacteria | 793 |
| 377 | Ga0207667_11637949 | 3300025949 | Bacteria | 611 |
| 378 | Ga0207712_10002412 | 3300025961 | Bacteria | 12085 |
| 379 | Ga0207712_10009047 | 3300025961 | Bacteria | 6301 |
| 380 | Ga0207712_10065117 | 3300025961 | Bacteria | 2600 |
| 381 | Ga0207712_10280007 | 3300025961 | Bacteria | 1361 |
| 382 | Ga0207712_10336921 | 3300025961 | Bacteria | 1250 |
| 383 | Ga0207668_10978585 | 3300025972 | Unclassified | 755 |
| 384 | Ga0207640_10011681 | 3300025981 | Bacteria | 4978 |
| 385 | Ga0207640_10224805 | 3300025981 | Bacteria | 1439 |
| 386 | Ga0207640_10337907 | 3300025981 | Bacteria | 1205 |
| 387 | Ga0207658_10490975 | 3300025986 | Bacteria | 1092 |
| 388 | Ga0207677_10017200 | 3300026023 | Unclassified | 4305 |
| 389 | Ga0207677_10395374 | 3300026023 | Bacteria | 1171 |
| 390 | Ga0207677_12070497 | 3300026023 | Bacteria | 529 |
| 391 | Ga0207703_10072251 | 3300026035 | Bacteria | 2852 |
| 392 | Ga0207703_10449464 | 3300026035 | Bacteria | 1203 |
| 393 | Ga0207703_10592041 | 3300026035 | Bacteria | 1048 |
| 394 | Ga0207639_10003536 | 3300026041 | Bacteria | 10494 |
| 395 | Ga0207639_10006299 | 3300026041 | Bacteria | 8061 |
| 396 | Ga0207639_10040707 | 3300026041 | Bacteria | 3470 |
| 397 | Ga0207639_10174266 | 3300026041 | Bacteria | 1824 |
| 398 | Ga0207639_10264318 | 3300026041 | Bacteria | 1506 |
| 399 | Ga0207639_11141608 | 3300026041 | Bacteria | 731 |
| 400 | Ga0207678_10329650 | 3300026067 | Bacteria | 1314 |
| 401 | Ga0207678_10636980 | 3300026067 | Bacteria | 936 |
| 402 | Ga0207708_10146882 | 3300026075 | Bacteria | 1853 |
| 403 | Ga0207708_10392807 | 3300026075 | Bacteria | 1146 |
| 404 | Ga0207702_10004005 | 3300026078 | Bacteria | 13233 |
| 405 | Ga0207702_10044939 | 3300026078 | Bacteria | 3714 |
| 406 | Ga0207702_10568936 | 3300026078 | Bacteria | 1110 |
| 407 | Ga0207702_10619772 | 3300026078 | Bacteria | 1062 |
| 408 | Ga0207641_10306079 | 3300026088 | Unclassified | 1503 |
| 409 | Ga0207641_10625403 | 3300026088 | Bacteria | 1056 |
| 410 | Ga0207641_10701429 | 3300026088 | Bacteria | 997 |
| 411 | Ga0207648_10015367 | 3300026089 | Bacteria | 7043 |
| 412 | Ga0207648_10338924 | 3300026089 | Bacteria | 1354 |
| 413 | Ga0207676_10049620 | 3300026095 | Unclassified | 3266 |
| 414 | Ga0207676_10139909 | 3300026095 | Bacteria | 2071 |
| 415 | Ga0207676_10412658 | 3300026095 | Bacteria | 1265 |
| 416 | Ga0207674_10004712 | 3300026116 | Bacteria | 16356 |
| 417 | Ga0207674_10006966 | 3300026116 | Bacteria | 13232 |
| 418 | Ga0207674_10015148 | 3300026116 | Bacteria | 8485 |
| 419 | Ga0207674_10034943 | 3300026116 | Bacteria | 5249 |
| 420 | Ga0207674_10044733 | 3300026116 | Bacteria | 4560 |
| 421 | Ga0207674_10081159 | 3300026116 | Bacteria | 3245 |
| 422 | Ga0207674_10495951 | 3300026116 | Bacteria | 1180 |
| 423 | Ga0207674_11102050 | 3300026116 | Bacteria | 763 |
| 424 | Ga0207675_100005780 | 3300026118 | Bacteria | 11828 |
| 425 | Ga0207675_100076379 | 3300026118 | Bacteria | 3137 |
| 426 | Ga0207675_101466047 | 3300026118 | Bacteria | 703 |
| 427 | Ga0207675_102000917 | 3300026118 | Unclassified | 597 |
| 428 | Ga0207683_11688598 | 3300026121 | Bacteria | 583 |
| 429 | Ga0207698_10013808 | 3300026142 | Bacteria | 5345 |
| 430 | Ga0207698_10105083 | 3300026142 | Bacteria | 2352 |
| 431 | Ga0207698_10281553 | 3300026142 | Bacteria | 1538 |
| 432 | Ga0207698_10501413 | 3300026142 | Bacteria | 1181 |
| 433 | Ga0207698_11359374 | 3300026142 | Bacteria | 725 |
| 434 | Ga0209179_1008569 | 3300027512 | Bacteria | 1727 |
| 435 | Ga0209813_10047796 | 3300027866 | Bacteria | 1326 |
| 436 | Ga0268266_10461551 | 3300028379 | Bacteria | 1208 |
| 437 | Ga0268266_10718803 | 3300028379 | Bacteria | 963 |
| 438 | Ga0268265_10058694 | 3300028380 | Bacteria | 2939 |
| 439 | Ga0268264_10000447 | 3300028381 | Bacteria | 56371 |
| 440 | Ga0268264_10220455 | 3300028381 | Bacteria | 1746 |
| 441 | Ga0268264_10388456 | 3300028381 | Unclassified | 1338 |
| 442 | Ga0265334_10047500 | 3300028573 | Bacteria | 1656 |
| 443 | Ga0265330_10115955 | 3300031235 | Bacteria | 1142 |
| 444 | Ga0265332_10037701 | 3300031238 | Bacteria | 2096 |
| 445 | Ga0265328_10010377 | 3300031239 | Bacteria | 3753 |
| 446 | Ga0265325_10012028 | 3300031241 | Bacteria | 4958 |
| 447 | Ga0265325_10041753 | 3300031241 | Bacteria | 2402 |
| 448 | Ga0265339_10008736 | 3300031249 | Bacteria | 6422 |
| 449 | Ga0265339_10074737 | 3300031249 | Bacteria | 1800 |
| 450 | Ga0307509_10078803 | 3300031507 | Bacteria | 3412 |
| 451 | Ga0307509_10346687 | 3300031507 | Bacteria | 1210 |
| 452 | Ga0265313_10118653 | 3300031595 | Bacteria | 1156 |
| 453 | Ga0307508_10059545 | 3300031616 | Bacteria | 3378 |
| 454 | Ga0307413_10066749 | 3300031824 | Bacteria | 2246 |
| 455 | Ga0307410_10151098 | 3300031852 | Bacteria | 1729 |
| 456 | Ga0307410_11183907 | 3300031852 | Bacteria | 665 |
| 457 | Ga0307414_11559866 | 3300032004 | Bacteria | 615 |
| 458 | Ga0373926_0065811 | 3300035083 | Bacteria | 1326 |
| 459 | Ga0373934_0001254 | 3300035086 | Bacteria | 9244 |
| 460 | Ga0373923_0002592 | 3300035111 | Bacteria | 5606 |
| 461 | Ga0373923_0003206 | 3300035111 | Bacteria | 5201 |
| 462 | Ga0373936_0000357 | 3300035113 | Bacteria | 15537 |
| 463 | Ga0373945_0010231 | 3300035116 | Bacteria | 3086 |
| 464 | Ga0373953_0001405 | 3300035117 | Bacteria | 6949 |
| 465 | Ga0373953_0008757 | 3300035117 | Bacteria | 3449 |
| 466 | Ga0373954_0002033 | 3300035118 | Bacteria | 8407 |
| 467 | Ga0373954_0002625 | 3300035118 | Bacteria | 7566 |
| 468 | Ga0373956_0001441 | 3300035119 | Bacteria | 9830 |
| 469 | Ga0373957_0006390 | 3300035120 | Bacteria | 3709 |
| 470 | Ga0373957_0016029 | 3300035120 | Bacteria | 2589 |
| 471 | Ga0373943_0000664 | 3300035170 | Bacteria | 14926 |
| 472 | Ga0373946_0001722 | 3300035171 | Bacteria | 7628 |
| 473 | Ga0373955_0002159 | 3300035172 | Bacteria | 8506 |
| 474 | Ga0373955_0003007 | 3300035172 | Bacteria | 7388 |
| 475 | Ga0373924_0001935 | 3300035410 | Bacteria | 6884 |
| 476 | Ga0373924_0007514 | 3300035410 | Bacteria | 3937 |
| 477 | Ga0373935_0000224 | 3300035692 | Bacteria | 27599 |
| 478 | Ga0373935_0380189 | 3300035692 | Bacteria | 1011 |
| 479 | Ga0373927_0021415 | 3300035695 | Bacteria | 4237 |
| 480 | Ga0373933_0000017 | 3300035724 | Bacteria | 100816 |
| 481 | Ga0373933_0004005 | 3300035724 | Bacteria | 8119 |
| 482 | Ga0373933_0025276 | 3300035724 | Bacteria | 3405 |
| 483 | Ga0373947_0011148 | 3300035725 | Bacteria | 5162 |
| 484 | Ga0373947_0093237 | 3300035725 | Bacteria | 1882 |
| 485 | Ga0373937_0001096 | 3300036401 | Bacteria | 22797 |
| 486 | Ga0373937_0079220 | 3300036401 | Bacteria | 3036 |
| 487 | Ga0373925_0000016 | 3300037068 | Bacteria | 176830 |
| 488 | Ga0395899_0682219 | 3300037312 | Unclassified | 646 |
| 489 | Ga0395900_1203945 | 3300037418 | Bacteria | 673 |
| 490 | Ga0395898_0107845 | 3300037466 | Bacteria | 2671 |
| 491 | Ga0395905_0388339 | 3300037471 | Bacteria | 1290 |
| 492 | Ga0395905_0655814 | 3300037471 | Bacteria | 951 |
| 493 | Ga0395901_0095046 | 3300038443 | Bacteria | 3123 |
| 494 | Ga0395901_0517507 | 3300038443 | Bacteria | 1213 |
| 495 | Ga0395901_0986358 | 3300038443 | Bacteria | 819 |
| 496 | Ga0436360_0205661 | 3300039438 | Bacteria | 740 |
| 497 | Ga0436361_0683511 | 3300039447 | Bacteria | 932 |
| 498 | Ga0451804_0654551 | 3300041463 | Bacteria | 777 |
| 499 | Ga0451807_1517432 | 3300041486 | Bacteria | 1414 |
| 500 | Ga0439435_0128685 | 3300042436 | Bacteria | 798 |
| 501 | Ga0451577_0872651 | 3300042876 | Bacteria | 811 |
| 502 | Ga0466961_0230819 | 3300044693 | Bacteria | 1139 |
| 503 | Ga0466963_0464256 | 3300044694 | Bacteria | 893 |
| 504 | Ga0453684_0140750 | 3300044712 | Bacteria | 2881 |
| 505 | Ga0466971_0089837 | 3300044719 | Bacteria | 1406 |
| 506 | Ga0466957_0379686 | 3300044842 | Bacteria | 963 |
| 507 | Ga0466960_0017393 | 3300044901 | Bacteria | 3134 |
| 508 | Ga0466960_0089253 | 3300044901 | Bacteria | 1568 |
| 509 | Ga0466959_0110346 | 3300045049 | Bacteria | 1964 |
| 510 | Ga0466959_0373679 | 3300045049 | Bacteria | 971 |
| 511 | Ga0451576_1137976 | 3300045051 | Bacteria | 816 |
| 512 | Ga0466958_0010359 | 3300045836 | Bacteria | 5221 |
| 513 | Ga0466958_0306486 | 3300045836 | Bacteria | 1020 |
| 514 | Ga0466967_1920476 | 3300045976 | Bacteria | 589 |
| 515 | Ga0495592_0000658 | 3300046454 | Bacteria | 24004 |
| 516 | Ga0495592_0027451 | 3300046454 | Bacteria | 4316 |
| 517 | Ga0495629_0001206 | 3300046459 | Bacteria | 20341 |
| 518 | Ga0495629_0011770 | 3300046459 | Bacteria | 6349 |
| 519 | Ga0495651_0000253 | 3300046462 | Bacteria | 41413 |
| 520 | Ga0495651_0221355 | 3300046462 | Bacteria | 1309 |
| 521 | Ga0495653_0000045 | 3300046463 | Bacteria | 115410 |
| 522 | Ga0495653_0007406 | 3300046463 | Bacteria | 8989 |
| 523 | Ga0495580_0415803 | 3300046472 | Bacteria | 905 |
| 524 | Ga0495662_0020376 | 3300046476 | Bacteria | 3207 |
| 525 | Ga0495664_0000004 | 3300046477 | Bacteria | 489411 |
| 526 | Ga0495664_0102623 | 3300046477 | Bacteria | 1724 |
| 527 | Ga0495608_0000017 | 3300046511 | Bacteria | 192929 |
| 528 | Ga0495608_0031076 | 3300046511 | Bacteria | 3612 |
| 529 | Ga0495618_0000350 | 3300046514 | Bacteria | 33025 |
| 530 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 531 | Ga0495628_0011177 | 3300046516 | Bacteria | 7597 |
| 532 | Ga0495630_0006902 | 3300046517 | Bacteria | 8095 |
| 533 | Ga0495663_0044398 | 3300046525 | Bacteria | 1360 |
| 534 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 535 | Ga0495652_0023745 | 3300046529 | Bacteria | 5434 |
| 536 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 537 | Ga0495640_0080679 | 3300046533 | Bacteria | 2163 |
| 538 | Ga0495587_0000008 | 3300046536 | Bacteria | 271097 |
| 539 | Ga0495587_0011834 | 3300046536 | Bacteria | 5515 |
| 540 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 541 | Ga0495645_0019910 | 3300046543 | Bacteria | 4837 |
| 542 | Ga0495667_0000029 | 3300046559 | Bacteria | 151568 |
| 543 | Ga0495667_0056834 | 3300046559 | Bacteria | 2572 |
| 544 | Ga0495634_0000339 | 3300046642 | Bacteria | 45231 |
| 545 | Ga0495634_0012302 | 3300046642 | Bacteria | 6201 |
| 546 | Ga0495625_0012614 | 3300046660 | Bacteria | 6839 |
| 547 | Ga0495635_0000002 | 3300046663 | Bacteria | 490490 |
| 548 | Ga0495635_0002216 | 3300046663 | Bacteria | 13218 |
| 549 | Ga0495657_0000064 | 3300046675 | Bacteria | 94324 |
| 550 | Ga0495657_0034350 | 3300046675 | Bacteria | 3522 |
| 551 | Ga0495599_0000064 | 3300046678 | Bacteria | 73422 |
| 552 | Ga0495599_0056876 | 3300046678 | Bacteria | 2447 |
| 553 | Ga0495623_0000065 | 3300046679 | Bacteria | 65151 |
| 554 | Ga0495623_0026792 | 3300046679 | Bacteria | 3709 |
| 555 | Ga0495646_0000023 | 3300046680 | Bacteria | 110212 |
| 556 | Ga0495646_0019235 | 3300046680 | Bacteria | 4325 |
| 557 | Ga0495613_0017402 | 3300046689 | Bacteria | 5355 |
| 558 | Ga0495613_0025125 | 3300046689 | Bacteria | 4439 |
| 559 | Ga0495600_0000010 | 3300046809 | Bacteria | 143675 |
| 560 | Ga0495600_0051002 | 3300046809 | Bacteria | 2700 |
| 561 | Ga0495604_0000009 | 3300047317 | Bacteria | 326341 |
| 562 | Ga0495604_0026169 | 3300047317 | Bacteria | 4644 |
| 563 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 564 | Ga0495674_0273479 | 3300047319 | Bacteria | 1385 |
| 565 | Ga0495676_0630418 | 3300047321 | Bacteria | 697 |
| 566 | Ga0495680_0002286 | 3300047322 | Bacteria | 19735 |
| 567 | Ga0495680_0034917 | 3300047322 | Bacteria | 4055 |
| 568 | Ga0495675_0000388 | 3300047444 | Bacteria | 30389 |
| 569 | Ga0495675_0002252 | 3300047444 | Bacteria | 11525 |
| 570 | Ga0495684_0000006 | 3300047471 | Bacteria | 247568 |
| 571 | Ga0495684_0000954 | 3300047471 | Bacteria | 23525 |
| 572 | Ga0495593_0003081 | 3300047673 | Bacteria | 10023 |
| 573 | Ga0495593_0004012 | 3300047673 | Bacteria | 8773 |
| 574 | Ga0495602_0002184 | 3300048088 | Bacteria | 19759 |
| 575 | Ga0495602_0042607 | 3300048088 | Bacteria | 4133 |
| 576 | Ga0496100_0347094 | 3300048903 | Bacteria | 1120 |
| 577 | Ga0496105_0031676 | 3300048908 | Bacteria | 4336 |
| 578 | Ga0496106_0142059 | 3300048909 | Bacteria | 1889 |
| 579 | Ga0496107_0407465 | 3300048910 | Bacteria | 1011 |
| 580 | Ga0496108_0736460 | 3300048911 | Bacteria | 853 |
| 581 | Ga0496109_0407018 | 3300048912 | Bacteria | 1285 |
| 582 | Ga0496110_0029315 | 3300048913 | Bacteria | 4735 |
| 583 | Ga0496111_0302365 | 3300048914 | Bacteria | 1186 |
| 584 | Ga0496112_0206704 | 3300048915 | Bacteria | 1921 |
| 585 | Ga0496113_0221839 | 3300048916 | Bacteria | 1507 |
| 586 | Ga0496113_0588596 | 3300048916 | Bacteria | 891 |
| 587 | Ga0496114_0684657 | 3300048917 | Bacteria | 900 |
| 588 | Ga0496115_0033724 | 3300048918 | Bacteria | 4043 |
| 589 | Ga0496115_0072884 | 3300048918 | Bacteria | 2787 |
| 590 | Ga0496121_0062150 | 3300048924 | Bacteria | 3061 |
| 591 | Ga0496126_0160370 | 3300048929 | Bacteria | 1922 |
| 592 | Ga0501031_0284787 | 3300049568 | Bacteria | 1072 |
| 593 | Ga0501034_0041732 | 3300049571 | Bacteria | 4642 |
| 594 | Ga0501069_0000165 | 3300049585 | Bacteria | 29318 |
| 595 | Ga0501069_0157344 | 3300049585 | Bacteria | 1308 |
| 596 | Ga0501070_0013009 | 3300049586 | Bacteria | 7013 |
| 597 | Ga0501071_0999108 | 3300049587 | Bacteria | 646 |
| 598 | nmdc:mga0k408_347444_c1 | 3300050493 | Bacteria | 884 |
| 599 | nmdc:mga09592_235999_c1 | 3300050508 | Bacteria | 1584 |
| 600 | nmdc:mga0rr50_1098180_c1 | 3300050513 | Bacteria | 677 |
| 601 | nmdc:mga08x19_26776_c1 | 3300050514 | Bacteria | 3600 |
| 602 | Ga0495601_0000002 | 3300053077 | Bacteria | 528704 |
| 603 | Ga0495601_0013360 | 3300053077 | Bacteria | 4937 |
| 604 | Ga0495601_0559241 | 3300053077 | Bacteria | 736 |
| 605 | Ga0495612_0000310 | 3300053078 | Bacteria | 19769 |
| 606 | Ga0495595_0000020 | 3300053084 | Bacteria | 115983 |
| 607 | Ga0495595_0002427 | 3300053084 | Bacteria | 7285 |
| 608 | Ga0495619_0000110 | 3300053085 | Bacteria | 61419 |
| 609 | Ga0495619_0003494 | 3300053085 | Bacteria | 10138 |
| 610 | Ga0500651_0323538 | 3300053093 | Bacteria | 880 |
| 611 | Ga0500658_0000279 | 3300053134 | Bacteria | 23195 |
| 612 | Ga0500590_246810 | 3300053148 | Bacteria | 713 |
| 613 | Ga0500619_165388 | 3300053154 | Bacteria | 750 |
| 614 | Ga0500639_063035 | 3300053163 | Bacteria | 1907 |
| 615 | Ga0500637_0008565 | 3300053178 | Bacteria | 5167 |
| 616 | Ga0500637_0377588 | 3300053178 | Bacteria | 744 |
| 617 | Ga0501084_0828299 | 3300054114 | Bacteria | 779 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039438 | Ga0436360_0205661 | Ga0436360_0205661_291_728 | 140 |
| 2 | 3300011119 | Ga0105246_10145866 | Ga0105246_101458662 | 143 |
| 3 | 3300035086 | Ga0373934_0001254 | Ga0373934_0001254_3225_3671 | 143 |
| 4 | 3300035111 | Ga0373923_0002592 | Ga0373923_0002592_260_706 | 143 |
| 5 | 3300035117 | Ga0373953_0001405 | Ga0373953_0001405_6407_6853 | 143 |
| 6 | 3300035118 | Ga0373954_0002625 | Ga0373954_0002625_1262_1708 | 143 |
| 7 | 3300035119 | Ga0373956_0001441 | Ga0373956_0001441_5266_5712 | 143 |
| 8 | 3300035120 | Ga0373957_0006390 | Ga0373957_0006390_1583_2029 | 143 |
| 9 | 3300035172 | Ga0373955_0003007 | Ga0373955_0003007_6270_6716 | 143 |
| 10 | 3300035410 | Ga0373924_0007514 | Ga0373924_0007514_1900_2346 | 143 |
| 11 | 3300035724 | Ga0373933_0000017 | Ga0373933_0000017_33743_34189 | 143 |
| 12 | 3300035724 | Ga0373933_0004005 | Ga0373933_0004005_6540_6986 | 143 |
| 13 | 3300036401 | Ga0373937_0079220 | Ga0373937_0079220_1457_1903 | 143 |
| 14 | 3300039447 | Ga0436361_0683511 | Ga0436361_0683511_69_521 | 143 |
| 15 | 3300046454 | Ga0495592_0027451 | Ga0495592_0027451_2157_2603 | 143 |
| 16 | 3300046459 | Ga0495629_0001206 | Ga0495629_0001206_16435_16881 | 143 |
| 17 | 3300046462 | Ga0495651_0221355 | Ga0495651_0221355_63_509 | 143 |
| 18 | 3300046463 | Ga0495653_0007406 | Ga0495653_0007406_6259_6705 | 143 |
| 19 | 3300046511 | Ga0495608_0031076 | Ga0495608_0031076_1710_2156 | 143 |
| 20 | 3300046516 | Ga0495628_0011177 | Ga0495628_0011177_4868_5314 | 143 |
| 21 | 3300046529 | Ga0495652_0023745 | Ga0495652_0023745_1652_2098 | 143 |
| 22 | 3300046533 | Ga0495640_0080679 | Ga0495640_0080679_1095_1541 | 143 |
| 23 | 3300046536 | Ga0495587_0011834 | Ga0495587_0011834_673_1119 | 143 |
| 24 | 3300046543 | Ga0495645_0019910 | Ga0495645_0019910_2418_2864 | 143 |
| 25 | 3300046559 | Ga0495667_0056834 | Ga0495667_0056834_1912_2358 | 143 |
| 26 | 3300046642 | Ga0495634_0012302 | Ga0495634_0012302_5430_5876 | 143 |
| 27 | 3300046663 | Ga0495635_0002216 | Ga0495635_0002216_7600_8046 | 143 |
| 28 | 3300046675 | Ga0495657_0034350 | Ga0495657_0034350_1262_1708 | 143 |
| 29 | 3300046678 | Ga0495599_0056876 | Ga0495599_0056876_673_1119 | 143 |
| 30 | 3300046679 | Ga0495623_0026792 | Ga0495623_0026792_1807_2253 | 143 |
| 31 | 3300046680 | Ga0495646_0019235 | Ga0495646_0019235_3819_4265 | 143 |
| 32 | 3300046689 | Ga0495613_0025125 | Ga0495613_0025125_2976_3422 | 143 |
| 33 | 3300046809 | Ga0495600_0051002 | Ga0495600_0051002_2040_2486 | 143 |
| 34 | 3300047317 | Ga0495604_0026169 | Ga0495604_0026169_2937_3383 | 143 |
| 35 | 3300047319 | Ga0495674_0273479 | Ga0495674_0273479_62_508 | 143 |
| 36 | 3300047322 | Ga0495680_0034917 | Ga0495680_0034917_2937_3383 | 143 |
| 37 | 3300047444 | Ga0495675_0002252 | Ga0495675_0002252_4315_4761 | 143 |
| 38 | 3300047471 | Ga0495684_0000954 | Ga0495684_0000954_11539_11985 | 143 |
| 39 | 3300047673 | Ga0495593_0003081 | Ga0495593_0003081_5432_5878 | 143 |
| 40 | 3300048088 | Ga0495602_0042607 | Ga0495602_0042607_1978_2424 | 143 |
| 41 | 3300048918 | Ga0496115_0072884 | Ga0496115_0072884_785_1234 | 143 |
| 42 | 3300053077 | Ga0495601_0013360 | Ga0495601_0013360_2791_3237 | 143 |
| 43 | 3300053077 | Ga0495601_0559241 | Ga0495601_0559241_221_670 | 143 |
| 44 | 3300053084 | Ga0495595_0002427 | Ga0495595_0002427_1683_2129 | 143 |
| 45 | 3300053085 | Ga0495619_0003494 | Ga0495619_0003494_6539_6985 | 143 |
| 46 | 3300053148 | Ga0500590_246810 | Ga0500590_246810_38_490 | 143 |
| 47 | 3300053154 | Ga0500619_165388 | Ga0500619_165388_176_625 | 143 |
| 48 | 3300053163 | Ga0500639_063035 | Ga0500639_063035_547_999 | 143 |
| 49 | 3300053178 | Ga0500637_0008565 | Ga0500637_0008565_1780_2232 | 143 |
| 50 | 3300053178 | Ga0500637_0377588 | Ga0500637_0377588_281_730 | 143 |
| 51 | 3300005338 | Ga0068868_100636693 | Ga0068868_1006366932 | 146 |
| 52 | 3300026023 | Ga0207677_12070497 | Ga0207677_120704971 | 146 |
| 53 | 3300005340 | Ga0070689_100440698 | Ga0070689_1004406981 | 147 |
| 54 | 3300005435 | Ga0070714_100053931 | Ga0070714_1000539314 | 147 |
| 55 | 3300005436 | Ga0070713_100002481 | Ga0070713_1000024812 | 147 |
| 56 | 3300005436 | Ga0070713_100623328 | Ga0070713_1006233282 | 147 |
| 57 | 3300005439 | Ga0070711_100622198 | Ga0070711_1006221981 | 147 |
| 58 | 3300005457 | Ga0070662_100666216 | Ga0070662_1006662161 | 147 |
| 59 | 3300005457 | Ga0070662_100784822 | Ga0070662_1007848221 | 147 |
| 60 | 3300005471 | Ga0070698_100606745 | Ga0070698_1006067452 | 147 |
| 61 | 3300005471 | Ga0070698_101113685 | Ga0070698_1011136851 | 147 |
| 62 | 3300005539 | Ga0068853_100416470 | Ga0068853_1004164701 | 147 |
| 63 | 3300005545 | Ga0070695_100890007 | Ga0070695_1008900071 | 147 |
| 64 | 3300005563 | Ga0068855_100057107 | Ga0068855_1000571077 | 147 |
| 65 | 3300005563 | Ga0068855_100085417 | Ga0068855_1000854172 | 147 |
| 66 | 3300005577 | Ga0068857_100029668 | Ga0068857_1000296682 | 147 |
| 67 | 3300005578 | Ga0068854_100013235 | Ga0068854_1000132352 | 147 |
| 68 | 3300005578 | Ga0068854_100174763 | Ga0068854_1001747632 | 147 |
| 69 | 3300005614 | Ga0068856_100055230 | Ga0068856_1000552302 | 147 |
| 70 | 3300005614 | Ga0068856_100115026 | Ga0068856_1001150262 | 147 |
| 71 | 3300005614 | Ga0068856_100554271 | Ga0068856_1005542712 | 147 |
| 72 | 3300005616 | Ga0068852_100024160 | Ga0068852_1000241605 | 147 |
| 73 | 3300005617 | Ga0068859_100291569 | Ga0068859_1002915692 | 147 |
| 74 | 3300005719 | Ga0068861_100992394 | Ga0068861_1009923942 | 147 |
| 75 | 3300005834 | Ga0068851_10022338 | Ga0068851_100223383 | 147 |
| 76 | 3300005981 | Ga0081538_10009408 | Ga0081538_100094082 | 147 |
| 77 | 3300005981 | Ga0081538_10124458 | Ga0081538_101244583 | 147 |
| 78 | 3300006028 | Ga0070717_10000329 | Ga0070717_1000032923 | 147 |
| 79 | 3300006028 | Ga0070717_11489515 | Ga0070717_114895151 | 147 |
| 80 | 3300006175 | Ga0070712_100865779 | Ga0070712_1008657792 | 147 |
| 81 | 3300006195 | Ga0075366_10570920 | Ga0075366_105709202 | 147 |
| 82 | 3300006358 | Ga0068871_100237352 | Ga0068871_1002373522 | 147 |
| 83 | 3300006844 | Ga0075428_100973148 | Ga0075428_1009731481 | 147 |
| 84 | 3300006881 | Ga0068865_101202321 | Ga0068865_1012023212 | 147 |
| 85 | 3300006931 | Ga0097620_100291579 | Ga0097620_1002915792 | 147 |
| 86 | 3300009093 | Ga0105240_10015110 | Ga0105240_100151108 | 147 |
| 87 | 3300009093 | Ga0105240_11030582 | Ga0105240_110305822 | 147 |
| 88 | 3300009094 | Ga0111539_12398453 | Ga0111539_123984531 | 147 |
| 89 | 3300009101 | Ga0105247_10035454 | Ga0105247_100354543 | 147 |
| 90 | 3300009147 | Ga0114129_11477144 | Ga0114129_114771442 | 147 |
| 91 | 3300009174 | Ga0105241_10009831 | Ga0105241_100098315 | 147 |
| 92 | 3300009174 | Ga0105241_11140417 | Ga0105241_111404171 | 147 |
| 93 | 3300009176 | Ga0105242_10069851 | Ga0105242_100698513 | 147 |
| 94 | 3300009545 | Ga0105237_10035169 | Ga0105237_100351692 | 147 |
| 95 | 3300009545 | Ga0105237_10107704 | Ga0105237_101077044 | 147 |
| 96 | 3300009545 | Ga0105237_10161812 | Ga0105237_101618123 | 147 |
| 97 | 3300009551 | Ga0105238_10008597 | Ga0105238_100085977 | 147 |
| 98 | 3300009551 | Ga0105238_10031322 | Ga0105238_100313227 | 147 |
| 99 | 3300010375 | Ga0105239_10016514 | Ga0105239_100165146 | 147 |
| 100 | 3300010375 | Ga0105239_10036415 | Ga0105239_100364152 | 147 |
| 101 | 3300011119 | Ga0105246_10480388 | Ga0105246_104803882 | 147 |
| 102 | 3300013296 | Ga0157374_10272124 | Ga0157374_102721243 | 147 |
| 103 | 3300013297 | Ga0157378_11082950 | Ga0157378_110829502 | 147 |
| 104 | 3300014325 | Ga0163163_10041679 | Ga0163163_100416795 | 147 |
| 105 | 3300014968 | Ga0157379_10391773 | Ga0157379_103917732 | 147 |
| 106 | 3300020069 | Ga0197907_10787107 | Ga0197907_107871072 | 147 |
| 107 | 3300021361 | Ga0213872_10252446 | Ga0213872_102524462 | 147 |
| 108 | 3300025898 | Ga0207692_10115034 | Ga0207692_101150342 | 147 |
| 109 | 3300025900 | Ga0207710_10034330 | Ga0207710_100343302 | 147 |
| 110 | 3300025904 | Ga0207647_10000685 | Ga0207647_1000068526 | 147 |
| 111 | 3300025905 | Ga0207685_10235209 | Ga0207685_102352092 | 147 |
| 112 | 3300025906 | Ga0207699_10306216 | Ga0207699_103062162 | 147 |
| 113 | 3300025914 | Ga0207671_10103648 | Ga0207671_101036484 | 147 |
| 114 | 3300025914 | Ga0207671_10129941 | Ga0207671_101299412 | 147 |
| 115 | 3300025914 | Ga0207671_11102178 | Ga0207671_111021781 | 147 |
| 116 | 3300025915 | Ga0207693_10183371 | Ga0207693_101833712 | 147 |
| 117 | 3300025915 | Ga0207693_10477567 | Ga0207693_104775672 | 147 |
| 118 | 3300025916 | Ga0207663_10372211 | Ga0207663_103722112 | 147 |
| 119 | 3300025928 | Ga0207700_10007850 | Ga0207700_100078506 | 147 |
| 120 | 3300025929 | Ga0207664_10047300 | Ga0207664_100473002 | 147 |
| 121 | 3300025931 | Ga0207644_11134706 | Ga0207644_111347062 | 147 |
| 122 | 3300025932 | Ga0207690_10804679 | Ga0207690_108046791 | 147 |
| 123 | 3300025933 | Ga0207706_10633205 | Ga0207706_106332052 | 147 |
| 124 | 3300025934 | Ga0207686_10088110 | Ga0207686_100881102 | 147 |
| 125 | 3300025936 | Ga0207670_10650303 | Ga0207670_106503031 | 147 |
| 126 | 3300025949 | Ga0207667_10805909 | Ga0207667_108059092 | 147 |
| 127 | 3300025981 | Ga0207640_10224805 | Ga0207640_102248051 | 147 |
| 128 | 3300026095 | Ga0207676_10139909 | Ga0207676_101399093 | 147 |
| 129 | 3300026116 | Ga0207674_10015148 | Ga0207674_100151487 | 147 |
| 130 | 3300026116 | Ga0207674_10044733 | Ga0207674_100447337 | 147 |
| 131 | 3300026116 | Ga0207674_11102050 | Ga0207674_111020501 | 147 |
| 132 | 3300026118 | Ga0207675_100076379 | Ga0207675_1000763793 | 147 |
| 133 | 3300026121 | Ga0207683_11688598 | Ga0207683_116885981 | 147 |
| 134 | 3300027512 | Ga0209179_1008569 | Ga0209179_10085692 | 147 |
| 135 | 3300028573 | Ga0265334_10047500 | Ga0265334_100475002 | 147 |
| 136 | 3300031235 | Ga0265330_10115955 | Ga0265330_101159552 | 147 |
| 137 | 3300031238 | Ga0265332_10037701 | Ga0265332_100377012 | 147 |
| 138 | 3300031239 | Ga0265328_10010377 | Ga0265328_100103773 | 147 |
| 139 | 3300031241 | Ga0265325_10041753 | Ga0265325_100417533 | 147 |
| 140 | 3300031249 | Ga0265339_10008736 | Ga0265339_100087362 | 147 |
| 141 | 3300031249 | Ga0265339_10074737 | Ga0265339_100747372 | 147 |
| 142 | 3300031507 | Ga0307509_10078803 | Ga0307509_100788032 | 147 |
| 143 | 3300031507 | Ga0307509_10346687 | Ga0307509_103466873 | 147 |
| 144 | 3300031595 | Ga0265313_10118653 | Ga0265313_101186531 | 147 |
| 145 | 3300031616 | Ga0307508_10059545 | Ga0307508_100595453 | 147 |
| 146 | 3300035692 | Ga0373935_0380189 | Ga0373935_0380189_402_863 | 147 |
| 147 | 3300037466 | Ga0395898_0107845 | Ga0395898_0107845_805_1263 | 147 |
| 148 | 3300038443 | Ga0395901_0095046 | Ga0395901_0095046_852_1310 | 147 |
| 149 | 3300038443 | Ga0395901_0517507 | Ga0395901_0517507_212_670 | 147 |
| 150 | 3300044694 | Ga0466963_0464256 | Ga0466963_0464256_71_532 | 147 |
| 151 | 3300044901 | Ga0466960_0089253 | Ga0466960_0089253_652_1110 | 147 |
| 152 | 3300046472 | Ga0495580_0415803 | Ga0495580_0415803_194_664 | 147 |
| 153 | 3300046477 | Ga0495664_0102623 | Ga0495664_0102623_629_1087 | 147 |
| 154 | 3300047321 | Ga0495676_0630418 | Ga0495676_0630418_133_591 | 147 |
| 155 | 3300048903 | Ga0496100_0347094 | Ga0496100_0347094_261_725 | 147 |
| 156 | 3300048908 | Ga0496105_0031676 | Ga0496105_0031676_385_849 | 147 |
| 157 | 3300048909 | Ga0496106_0142059 | Ga0496106_0142059_1331_1795 | 147 |
| 158 | 3300048911 | Ga0496108_0736460 | Ga0496108_0736460_33_494 | 147 |
| 159 | 3300048912 | Ga0496109_0407018 | Ga0496109_0407018_67_531 | 147 |
| 160 | 3300048915 | Ga0496112_0206704 | Ga0496112_0206704_183_647 | 147 |
| 161 | 3300048916 | Ga0496113_0588596 | Ga0496113_0588596_401_865 | 147 |
| 162 | 3300048924 | Ga0496121_0062150 | Ga0496121_0062150_402_863 | 147 |
| 163 | 3300048929 | Ga0496126_0160370 | Ga0496126_0160370_1443_1904 | 147 |
| 164 | 3300049585 | Ga0501069_0157344 | Ga0501069_0157344_310_771 | 147 |
| 165 | 3300044901 | Ga0466960_0017393 | Ga0466960_0017393_665_1129 | 148 |
| 166 | 3300045049 | Ga0466959_0110346 | Ga0466959_0110346_1366_1821 | 148 |
| 167 | 3300005563 | Ga0068855_100019058 | Ga0068855_1000190583 | 149 |
| 168 | 3300005614 | Ga0068856_100044482 | Ga0068856_1000444826 | 149 |
| 169 | 3300009093 | Ga0105240_10117551 | Ga0105240_101175514 | 149 |
| 170 | 3300009177 | Ga0105248_12162708 | Ga0105248_121627082 | 149 |
| 171 | 3300009551 | Ga0105238_10101023 | Ga0105238_101010232 | 149 |
| 172 | 3300025913 | Ga0207695_10156005 | Ga0207695_101560052 | 149 |
| 173 | 3300025924 | Ga0207694_10573187 | Ga0207694_105731872 | 149 |
| 174 | 3300025949 | Ga0207667_10033361 | Ga0207667_100333613 | 149 |
| 175 | 3300026078 | Ga0207702_10619772 | Ga0207702_106197722 | 149 |
| 176 | 3300045836 | Ga0466958_0306486 | Ga0466958_0306486_146_619 | 149 |
| 177 | 3300046525 | Ga0495663_0044398 | Ga0495663_0044398_303_776 | 149 |
| 178 | 3300046660 | Ga0495625_0012614 | Ga0495625_0012614_3958_4431 | 149 |
| 179 | 3300053134 | Ga0500658_0000279 | Ga0500658_0000279_20117_20590 | 149 |
| 180 | 3300005329 | Ga0070683_100008457 | Ga0070683_1000084575 | 150 |
| 181 | 3300005329 | Ga0070683_100350869 | Ga0070683_1003508693 | 150 |
| 182 | 3300005344 | Ga0070661_100125931 | Ga0070661_1001259311 | 150 |
| 183 | 3300005535 | Ga0070684_100124582 | Ga0070684_1001245823 | 150 |
| 184 | 3300005563 | Ga0068855_101204706 | Ga0068855_1012047062 | 150 |
| 185 | 3300005614 | Ga0068856_100062875 | Ga0068856_1000628754 | 150 |
| 186 | 3300009093 | Ga0105240_10004314 | Ga0105240_100043143 | 150 |
| 187 | 3300009093 | Ga0105240_10186224 | Ga0105240_101862244 | 150 |
| 188 | 3300009174 | Ga0105241_10256564 | Ga0105241_102565641 | 150 |
| 189 | 3300010159 | Ga0099796_10042712 | Ga0099796_100427122 | 150 |
| 190 | 3300013105 | Ga0157369_10163239 | Ga0157369_101632392 | 150 |
| 191 | 3300013307 | Ga0157372_10260709 | Ga0157372_102607092 | 150 |
| 192 | 3300025906 | Ga0207699_10440680 | Ga0207699_104406802 | 150 |
| 193 | 3300025913 | Ga0207695_10020606 | Ga0207695_100206064 | 150 |
| 194 | 3300025913 | Ga0207695_10153320 | Ga0207695_101533204 | 150 |
| 195 | 3300025920 | Ga0207649_10357769 | Ga0207649_103577692 | 150 |
| 196 | 3300025944 | Ga0207661_10058236 | Ga0207661_100582362 | 150 |
| 197 | 3300025949 | Ga0207667_11065841 | Ga0207667_110658412 | 150 |
| 198 | 3300026078 | Ga0207702_10044939 | Ga0207702_100449392 | 150 |
| 199 | 3300005290 | Ga0065712_10574782 | Ga0065712_105747821 | 151 |
| 200 | 3300005328 | Ga0070676_10518284 | Ga0070676_105182842 | 151 |
| 201 | 3300005329 | Ga0070683_100009334 | Ga0070683_1000093346 | 151 |
| 202 | 3300005329 | Ga0070683_100159810 | Ga0070683_1001598105 | 151 |
| 203 | 3300005329 | Ga0070683_100598883 | Ga0070683_1005988833 | 151 |
| 204 | 3300005329 | Ga0070683_100755779 | Ga0070683_1007557792 | 151 |
| 205 | 3300005329 | Ga0070683_100780607 | Ga0070683_1007806071 | 151 |
| 206 | 3300005330 | Ga0070690_101369986 | Ga0070690_1013699861 | 151 |
| 207 | 3300005331 | Ga0070670_100044499 | Ga0070670_1000444991 | 151 |
| 208 | 3300005331 | Ga0070670_100149869 | Ga0070670_1001498693 | 151 |
| 209 | 3300005334 | Ga0068869_100004563 | Ga0068869_1000045632 | 151 |
| 210 | 3300005334 | Ga0068869_100144297 | Ga0068869_1001442972 | 151 |
| 211 | 3300005334 | Ga0068869_101224435 | Ga0068869_1012244351 | 151 |
| 212 | 3300005335 | Ga0070666_10507878 | Ga0070666_105078781 | 151 |
| 213 | 3300005336 | Ga0070680_100719430 | Ga0070680_1007194301 | 151 |
| 214 | 3300005337 | Ga0070682_100940450 | Ga0070682_1009404501 | 151 |
| 215 | 3300005338 | Ga0068868_100136128 | Ga0068868_1001361283 | 151 |
| 216 | 3300005339 | Ga0070660_100016825 | Ga0070660_1000168253 | 151 |
| 217 | 3300005340 | Ga0070689_100331625 | Ga0070689_1003316253 | 151 |
| 218 | 3300005340 | Ga0070689_100404122 | Ga0070689_1004041222 | 151 |
| 219 | 3300005343 | Ga0070687_100567922 | Ga0070687_1005679221 | 151 |
| 220 | 3300005344 | Ga0070661_100002712 | Ga0070661_1000027129 | 151 |
| 221 | 3300005344 | Ga0070661_100032923 | Ga0070661_1000329236 | 151 |
| 222 | 3300005344 | Ga0070661_100037766 | Ga0070661_1000377664 | 151 |
| 223 | 3300005354 | Ga0070675_100391475 | Ga0070675_1003914752 | 151 |
| 224 | 3300005354 | Ga0070675_100412247 | Ga0070675_1004122472 | 151 |
| 225 | 3300005355 | Ga0070671_100530996 | Ga0070671_1005309961 | 151 |
| 226 | 3300005364 | Ga0070673_100180459 | Ga0070673_1001804592 | 151 |
| 227 | 3300005364 | Ga0070673_100497668 | Ga0070673_1004976681 | 151 |
| 228 | 3300005365 | Ga0070688_100142140 | Ga0070688_1001421403 | 151 |
| 229 | 3300005366 | Ga0070659_100010732 | Ga0070659_1000107323 | 151 |
| 230 | 3300005366 | Ga0070659_100141447 | Ga0070659_1001414473 | 151 |
| 231 | 3300005367 | Ga0070667_100202460 | Ga0070667_1002024602 | 151 |
| 232 | 3300005367 | Ga0070667_100558313 | Ga0070667_1005583131 | 151 |
| 233 | 3300005434 | Ga0070709_10840181 | Ga0070709_108401811 | 151 |
| 234 | 3300005435 | Ga0070714_100036717 | Ga0070714_1000367174 | 151 |
| 235 | 3300005436 | Ga0070713_100218040 | Ga0070713_1002180401 | 151 |
| 236 | 3300005438 | Ga0070701_10199215 | Ga0070701_101992152 | 151 |
| 237 | 3300005441 | Ga0070700_100045595 | Ga0070700_1000455954 | 151 |
| 238 | 3300005441 | Ga0070700_100186904 | Ga0070700_1001869042 | 151 |
| 239 | 3300005444 | Ga0070694_100932019 | Ga0070694_1009320191 | 151 |
| 240 | 3300005445 | Ga0070708_100226777 | Ga0070708_1002267772 | 151 |
| 241 | 3300005455 | Ga0070663_100275927 | Ga0070663_1002759272 | 151 |
| 242 | 3300005455 | Ga0070663_100519704 | Ga0070663_1005197041 | 151 |
| 243 | 3300005456 | Ga0070678_100169033 | Ga0070678_1001690331 | 151 |
| 244 | 3300005457 | Ga0070662_100038573 | Ga0070662_1000385733 | 151 |
| 245 | 3300005457 | Ga0070662_100255684 | Ga0070662_1002556841 | 151 |
| 246 | 3300005459 | Ga0068867_100307440 | Ga0068867_1003074402 | 151 |
| 247 | 3300005459 | Ga0068867_100507189 | Ga0068867_1005071892 | 151 |
| 248 | 3300005466 | Ga0070685_10270745 | Ga0070685_102707451 | 151 |
| 249 | 3300005467 | Ga0070706_100005867 | Ga0070706_1000058678 | 151 |
| 250 | 3300005468 | Ga0070707_100004630 | Ga0070707_10000463014 | 151 |
| 251 | 3300005471 | Ga0070698_100010297 | Ga0070698_1000102979 | 151 |
| 252 | 3300005471 | Ga0070698_100076895 | Ga0070698_1000768953 | 151 |
| 253 | 3300005518 | Ga0070699_100465083 | Ga0070699_1004650832 | 151 |
| 254 | 3300005530 | Ga0070679_100120267 | Ga0070679_1001202672 | 151 |
| 255 | 3300005530 | Ga0070679_100362678 | Ga0070679_1003626781 | 151 |
| 256 | 3300005535 | Ga0070684_100000866 | Ga0070684_10000086618 | 151 |
| 257 | 3300005535 | Ga0070684_100005712 | Ga0070684_1000057123 | 151 |
| 258 | 3300005535 | Ga0070684_100019112 | Ga0070684_1000191126 | 151 |
| 259 | 3300005535 | Ga0070684_100156853 | Ga0070684_1001568533 | 151 |
| 260 | 3300005535 | Ga0070684_100215665 | Ga0070684_1002156652 | 151 |
| 261 | 3300005535 | Ga0070684_101704559 | Ga0070684_1017045591 | 151 |
| 262 | 3300005539 | Ga0068853_100007014 | Ga0068853_1000070142 | 151 |
| 263 | 3300005539 | Ga0068853_100009281 | Ga0068853_1000092813 | 151 |
| 264 | 3300005539 | Ga0068853_100039529 | Ga0068853_1000395293 | 151 |
| 265 | 3300005539 | Ga0068853_100055051 | Ga0068853_1000550513 | 151 |
| 266 | 3300005539 | Ga0068853_100171621 | Ga0068853_1001716212 | 151 |
| 267 | 3300005539 | Ga0068853_101302452 | Ga0068853_1013024521 | 151 |
| 268 | 3300005543 | Ga0070672_100279205 | Ga0070672_1002792053 | 151 |
| 269 | 3300005545 | Ga0070695_100906054 | Ga0070695_1009060541 | 151 |
| 270 | 3300005547 | Ga0070693_100879314 | Ga0070693_1008793141 | 151 |
| 271 | 3300005548 | Ga0070665_100531980 | Ga0070665_1005319803 | 151 |
| 272 | 3300005548 | Ga0070665_101153613 | Ga0070665_1011536132 | 151 |
| 273 | 3300005549 | Ga0070704_102092984 | Ga0070704_1020929841 | 151 |
| 274 | 3300005563 | Ga0068855_100013376 | Ga0068855_1000133763 | 151 |
| 275 | 3300005563 | Ga0068855_100311330 | Ga0068855_1003113302 | 151 |
| 276 | 3300005564 | Ga0070664_100001013 | Ga0070664_10000101318 | 151 |
| 277 | 3300005564 | Ga0070664_100001091 | Ga0070664_1000010916 | 151 |
| 278 | 3300005564 | Ga0070664_100030545 | Ga0070664_1000305455 | 151 |
| 279 | 3300005564 | Ga0070664_100071638 | Ga0070664_1000716385 | 151 |
| 280 | 3300005564 | Ga0070664_100096829 | Ga0070664_1000968293 | 151 |
| 281 | 3300005564 | Ga0070664_101084175 | Ga0070664_1010841751 | 151 |
| 282 | 3300005577 | Ga0068857_100003966 | Ga0068857_1000039666 | 151 |
| 283 | 3300005577 | Ga0068857_100035926 | Ga0068857_1000359265 | 151 |
| 284 | 3300005577 | Ga0068857_100190602 | Ga0068857_1001906022 | 151 |
| 285 | 3300005577 | Ga0068857_100278147 | Ga0068857_1002781472 | 151 |
| 286 | 3300005577 | Ga0068857_100297688 | Ga0068857_1002976881 | 151 |
| 287 | 3300005577 | Ga0068857_100498659 | Ga0068857_1004986592 | 151 |
| 288 | 3300005578 | Ga0068854_100004399 | Ga0068854_1000043996 | 151 |
| 289 | 3300005578 | Ga0068854_100395923 | Ga0068854_1003959232 | 151 |
| 290 | 3300005578 | Ga0068854_100643426 | Ga0068854_1006434262 | 151 |
| 291 | 3300005614 | Ga0068856_100004251 | Ga0068856_10000425113 | 151 |
| 292 | 3300005614 | Ga0068856_100690751 | Ga0068856_1006907511 | 151 |
| 293 | 3300005614 | Ga0068856_100782045 | Ga0068856_1007820451 | 151 |
| 294 | 3300005616 | Ga0068852_100002382 | Ga0068852_10000238212 | 151 |
| 295 | 3300005616 | Ga0068852_100070073 | Ga0068852_1000700733 | 151 |
| 296 | 3300005616 | Ga0068852_100492678 | Ga0068852_1004926782 | 151 |
| 297 | 3300005616 | Ga0068852_100869714 | Ga0068852_1008697141 | 151 |
| 298 | 3300005617 | Ga0068859_100116618 | Ga0068859_1001166184 | 151 |
| 299 | 3300005617 | Ga0068859_100137080 | Ga0068859_1001370801 | 151 |
| 300 | 3300005617 | Ga0068859_100155691 | Ga0068859_1001556913 | 151 |
| 301 | 3300005617 | Ga0068859_100551144 | Ga0068859_1005511442 | 151 |
| 302 | 3300005617 | Ga0068859_100784776 | Ga0068859_1007847761 | 151 |
| 303 | 3300005618 | Ga0068864_100039887 | Ga0068864_1000398874 | 151 |
| 304 | 3300005618 | Ga0068864_100578909 | Ga0068864_1005789092 | 151 |
| 305 | 3300005618 | Ga0068864_100657608 | Ga0068864_1006576082 | 151 |
| 306 | 3300005719 | Ga0068861_100040137 | Ga0068861_1000401378 | 151 |
| 307 | 3300005719 | Ga0068861_100048268 | Ga0068861_1000482682 | 151 |
| 308 | 3300005834 | Ga0068851_10008128 | Ga0068851_100081285 | 151 |
| 309 | 3300005841 | Ga0068863_100395505 | Ga0068863_1003955052 | 151 |
| 310 | 3300005841 | Ga0068863_100567498 | Ga0068863_1005674981 | 151 |
| 311 | 3300005842 | Ga0068858_100170097 | Ga0068858_1001700972 | 151 |
| 312 | 3300005842 | Ga0068858_100841792 | Ga0068858_1008417921 | 151 |
| 313 | 3300005843 | Ga0068860_100010741 | Ga0068860_1000107415 | 151 |
| 314 | 3300005844 | Ga0068862_100081350 | Ga0068862_1000813503 | 151 |
| 315 | 3300005844 | Ga0068862_100545506 | Ga0068862_1005455061 | 151 |
| 316 | 3300006028 | Ga0070717_10592057 | Ga0070717_105920571 | 151 |
| 317 | 3300006042 | Ga0075368_10042008 | Ga0075368_100420082 | 151 |
| 318 | 3300006175 | Ga0070712_100852315 | Ga0070712_1008523151 | 151 |
| 319 | 3300006195 | Ga0075366_10679661 | Ga0075366_106796612 | 151 |
| 320 | 3300006237 | Ga0097621_100034307 | Ga0097621_1000343071 | 151 |
| 321 | 3300006358 | Ga0068871_100111737 | Ga0068871_1001117372 | 151 |
| 322 | 3300006358 | Ga0068871_100174289 | Ga0068871_1001742893 | 151 |
| 323 | 3300006358 | Ga0068871_100488112 | Ga0068871_1004881123 | 151 |
| 324 | 3300006844 | Ga0075428_100057010 | Ga0075428_1000570105 | 151 |
| 325 | 3300006846 | Ga0075430_101034412 | Ga0075430_1010344121 | 151 |
| 326 | 3300006880 | Ga0075429_100017742 | Ga0075429_1000177423 | 151 |
| 327 | 3300006881 | Ga0068865_100283048 | Ga0068865_1002830482 | 151 |
| 328 | 3300006881 | Ga0068865_101993136 | Ga0068865_1019931361 | 151 |
| 329 | 3300006914 | Ga0075436_100020045 | Ga0075436_1000200452 | 151 |
| 330 | 3300006931 | Ga0097620_100116618 | Ga0097620_1001166184 | 151 |
| 331 | 3300006931 | Ga0097620_100137076 | Ga0097620_1001370763 | 151 |
| 332 | 3300006931 | Ga0097620_100155703 | Ga0097620_1001557033 | 151 |
| 333 | 3300006931 | Ga0097620_100551141 | Ga0097620_1005511412 | 151 |
| 334 | 3300006931 | Ga0097620_100784798 | Ga0097620_1007847982 | 151 |
| 335 | 3300007076 | Ga0075435_100691635 | Ga0075435_1006916352 | 151 |
| 336 | 3300009093 | Ga0105240_10026349 | Ga0105240_100263497 | 151 |
| 337 | 3300009093 | Ga0105240_10288061 | Ga0105240_102880612 | 151 |
| 338 | 3300009093 | Ga0105240_10484418 | Ga0105240_104844182 | 151 |
| 339 | 3300009094 | Ga0111539_10583424 | Ga0111539_105834242 | 151 |
| 340 | 3300009101 | Ga0105247_10007691 | Ga0105247_100076916 | 151 |
| 341 | 3300009174 | Ga0105241_10078395 | Ga0105241_100783955 | 151 |
| 342 | 3300009174 | Ga0105241_10114327 | Ga0105241_101143271 | 151 |
| 343 | 3300009174 | Ga0105241_10131077 | Ga0105241_101310772 | 151 |
| 344 | 3300009174 | Ga0105241_10378856 | Ga0105241_103788562 | 151 |
| 345 | 3300009177 | Ga0105248_10648470 | Ga0105248_106484701 | 151 |
| 346 | 3300009177 | Ga0105248_10915646 | Ga0105248_109156461 | 151 |
| 347 | 3300009177 | Ga0105248_12673506 | Ga0105248_126735061 | 151 |
| 348 | 3300009545 | Ga0105237_10089762 | Ga0105237_100897622 | 151 |
| 349 | 3300009545 | Ga0105237_10240538 | Ga0105237_102405381 | 151 |
| 350 | 3300009545 | Ga0105237_10744899 | Ga0105237_107448991 | 151 |
| 351 | 3300009551 | Ga0105238_10001137 | Ga0105238_1000113717 | 151 |
| 352 | 3300009551 | Ga0105238_10669675 | Ga0105238_106696752 | 151 |
| 353 | 3300009553 | Ga0105249_10003199 | Ga0105249_100031995 | 151 |
| 354 | 3300009553 | Ga0105249_10009092 | Ga0105249_100090924 | 151 |
| 355 | 3300009553 | Ga0105249_10045511 | Ga0105249_100455113 | 151 |
| 356 | 3300009553 | Ga0105249_10500425 | Ga0105249_105004252 | 151 |
| 357 | 3300009553 | Ga0105249_10612081 | Ga0105249_106120811 | 151 |
| 358 | 3300010375 | Ga0105239_10090452 | Ga0105239_100904523 | 151 |
| 359 | 3300010375 | Ga0105239_10273515 | Ga0105239_102735152 | 151 |
| 360 | 3300011119 | Ga0105246_10270137 | Ga0105246_102701372 | 151 |
| 361 | 3300013100 | Ga0157373_10004071 | Ga0157373_100040711 | 151 |
| 362 | 3300013100 | Ga0157373_10186025 | Ga0157373_101860251 | 151 |
| 363 | 3300013100 | Ga0157373_10411871 | Ga0157373_104118712 | 151 |
| 364 | 3300013102 | Ga0157371_10370173 | Ga0157371_103701732 | 151 |
| 365 | 3300013104 | Ga0157370_10013002 | Ga0157370_100130029 | 151 |
| 366 | 3300013104 | Ga0157370_10139812 | Ga0157370_101398122 | 151 |
| 367 | 3300013105 | Ga0157369_10007484 | Ga0157369_100074843 | 151 |
| 368 | 3300013105 | Ga0157369_10392689 | Ga0157369_103926892 | 151 |
| 369 | 3300013105 | Ga0157369_10796371 | Ga0157369_107963711 | 151 |
| 370 | 3300013105 | Ga0157369_10842600 | Ga0157369_108426002 | 151 |
| 371 | 3300013296 | Ga0157374_10006243 | Ga0157374_100062433 | 151 |
| 372 | 3300013296 | Ga0157374_10036265 | Ga0157374_100362655 | 151 |
| 373 | 3300013296 | Ga0157374_10197673 | Ga0157374_101976731 | 151 |
| 374 | 3300013296 | Ga0157374_11369855 | Ga0157374_113698552 | 151 |
| 375 | 3300013297 | Ga0157378_10111222 | Ga0157378_101112223 | 151 |
| 376 | 3300013297 | Ga0157378_10774444 | Ga0157378_107744441 | 151 |
| 377 | 3300013306 | Ga0163162_10147148 | Ga0163162_101471482 | 151 |
| 378 | 3300013306 | Ga0163162_10273412 | Ga0163162_102734122 | 151 |
| 379 | 3300013306 | Ga0163162_10342250 | Ga0163162_103422502 | 151 |
| 380 | 3300013306 | Ga0163162_12751498 | Ga0163162_127514981 | 151 |
| 381 | 3300013307 | Ga0157372_10006264 | Ga0157372_1000626411 | 151 |
| 382 | 3300013307 | Ga0157372_10549602 | Ga0157372_105496021 | 151 |
| 383 | 3300013307 | Ga0157372_13141710 | Ga0157372_131417101 | 151 |
| 384 | 3300013308 | Ga0157375_10018953 | Ga0157375_100189533 | 151 |
| 385 | 3300013308 | Ga0157375_10073852 | Ga0157375_100738523 | 151 |
| 386 | 3300014325 | Ga0163163_10005024 | Ga0163163_1000502412 | 151 |
| 387 | 3300014325 | Ga0163163_10596340 | Ga0163163_105963401 | 151 |
| 388 | 3300014325 | Ga0163163_11219135 | Ga0163163_112191351 | 151 |
| 389 | 3300014326 | Ga0157380_10209597 | Ga0157380_102095972 | 151 |
| 390 | 3300014968 | Ga0157379_10162118 | Ga0157379_101621181 | 151 |
| 391 | 3300014968 | Ga0157379_10203809 | Ga0157379_102038092 | 151 |
| 392 | 3300014968 | Ga0157379_10440606 | Ga0157379_104406061 | 151 |
| 393 | 3300014969 | Ga0157376_11023168 | Ga0157376_110231681 | 151 |
| 394 | 3300014969 | Ga0157376_11367824 | Ga0157376_113678241 | 151 |
| 395 | 3300017792 | Ga0163161_10137955 | Ga0163161_101379552 | 151 |
| 396 | 3300020070 | Ga0206356_10132939 | Ga0206356_101329391 | 151 |
| 397 | 3300025315 | Ga0207697_10035593 | Ga0207697_100355933 | 151 |
| 398 | 3300025900 | Ga0207710_10002424 | Ga0207710_100024246 | 151 |
| 399 | 3300025900 | Ga0207710_10476052 | Ga0207710_104760522 | 151 |
| 400 | 3300025903 | Ga0207680_10404464 | Ga0207680_104044641 | 151 |
| 401 | 3300025904 | Ga0207647_10042037 | Ga0207647_100420372 | 151 |
| 402 | 3300025904 | Ga0207647_10548496 | Ga0207647_105484961 | 151 |
| 403 | 3300025906 | Ga0207699_10617645 | Ga0207699_106176451 | 151 |
| 404 | 3300025906 | Ga0207699_10668940 | Ga0207699_106689402 | 151 |
| 405 | 3300025907 | Ga0207645_10091003 | Ga0207645_100910032 | 151 |
| 406 | 3300025907 | Ga0207645_10640039 | Ga0207645_106400392 | 151 |
| 407 | 3300025909 | Ga0207705_10021706 | Ga0207705_100217064 | 151 |
| 408 | 3300025909 | Ga0207705_10471162 | Ga0207705_104711622 | 151 |
| 409 | 3300025910 | Ga0207684_10107810 | Ga0207684_101078102 | 151 |
| 410 | 3300025911 | Ga0207654_10076140 | Ga0207654_100761402 | 151 |
| 411 | 3300025911 | Ga0207654_10139945 | Ga0207654_101399451 | 151 |
| 412 | 3300025911 | Ga0207654_10212393 | Ga0207654_102123932 | 151 |
| 413 | 3300025912 | Ga0207707_10000570 | Ga0207707_1000057031 | 151 |
| 414 | 3300025912 | Ga0207707_10211437 | Ga0207707_102114372 | 151 |
| 415 | 3300025912 | Ga0207707_10260093 | Ga0207707_102600932 | 151 |
| 416 | 3300025913 | Ga0207695_10021907 | Ga0207695_100219076 | 151 |
| 417 | 3300025913 | Ga0207695_10046485 | Ga0207695_100464854 | 151 |
| 418 | 3300025913 | Ga0207695_10059410 | Ga0207695_100594101 | 151 |
| 419 | 3300025914 | Ga0207671_10053393 | Ga0207671_100533934 | 151 |
| 420 | 3300025915 | Ga0207693_10854466 | Ga0207693_108544661 | 151 |
| 421 | 3300025917 | Ga0207660_10012565 | Ga0207660_100125657 | 151 |
| 422 | 3300025919 | Ga0207657_10007975 | Ga0207657_100079759 | 151 |
| 423 | 3300025920 | Ga0207649_10005003 | Ga0207649_100050034 | 151 |
| 424 | 3300025920 | Ga0207649_10010573 | Ga0207649_100105736 | 151 |
| 425 | 3300025920 | Ga0207649_10023904 | Ga0207649_100239044 | 151 |
| 426 | 3300025921 | Ga0207652_10053166 | Ga0207652_100531663 | 151 |
| 427 | 3300025921 | Ga0207652_10101259 | Ga0207652_101012595 | 151 |
| 428 | 3300025921 | Ga0207652_10164834 | Ga0207652_101648342 | 151 |
| 429 | 3300025921 | Ga0207652_10357636 | Ga0207652_103576362 | 151 |
| 430 | 3300025922 | Ga0207646_10013658 | Ga0207646_100136588 | 151 |
| 431 | 3300025923 | Ga0207681_11105266 | Ga0207681_111052661 | 151 |
| 432 | 3300025924 | Ga0207694_10004254 | Ga0207694_100042542 | 151 |
| 433 | 3300025924 | Ga0207694_10916804 | Ga0207694_109168042 | 151 |
| 434 | 3300025925 | Ga0207650_10406838 | Ga0207650_104068382 | 151 |
| 435 | 3300025925 | Ga0207650_10681030 | Ga0207650_106810301 | 151 |
| 436 | 3300025928 | Ga0207700_11459780 | Ga0207700_114597801 | 151 |
| 437 | 3300025929 | Ga0207664_10001915 | Ga0207664_100019153 | 151 |
| 438 | 3300025929 | Ga0207664_10413576 | Ga0207664_104135762 | 151 |
| 439 | 3300025931 | Ga0207644_10861302 | Ga0207644_108613021 | 151 |
| 440 | 3300025931 | Ga0207644_10887655 | Ga0207644_108876551 | 151 |
| 441 | 3300025932 | Ga0207690_10026270 | Ga0207690_100262703 | 151 |
| 442 | 3300025932 | Ga0207690_10074575 | Ga0207690_100745752 | 151 |
| 443 | 3300025932 | Ga0207690_10913729 | Ga0207690_109137292 | 151 |
| 444 | 3300025933 | Ga0207706_10095679 | Ga0207706_100956793 | 151 |
| 445 | 3300025933 | Ga0207706_10130479 | Ga0207706_101304792 | 151 |
| 446 | 3300025933 | Ga0207706_11085158 | Ga0207706_110851581 | 151 |
| 447 | 3300025934 | Ga0207686_10598028 | Ga0207686_105980281 | 151 |
| 448 | 3300025936 | Ga0207670_10007419 | Ga0207670_100074193 | 151 |
| 449 | 3300025936 | Ga0207670_10027763 | Ga0207670_100277634 | 151 |
| 450 | 3300025936 | Ga0207670_10465185 | Ga0207670_104651851 | 151 |
| 451 | 3300025937 | Ga0207669_11593593 | Ga0207669_115935931 | 151 |
| 452 | 3300025938 | Ga0207704_10188645 | Ga0207704_101886452 | 151 |
| 453 | 3300025938 | Ga0207704_11203451 | Ga0207704_112034511 | 151 |
| 454 | 3300025939 | Ga0207665_10484409 | Ga0207665_104844091 | 151 |
| 455 | 3300025940 | Ga0207691_10061982 | Ga0207691_100619823 | 151 |
| 456 | 3300025940 | Ga0207691_10416418 | Ga0207691_104164181 | 151 |
| 457 | 3300025942 | Ga0207689_10003767 | Ga0207689_100037672 | 151 |
| 458 | 3300025942 | Ga0207689_10043742 | Ga0207689_100437423 | 151 |
| 459 | 3300025944 | Ga0207661_10000392 | Ga0207661_100003925 | 151 |
| 460 | 3300025944 | Ga0207661_10022874 | Ga0207661_100228745 | 151 |
| 461 | 3300025944 | Ga0207661_10051028 | Ga0207661_100510283 | 151 |
| 462 | 3300025944 | Ga0207661_10176822 | Ga0207661_101768222 | 151 |
| 463 | 3300025945 | Ga0207679_10001465 | Ga0207679_100014652 | 151 |
| 464 | 3300025945 | Ga0207679_10001859 | Ga0207679_100018593 | 151 |
| 465 | 3300025945 | Ga0207679_10458710 | Ga0207679_104587101 | 151 |
| 466 | 3300025945 | Ga0207679_11656533 | Ga0207679_116565331 | 151 |
| 467 | 3300025949 | Ga0207667_10031999 | Ga0207667_100319997 | 151 |
| 468 | 3300025949 | Ga0207667_10071701 | Ga0207667_100717014 | 151 |
| 469 | 3300025949 | Ga0207667_11637949 | Ga0207667_116379491 | 151 |
| 470 | 3300025961 | Ga0207712_10002412 | Ga0207712_1000241210 | 151 |
| 471 | 3300025961 | Ga0207712_10009047 | Ga0207712_100090474 | 151 |
| 472 | 3300025961 | Ga0207712_10065117 | Ga0207712_100651174 | 151 |
| 473 | 3300025961 | Ga0207712_10280007 | Ga0207712_102800072 | 151 |
| 474 | 3300025961 | Ga0207712_10336921 | Ga0207712_103369211 | 151 |
| 475 | 3300025972 | Ga0207668_10978585 | Ga0207668_109785851 | 151 |
| 476 | 3300025981 | Ga0207640_10011681 | Ga0207640_100116812 | 151 |
| 477 | 3300025981 | Ga0207640_10337907 | Ga0207640_103379072 | 151 |
| 478 | 3300025986 | Ga0207658_10490975 | Ga0207658_104909751 | 151 |
| 479 | 3300026023 | Ga0207677_10017200 | Ga0207677_100172004 | 151 |
| 480 | 3300026023 | Ga0207677_10395374 | Ga0207677_103953742 | 151 |
| 481 | 3300026035 | Ga0207703_10072251 | Ga0207703_100722513 | 151 |
| 482 | 3300026035 | Ga0207703_10449464 | Ga0207703_104494642 | 151 |
| 483 | 3300026035 | Ga0207703_10592041 | Ga0207703_105920411 | 151 |
| 484 | 3300026041 | Ga0207639_10003536 | Ga0207639_100035365 | 151 |
| 485 | 3300026041 | Ga0207639_10006299 | Ga0207639_100062993 | 151 |
| 486 | 3300026041 | Ga0207639_10040707 | Ga0207639_100407072 | 151 |
| 487 | 3300026041 | Ga0207639_10174266 | Ga0207639_101742662 | 151 |
| 488 | 3300026041 | Ga0207639_10264318 | Ga0207639_102643182 | 151 |
| 489 | 3300026041 | Ga0207639_11141608 | Ga0207639_111416081 | 151 |
| 490 | 3300026067 | Ga0207678_10329650 | Ga0207678_103296501 | 151 |
| 491 | 3300026067 | Ga0207678_10636980 | Ga0207678_106369801 | 151 |
| 492 | 3300026075 | Ga0207708_10146882 | Ga0207708_101468823 | 151 |
| 493 | 3300026075 | Ga0207708_10392807 | Ga0207708_103928072 | 151 |
| 494 | 3300026078 | Ga0207702_10004005 | Ga0207702_1000400512 | 151 |
| 495 | 3300026078 | Ga0207702_10568936 | Ga0207702_105689361 | 151 |
| 496 | 3300026088 | Ga0207641_10306079 | Ga0207641_103060792 | 151 |
| 497 | 3300026088 | Ga0207641_10625403 | Ga0207641_106254031 | 151 |
| 498 | 3300026088 | Ga0207641_10701429 | Ga0207641_107014292 | 151 |
| 499 | 3300026089 | Ga0207648_10015367 | Ga0207648_100153673 | 151 |
| 500 | 3300026089 | Ga0207648_10338924 | Ga0207648_103389242 | 151 |
| 501 | 3300026095 | Ga0207676_10049620 | Ga0207676_100496204 | 151 |
| 502 | 3300026095 | Ga0207676_10412658 | Ga0207676_104126582 | 151 |
| 503 | 3300026116 | Ga0207674_10004712 | Ga0207674_1000471213 | 151 |
| 504 | 3300026116 | Ga0207674_10006966 | Ga0207674_1000696613 | 151 |
| 505 | 3300026116 | Ga0207674_10034943 | Ga0207674_100349432 | 151 |
| 506 | 3300026116 | Ga0207674_10495951 | Ga0207674_104959511 | 151 |
| 507 | 3300026118 | Ga0207675_100005780 | Ga0207675_1000057805 | 151 |
| 508 | 3300026118 | Ga0207675_101466047 | Ga0207675_1014660471 | 151 |
| 509 | 3300026118 | Ga0207675_102000917 | Ga0207675_1020009172 | 151 |
| 510 | 3300026142 | Ga0207698_10013808 | Ga0207698_100138085 | 151 |
| 511 | 3300026142 | Ga0207698_10105083 | Ga0207698_101050832 | 151 |
| 512 | 3300026142 | Ga0207698_10281553 | Ga0207698_102815531 | 151 |
| 513 | 3300026142 | Ga0207698_10501413 | Ga0207698_105014132 | 151 |
| 514 | 3300026142 | Ga0207698_11359374 | Ga0207698_113593742 | 151 |
| 515 | 3300027866 | Ga0209813_10047796 | Ga0209813_100477962 | 151 |
| 516 | 3300028379 | Ga0268266_10461551 | Ga0268266_104615512 | 151 |
| 517 | 3300028379 | Ga0268266_10718803 | Ga0268266_107188032 | 151 |
| 518 | 3300028380 | Ga0268265_10058694 | Ga0268265_100586944 | 151 |
| 519 | 3300028381 | Ga0268264_10000447 | Ga0268264_1000044739 | 151 |
| 520 | 3300028381 | Ga0268264_10220455 | Ga0268264_102204552 | 151 |
| 521 | 3300028381 | Ga0268264_10388456 | Ga0268264_103884562 | 151 |
| 522 | 3300031241 | Ga0265325_10012028 | Ga0265325_100120282 | 151 |
| 523 | 3300031824 | Ga0307413_10066749 | Ga0307413_100667492 | 151 |
| 524 | 3300031852 | Ga0307410_10151098 | Ga0307410_101510982 | 151 |
| 525 | 3300031852 | Ga0307410_11183907 | Ga0307410_111839071 | 151 |
| 526 | 3300032004 | Ga0307414_11559866 | Ga0307414_115598661 | 151 |
| 527 | 3300035083 | Ga0373926_0065811 | Ga0373926_0065811_673_1140 | 151 |
| 528 | 3300035111 | Ga0373923_0003206 | Ga0373923_0003206_2269_2736 | 151 |
| 529 | 3300035113 | Ga0373936_0000357 | Ga0373936_0000357_2477_2944 | 151 |
| 530 | 3300035116 | Ga0373945_0010231 | Ga0373945_0010231_2171_2638 | 151 |
| 531 | 3300035117 | Ga0373953_0008757 | Ga0373953_0008757_1127_1594 | 151 |
| 532 | 3300035118 | Ga0373954_0002033 | Ga0373954_0002033_5133_5600 | 151 |
| 533 | 3300035120 | Ga0373957_0016029 | Ga0373957_0016029_1130_1597 | 151 |
| 534 | 3300035170 | Ga0373943_0000664 | Ga0373943_0000664_1623_2090 | 151 |
| 535 | 3300035171 | Ga0373946_0001722 | Ga0373946_0001722_2032_2499 | 151 |
| 536 | 3300035172 | Ga0373955_0002159 | Ga0373955_0002159_5116_5583 | 151 |
| 537 | 3300035410 | Ga0373924_0001935 | Ga0373924_0001935_3175_3642 | 151 |
| 538 | 3300035692 | Ga0373935_0000224 | Ga0373935_0000224_22027_22494 | 151 |
| 539 | 3300035695 | Ga0373927_0021415 | Ga0373927_0021415_429_896 | 151 |
| 540 | 3300035724 | Ga0373933_0025276 | Ga0373933_0025276_542_1009 | 151 |
| 541 | 3300035725 | Ga0373947_0011148 | Ga0373947_0011148_4160_4627 | 151 |
| 542 | 3300035725 | Ga0373947_0093237 | Ga0373947_0093237_691_1158 | 151 |
| 543 | 3300036401 | Ga0373937_0001096 | Ga0373937_0001096_21123_21590 | 151 |
| 544 | 3300037068 | Ga0373925_0000016 | Ga0373925_0000016_25908_26375 | 151 |
| 545 | 3300037312 | Ga0395899_0682219 | Ga0395899_0682219_153_626 | 151 |
| 546 | 3300037418 | Ga0395900_1203945 | Ga0395900_1203945_12_488 | 151 |
| 547 | 3300037471 | Ga0395905_0388339 | Ga0395905_0388339_127_606 | 151 |
| 548 | 3300037471 | Ga0395905_0655814 | Ga0395905_0655814_364_840 | 151 |
| 549 | 3300038443 | Ga0395901_0986358 | Ga0395901_0986358_302_778 | 151 |
| 550 | 3300041463 | Ga0451804_0654551 | Ga0451804_0654551_35_508 | 151 |
| 551 | 3300041486 | Ga0451807_1517432 | Ga0451807_1517432_800_1273 | 151 |
| 552 | 3300042436 | Ga0439435_0128685 | Ga0439435_0128685_146_619 | 151 |
| 553 | 3300042876 | Ga0451577_0872651 | Ga0451577_0872651_64_537 | 151 |
| 554 | 3300044693 | Ga0466961_0230819 | Ga0466961_0230819_422_898 | 151 |
| 555 | 3300044712 | Ga0453684_0140750 | Ga0453684_0140750_1048_1521 | 151 |
| 556 | 3300044719 | Ga0466971_0089837 | Ga0466971_0089837_399_875 | 151 |
| 557 | 3300044842 | Ga0466957_0379686 | Ga0466957_0379686_212_688 | 151 |
| 558 | 3300045049 | Ga0466959_0373679 | Ga0466959_0373679_350_826 | 151 |
| 559 | 3300045051 | Ga0451576_1137976 | Ga0451576_1137976_163_639 | 151 |
| 560 | 3300045836 | Ga0466958_0010359 | Ga0466958_0010359_1843_2319 | 151 |
| 561 | 3300046454 | Ga0495592_0000658 | Ga0495592_0000658_5120_5587 | 151 |
| 562 | 3300046459 | Ga0495629_0011770 | Ga0495629_0011770_1807_2274 | 151 |
| 563 | 3300046462 | Ga0495651_0000253 | Ga0495651_0000253_32229_32696 | 151 |
| 564 | 3300046463 | Ga0495653_0000045 | Ga0495653_0000045_5124_5591 | 151 |
| 565 | 3300046476 | Ga0495662_0020376 | Ga0495662_0020376_1506_1973 | 151 |
| 566 | 3300046477 | Ga0495664_0000004 | Ga0495664_0000004_5135_5602 | 151 |
| 567 | 3300046511 | Ga0495608_0000017 | Ga0495608_0000017_5122_5589 | 151 |
| 568 | 3300046514 | Ga0495618_0000350 | Ga0495618_0000350_27433_27900 | 151 |
| 569 | 3300046516 | Ga0495628_0000001 | Ga0495628_0000001_5124_5591 | 151 |
| 570 | 3300046517 | Ga0495630_0006902 | Ga0495630_0006902_5141_5608 | 151 |
| 571 | 3300046529 | Ga0495652_0000002 | Ga0495652_0000002_219658_220125 | 151 |
| 572 | 3300046533 | Ga0495640_0000001 | Ga0495640_0000001_313662_314129 | 151 |
| 573 | 3300046536 | Ga0495587_0000008 | Ga0495587_0000008_5342_5809 | 151 |
| 574 | 3300046543 | Ga0495645_0000002 | Ga0495645_0000002_5137_5604 | 151 |
| 575 | 3300046559 | Ga0495667_0000029 | Ga0495667_0000029_5133_5600 | 151 |
| 576 | 3300046642 | Ga0495634_0000339 | Ga0495634_0000339_5091_5558 | 151 |
| 577 | 3300046663 | Ga0495635_0000002 | Ga0495635_0000002_481333_481800 | 151 |
| 578 | 3300046675 | Ga0495657_0000064 | Ga0495657_0000064_88723_89190 | 151 |
| 579 | 3300046678 | Ga0495599_0000064 | Ga0495599_0000064_5136_5603 | 151 |
| 580 | 3300046679 | Ga0495623_0000065 | Ga0495623_0000065_5151_5618 | 151 |
| 581 | 3300046680 | Ga0495646_0000023 | Ga0495646_0000023_5011_5478 | 151 |
| 582 | 3300046689 | Ga0495613_0017402 | Ga0495613_0017402_2811_3278 | 151 |
| 583 | 3300046809 | Ga0495600_0000010 | Ga0495600_0000010_10373_10840 | 151 |
| 584 | 3300047317 | Ga0495604_0000009 | Ga0495604_0000009_320701_321168 | 151 |
| 585 | 3300047319 | Ga0495674_0000002 | Ga0495674_0000002_5125_5592 | 151 |
| 586 | 3300047322 | Ga0495680_0002286 | Ga0495680_0002286_14141_14608 | 151 |
| 587 | 3300047444 | Ga0495675_0000388 | Ga0495675_0000388_5118_5585 | 151 |
| 588 | 3300047471 | Ga0495684_0000006 | Ga0495684_0000006_5084_5551 | 151 |
| 589 | 3300047673 | Ga0495593_0004012 | Ga0495593_0004012_3241_3708 | 151 |
| 590 | 3300048088 | Ga0495602_0002184 | Ga0495602_0002184_5131_5598 | 151 |
| 591 | 3300048910 | Ga0496107_0407465 | Ga0496107_0407465_376_843 | 151 |
| 592 | 3300048913 | Ga0496110_0029315 | Ga0496110_0029315_1936_2409 | 151 |
| 593 | 3300048914 | Ga0496111_0302365 | Ga0496111_0302365_105_581 | 151 |
| 594 | 3300048916 | Ga0496113_0221839 | Ga0496113_0221839_951_1424 | 151 |
| 595 | 3300048917 | Ga0496114_0684657 | Ga0496114_0684657_302_769 | 151 |
| 596 | 3300048918 | Ga0496115_0033724 | Ga0496115_0033724_3545_4012 | 151 |
| 597 | 3300049568 | Ga0501031_0284787 | Ga0501031_0284787_141_611 | 151 |
| 598 | 3300049571 | Ga0501034_0041732 | Ga0501034_0041732_3835_4302 | 151 |
| 599 | 3300049585 | Ga0501069_0000165 | Ga0501069_0000165_20969_21442 | 151 |
| 600 | 3300049586 | Ga0501070_0013009 | Ga0501070_0013009_450_923 | 151 |
| 601 | 3300049587 | Ga0501071_0999108 | Ga0501071_0999108_130_609 | 151 |
| 602 | 3300050493 | nmdc:mga0k408_347444_c1 | nmdc:mga0k408_347444_c1_52_519 | 151 |
| 603 | 3300050508 | nmdc:mga09592_235999_c1 | nmdc:mga09592_235999_c1_622_1101 | 151 |
| 604 | 3300050513 | nmdc:mga0rr50_1098180_c1 | nmdc:mga0rr50_1098180_c1_172_648 | 151 |
| 605 | 3300050514 | nmdc:mga08x19_26776_c1 | nmdc:mga08x19_26776_c1_1438_1914 | 151 |
| 606 | 3300053077 | Ga0495601_0000002 | Ga0495601_0000002_305870_306337 | 151 |
| 607 | 3300053078 | Ga0495612_0000310 | Ga0495612_0000310_5136_5603 | 151 |
| 608 | 3300053084 | Ga0495595_0000020 | Ga0495595_0000020_5134_5601 | 151 |
| 609 | 3300053085 | Ga0495619_0000110 | Ga0495619_0000110_55839_56306 | 151 |
| 610 | 3300053093 | Ga0500651_0323538 | Ga0500651_0323538_288_761 | 151 |
| 611 | 3300054114 | Ga0501084_0828299 | Ga0501084_0828299_280_750 | 151 |
| 612 | 3300045976 | Ga0466967_1920476 | Ga0466967_1920476_52_540 | 153 |
| 613 | 3300013104 | Ga0157370_10432869 | Ga0157370_104328692 | 154 |
| 614 | 3300026116 | Ga0207674_10081159 | Ga0207674_100811593 | 155 |
| 615 | 3300003322 | rootL2_10108963 | rootL2_101089636 | 157 |
| 616 | 3300003323 | rootH1_10039019 | rootH1_100390196 | 157 |
| 617 | 3300013307 | Ga0157372_10710172 | Ga0157372_107101722 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xw1-assembly1.cif.gz_A | the crystal structure of ahpd from pseudomonas aeruginosa | 0.978 | 20 | 144 |
| 2ijc-assembly2.cif.gz_I | structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa | 0.9578 | 7 | 147 |
| 2gmy-assembly1.cif.gz_C | crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd | 0.9355 | 8 | 150 |
| 2ijc-assembly2.cif.gz_I | structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa | 0.9256 | 7 | 147 |
| 7xw1-assembly1.cif.gz_A | the crystal structure of ahpd from pseudomonas aeruginosa | 0.9134 | 20 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVE0_2_139_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9487 | 12 | 144 | 1.20.1290.10 |
| 2ijcF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9482 | 10 | 146 | 1.20.1290.10 |
| 2o4dA00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9381 | 10 | 147 | 1.20.1290.10 |
| 2gmyF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9333 | 8 | 151 | 1.20.1290.10 |
| 2ijcF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9283 | 10 | 146 | 1.20.1290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X6P6M7-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 0.9855 | 34 | 141 |
GO:0051920
|
| AF-A0A7V9HI84-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 0.9851 | 18 | 154 |
GO:0051920
|
| AF-A0A2N3TBP8-F1-model_v4 | AhpD family alkylhydroperoxidase | 0.9819 | 10 | 146 |
GO:0051920
|
| AF-A0A846US39-F1-model_v4 | deleted | 0.9819 | 10 | 144 |
|
| AF-A0A1E7RL96-F1-model_v4 | Alkylhydroperoxidase | 0.9813 | 10 | 141 |
GO:0051920
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar