F469559

General Info

Members Datasets Scaffolds Average Seq Length
616 277 1232 197

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10139529|Ga0307516_101395293
Length 186
Sequence MTTTTNAAPRADELATPASNRELFVAFTSLSLQGFGGVLPVAQRVLVERRRWLTKEQFVEMLAVSQVLPGPNVVNLALMFGDRCFGLRGAFAALAGMLLVPTLIVLALTALYGQFAQNPVVTGALRGMGAVAAGLVLKRNAMGLPLCLGFGAVTVLATAWLRVPLVWVILGLGAVAIAVAWSRLRP

Samples

Sample ID Description Type Environment
1 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
171 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
172 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
178 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
215 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
216 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
217 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
218 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
256 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
257 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
258 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
259 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
260 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
261 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
262 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
263 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
264 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
265 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
266 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
267 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
268 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
269 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
271 2643221570 Acidovorax sp. Root568 Isolate Unclassified
272 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
273 2643221652 Acidovorax sp. Root402 Isolate Unclassified
274 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
275 2643221717 Acidovorax sp. Root267 Isolate Unclassified
276 2842747753 Variovorax sp. R-72060 Isolate Unclassified
277 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 0
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.04
Nodule 0.16
Rhizoplane 3.25
Rhizosphere 81.33
Stem 0
Stem Tuber 0
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307516_10139529 3300031730 Bacteria 2195
2 JGI25152J39213_1026168 3300002773 Bacteria 957
3 JGI25151J46595_10000913 3300003187 Bacteria 23081
4 Ga0055535_1001892 3300003761 Bacteria 8831
5 Ga0055529_1001389 3300003763 Bacteria 7746
6 Ga0070658_10067963 3300005327 Bacteria 2912
7 Ga0070658_10246301 3300005327 Bacteria 1516
8 Ga0070658_10657158 3300005327 Bacteria 909
9 Ga0070658_10879830 3300005327 Bacteria 779
10 Ga0070676_10102174 3300005328 Bacteria 1773
11 Ga0070676_10149054 3300005328 Bacteria 1496
12 Ga0070676_10442975 3300005328 Bacteria 912
13 Ga0070670_100004429 3300005331 Bacteria 11766
14 Ga0070670_100033175 3300005331 Bacteria 4447
15 Ga0070670_100092030 3300005331 Bacteria 2607
16 Ga0070670_100114544 3300005331 Bacteria 2324
17 Ga0070670_100181295 3300005331 Bacteria 1828
18 Ga0070677_10014615 3300005333 Bacteria 2767
19 Ga0070677_10018947 3300005333 Bacteria 2486
20 Ga0070677_10125188 3300005333 Bacteria 1166
21 Ga0070677_10176692 3300005333 Bacteria 1014
22 Ga0068869_100035885 3300005334 Bacteria 3517
23 Ga0070666_10264664 3300005335 Bacteria 1219
24 Ga0070680_100007148 3300005336 Bacteria 8508
25 Ga0070680_100206703 3300005336 Bacteria 1656
26 Ga0068868_100005325 3300005338 Bacteria 9035
27 Ga0068868_100137356 3300005338 Bacteria 2005
28 Ga0068868_100153217 3300005338 Bacteria 1899
29 Ga0070660_100027786 3300005339 Bacteria 4226
30 Ga0070660_100178428 3300005339 Bacteria 1718
31 Ga0070661_100006922 3300005344 Bacteria 7825
32 Ga0070661_100125165 3300005344 Bacteria 1928
33 Ga0070661_100139908 3300005344 Bacteria 1823
34 Ga0070661_100176204 3300005344 Bacteria 1625
35 Ga0070668_100034394 3300005347 Bacteria 3861
36 Ga0070668_100036293 3300005347 Bacteria 3761
37 Ga0070668_100108677 3300005347 Bacteria 2206
38 Ga0070668_101047098 3300005347 Bacteria 735
39 Ga0070669_100009248 3300005353 Bacteria 7020
40 Ga0070669_100011470 3300005353 Bacteria 6292
41 Ga0070669_100030741 3300005353 Bacteria 3876
42 Ga0070669_100279441 3300005353 Bacteria 1337
43 Ga0070675_100001542 3300005354 Bacteria 17053
44 Ga0070675_100021409 3300005354 Bacteria 5167
45 Ga0070675_100159566 3300005354 Bacteria 1938
46 Ga0070675_100451086 3300005354 Bacteria 1153
47 Ga0070671_100000711 3300005355 Bacteria 23911
48 Ga0070671_100046017 3300005355 Bacteria 3628
49 Ga0070671_100081949 3300005355 Bacteria 2697
50 Ga0070671_100090261 3300005355 Bacteria 2565
51 Ga0070671_100121651 3300005355 Bacteria 2197
52 Ga0070671_100987027 3300005355 Bacteria 738
53 Ga0070674_100014342 3300005356 Bacteria 4927
54 Ga0070674_100039585 3300005356 Bacteria 3184
55 Ga0070674_100337149 3300005356 Bacteria 1213
56 Ga0070674_100578821 3300005356 Bacteria 946
57 Ga0070674_100592628 3300005356 Bacteria 935
58 Ga0070673_100052039 3300005364 Bacteria 3211
59 Ga0070673_100056250 3300005364 Bacteria 3103
60 Ga0070673_100056561 3300005364 Bacteria 3095
61 Ga0070673_100122253 3300005364 Bacteria 2174
62 Ga0070673_100137451 3300005364 Bacteria 2058
63 Ga0070673_101277559 3300005364 Bacteria 689
64 Ga0070688_100132528 3300005365 Bacteria 1683
65 Ga0070659_100001414 3300005366 Bacteria 17309
66 Ga0070659_100052681 3300005366 Bacteria 3201
67 Ga0070659_100142028 3300005366 Bacteria 1955
68 Ga0070659_100236803 3300005366 Bacteria 1509
69 Ga0070659_100266659 3300005366 Unclassified 1422
70 Ga0070659_100320965 3300005366 Bacteria 1295
71 Ga0070659_100702779 3300005366 Bacteria 874
72 Ga0070667_100097079 3300005367 Bacteria 2542
73 Ga0070667_100099891 3300005367 Bacteria 2505
74 Ga0070667_100343169 3300005367 Bacteria 1351
75 Ga0070667_100436916 3300005367 Bacteria 1195
76 Ga0070700_100070638 3300005441 Bacteria 2227
77 Ga0070708_100241478 3300005445 Bacteria 1696
78 Ga0070663_100058392 3300005455 Bacteria 2770
79 Ga0070678_100003295 3300005456 Bacteria 8977
80 Ga0070678_100026686 3300005456 Bacteria 3910
81 Ga0070678_100059248 3300005456 Bacteria 2813
82 Ga0070678_100061704 3300005456 Bacteria 2764
83 Ga0070678_100138304 3300005456 Bacteria 1945
84 Ga0070678_100582855 3300005456 Bacteria 997
85 Ga0070678_100651938 3300005456 Bacteria 944
86 Ga0070678_100809489 3300005456 Bacteria 851
87 Ga0070678_100833018 3300005456 Bacteria 839
88 Ga0070662_100003018 3300005457 Bacteria 10468
89 Ga0070662_100120546 3300005457 Bacteria 2010
90 Ga0068867_100017020 3300005459 Bacteria 5166
91 Ga0068867_100021462 3300005459 Bacteria 4607
92 Ga0068867_100021515 3300005459 Bacteria 4602
93 Ga0068867_100062461 3300005459 Bacteria 2767
94 Ga0068867_100075684 3300005459 Bacteria 2526
95 Ga0068867_100092426 3300005459 Bacteria 2298
96 Ga0070684_100045454 3300005535 Bacteria 3803
97 Ga0068853_100042371 3300005539 Bacteria 3891
98 Ga0068853_100261734 3300005539 Bacteria 1590
99 Ga0068853_100669155 3300005539 Bacteria 989
100 Ga0070672_100005741 3300005543 Bacteria 8272
101 Ga0070672_100011714 3300005543 Bacteria 6125
102 Ga0070672_100027112 3300005543 Bacteria 4271
103 Ga0070672_100061450 3300005543 Bacteria 2961
104 Ga0070672_100092593 3300005543 Bacteria 2440
105 Ga0070672_100328593 3300005543 Unclassified 1301
106 Ga0070672_100364690 3300005543 Bacteria 1233
107 Ga0070672_100733072 3300005543 Bacteria 866
108 Ga0070672_100809378 3300005543 Bacteria 825
109 Ga0070672_100871395 3300005543 Bacteria 794
110 Ga0070693_100206693 3300005547 Bacteria 1278
111 Ga0070693_100328488 3300005547 Bacteria 1040
112 Ga0070665_100126200 3300005548 Bacteria 2561
113 Ga0070665_100641637 3300005548 Bacteria 1075
114 Ga0068855_100018671 3300005563 Bacteria 8340
115 Ga0068855_100036782 3300005563 Bacteria 5825
116 Ga0068855_100681197 3300005563 Bacteria 1102
117 Ga0070664_100001442 3300005564 Bacteria 18959
118 Ga0070664_100058670 3300005564 Bacteria 3273
119 Ga0070664_100130097 3300005564 Bacteria 2210
120 Ga0070664_100222377 3300005564 Bacteria 1690
121 Ga0070664_100611970 3300005564 Bacteria 1011
122 Ga0068857_100192893 3300005577 Bacteria 1856
123 Ga0068854_100100823 3300005578 Bacteria 2165
124 Ga0068854_100253676 3300005578 Bacteria 1406
125 Ga0068856_100030895 3300005614 Bacteria 5238
126 Ga0068856_100041213 3300005614 Bacteria 4537
127 Ga0070702_100702570 3300005615 Bacteria 771
128 Ga0068852_100061937 3300005616 Bacteria 3252
129 Ga0068852_100090358 3300005616 Bacteria 2739
130 Ga0068852_100205238 3300005616 Bacteria 1866
131 Ga0068852_100205786 3300005616 Bacteria 1864
132 Ga0068852_100209461 3300005616 Bacteria 1849
133 Ga0068852_100772978 3300005616 Bacteria 973
134 Ga0068859_100023232 3300005617 Bacteria 6222
135 Ga0068859_100053222 3300005617 Bacteria 4071
136 Ga0068859_101744344 3300005617 Bacteria 688
137 Ga0068864_100052945 3300005618 Bacteria 3500
138 Ga0068864_100207936 3300005618 Bacteria 1801
139 Ga0068864_100514887 3300005618 Bacteria 1153
140 Ga0068866_10479336 3300005718 Bacteria 819
141 Ga0068861_100003160 3300005719 Bacteria 10893
142 Ga0068861_100017921 3300005719 Bacteria 5034
143 Ga0068861_100435663 3300005719 Bacteria 1171
144 Ga0068851_10002126 3300005834 Bacteria 8701
145 Ga0068851_10039824 3300005834 Bacteria 2361
146 Ga0068870_10018190 3300005840 Bacteria 3390
147 Ga0068870_10159117 3300005840 Bacteria 1338
148 Ga0068863_100042091 3300005841 Bacteria 4341
149 Ga0068863_100263481 3300005841 Bacteria 1667
150 Ga0068863_100289600 3300005841 Bacteria 1587
151 Ga0068863_100299029 3300005841 Bacteria 1561
152 Ga0068862_100949386 3300005844 Bacteria 848
153 Ga0075363_100019397 3300006048 Bacteria 3400
154 Ga0075363_100037499 3300006048 Bacteria 2546
155 Ga0075364_10045931 3300006051 Bacteria 2843
156 Ga0075362_10020603 3300006177 Bacteria 2757
157 Ga0075362_10042675 3300006177 Bacteria 2006
158 Ga0075362_10056052 3300006177 Bacteria 1773
159 Ga0075367_10001732 3300006178 Bacteria 9554
160 Ga0075367_10010067 3300006178 Bacteria 4957
161 Ga0075367_10051822 3300006178 Bacteria 2427
162 Ga0075367_10182791 3300006178 Bacteria 1307
163 Ga0075369_10062810 3300006186 Bacteria 1623
164 Ga0075366_10000104 3300006195 Bacteria 34139
165 Ga0075366_10000464 3300006195 Bacteria 18904
166 Ga0075366_10006458 3300006195 Bacteria 6426
167 Ga0075366_10114583 3300006195 Bacteria 1623
168 Ga0075366_10170624 3300006195 Bacteria 1320
169 Ga0075366_10176176 3300006195 Bacteria 1298
170 Ga0097621_100043698 3300006237 Bacteria 3612
171 Ga0097621_100076151 3300006237 Bacteria 2782
172 Ga0097621_100089566 3300006237 Bacteria 2573
173 Ga0097621_100118102 3300006237 Bacteria 2248
174 Ga0097621_100243943 3300006237 Bacteria 1571
175 Ga0097621_100914812 3300006237 Bacteria 818
176 Ga0075370_10004415 3300006353 Bacteria 6831
177 Ga0075370_10006066 3300006353 Bacteria 6057
178 Ga0075370_10207066 3300006353 Bacteria 1158
179 Ga0075370_10330756 3300006353 Bacteria 908
180 Ga0075370_10389010 3300006353 Bacteria 836
181 Ga0068871_100092191 3300006358 Bacteria 2526
182 Ga0068871_100126617 3300006358 Bacteria 2162
183 Ga0068871_101122095 3300006358 Bacteria 736
184 Ga0075431_100405939 3300006847 Bacteria 1363
185 Ga0075434_100322539 3300006871 Bacteria 1565
186 Ga0075429_100003387 3300006880 Bacteria 13593
187 Ga0068865_100108998 3300006881 Bacteria 2039
188 Ga0068865_100246875 3300006881 Bacteria 1407
189 Ga0068865_100247015 3300006881 Bacteria 1407
190 Ga0097620_100023232 3300006931 Bacteria 6222
191 Ga0097620_100053222 3300006931 Bacteria 4071
192 Ga0097620_101744335 3300006931 Bacteria 688
193 Ga0105240_10010419 3300009093 Bacteria 13061
194 Ga0105240_10104473 3300009093 Bacteria 3440
195 Ga0105240_10484984 3300009093 Bacteria 1377
196 Ga0105245_10399927 3300009098 Bacteria 1372
197 Ga0105243_10056067 3300009148 Bacteria 3132
198 Ga0105243_10167640 3300009148 Bacteria 1899
199 Ga0105243_10948834 3300009148 Bacteria 859
200 Ga0105242_10188615 3300009176 Bacteria 1824
201 Ga0105242_10221538 3300009176 Bacteria 1691
202 Ga0105248_10013789 3300009177 Bacteria 8896
203 Ga0105248_10014088 3300009177 Bacteria 8798
204 Ga0105248_10107670 3300009177 Bacteria 3143
205 Ga0105237_10004927 3300009545 Bacteria 15265
206 Ga0105238_11132622 3300009551 Bacteria 806
207 Ga0105249_10011327 3300009553 Bacteria 7829
208 Ga0105249_10137882 3300009553 Bacteria 2337
209 Ga0105239_10231408 3300010375 Bacteria 2073
210 Ga0105246_10251135 3300011119 Bacteria 1404
211 Ga0157369_10655266 3300013105 Bacteria 1083
212 Ga0157374_10007940 3300013296 Bacteria 9063
213 Ga0157374_10747586 3300013296 Bacteria 992
214 Ga0157378_10184600 3300013297 Bacteria 1964
215 Ga0157378_11118679 3300013297 Unclassified 825
216 Ga0163162_10003553 3300013306 Bacteria 14913
217 Ga0163162_10026145 3300013306 Bacteria 5768
218 Ga0163162_10605632 3300013306 Bacteria 1221
219 Ga0157375_10013906 3300013308 Bacteria 7176
220 Ga0157375_10054303 3300013308 Bacteria 3945
221 Ga0157375_10071341 3300013308 Bacteria 3486
222 Ga0157375_10084931 3300013308 Bacteria 3215
223 Ga0157375_10307025 3300013308 Bacteria 1751
224 Ga0157375_10316409 3300013308 Bacteria 1725
225 Ga0157375_11393062 3300013308 Bacteria 826
226 Ga0163163_10012882 3300014325 Bacteria 7635
227 Ga0163163_10272358 3300014325 Bacteria 1744
228 Ga0157380_10015076 3300014326 Bacteria 5671
229 Ga0157380_10066199 3300014326 Bacteria 2905
230 Ga0157380_10207187 3300014326 Bacteria 1744
231 Ga0182008_10003595 3300014497 Bacteria 9279
232 Ga0157377_10000781 3300014745 Bacteria 13158
233 Ga0157377_10804610 3300014745 Bacteria 693
234 Ga0157379_10009134 3300014968 Bacteria 8632
235 Ga0157379_10200423 3300014968 Bacteria 1805
236 Ga0157379_10379466 3300014968 Bacteria 1297
237 Ga0157376_10034183 3300014969 Bacteria 4103
238 Ga0157376_10617979 3300014969 Bacteria 1080
239 Ga0157376_10978020 3300014969 Bacteria 868
240 Ga0163161_10019360 3300017792 Bacteria 4775
241 Ga0163161_10027391 3300017792 Bacteria 4042
242 Ga0163161_10336793 3300017792 Bacteria 1196
243 Ga0213876_10060768 3300021384 Bacteria 1994
244 Ga0209258_100559 3300025242 Bacteria 32575
245 Ga0209677_102956 3300025253 Bacteria 5921
246 Ga0209759_1001628 3300025256 Bacteria 11940
247 Ga0209759_1024977 3300025256 Bacteria 1281
248 Ga0209129_1003748 3300025258 Bacteria 6418
249 Ga0207666_1028675 3300025271 Bacteria 846
250 Ga0209455_1000643 3300025272 Bacteria 21407
251 Ga0209025_1000217 3300025294 Bacteria 137909
252 Ga0209025_1004428 3300025294 Bacteria 12210
253 Ga0209051_1012311 3300025303 Bacteria 4147
254 Ga0209257_1037944 3300025304 Bacteria 1464
255 Ga0207697_10008867 3300025315 Bacteria 4373
256 Ga0207656_10042957 3300025321 Bacteria 1926
257 Ga0207656_10051339 3300025321 Bacteria 1783
258 Ga0207656_10058835 3300025321 Bacteria 1680
259 Ga0207682_10002474 3300025893 Bacteria 8270
260 Ga0207682_10013686 3300025893 Bacteria 3159
261 Ga0207682_10040232 3300025893 Bacteria 1904
262 Ga0207682_10042297 3300025893 Bacteria 1862
263 Ga0207682_10080125 3300025893 Bacteria 1398
264 Ga0207682_10098178 3300025893 Bacteria 1277
265 Ga0207688_10139725 3300025901 Bacteria 1425
266 Ga0207680_10022913 3300025903 Bacteria 3402
267 Ga0207680_10138469 3300025903 Bacteria 1611
268 Ga0207645_10028497 3300025907 Bacteria 3604
269 Ga0207645_10126511 3300025907 Bacteria 1661
270 Ga0207645_10157511 3300025907 Bacteria 1484
271 Ga0207645_10159152 3300025907 Bacteria 1477
272 Ga0207643_10038357 3300025908 Bacteria 2691
273 Ga0207643_10543583 3300025908 Bacteria 745
274 Ga0207705_10152935 3300025909 Bacteria 1729
275 Ga0207684_10166419 3300025910 Bacteria 1900
276 Ga0207707_10127546 3300025912 Bacteria 2225
277 Ga0207695_10049379 3300025913 Bacteria 4436
278 Ga0207695_10076647 3300025913 Bacteria 3398
279 Ga0207671_10020807 3300025914 Bacteria 4989
280 Ga0207660_10026715 3300025917 Bacteria 3933
281 Ga0207660_10300572 3300025917 Bacteria 1278
282 Ga0207657_10037305 3300025919 Bacteria 4341
283 Ga0207657_10247866 3300025919 Bacteria 1421
284 Ga0207657_10292723 3300025919 Bacteria 1291
285 Ga0207649_10000814 3300025920 Bacteria 20063
286 Ga0207649_10073620 3300025920 Bacteria 2189
287 Ga0207649_10080647 3300025920 Bacteria 2105
288 Ga0207652_10032317 3300025921 Bacteria 4398
289 Ga0207652_10033064 3300025921 Bacteria 4353
290 Ga0207681_10009273 3300025923 Bacteria 6012
291 Ga0207681_10113234 3300025923 Bacteria 1977
292 Ga0207650_10000494 3300025925 Bacteria 32860
293 Ga0207650_10088278 3300025925 Bacteria 2364
294 Ga0207650_10327371 3300025925 Bacteria 1256
295 Ga0207650_10890743 3300025925 Bacteria 755
296 Ga0207650_10893165 3300025925 Bacteria 754
297 Ga0207650_10925446 3300025925 Bacteria 740
298 Ga0207650_10934739 3300025925 Bacteria 737
299 Ga0207659_10000668 3300025926 Bacteria 20280
300 Ga0207659_10001917 3300025926 Bacteria 12336
301 Ga0207659_10123622 3300025926 Bacteria 1986
302 Ga0207687_10074199 3300025927 Bacteria 2437
303 Ga0207644_10000432 3300025931 Bacteria 27181
304 Ga0207644_10013080 3300025931 Bacteria 5524
305 Ga0207644_10038180 3300025931 Bacteria 3381
306 Ga0207644_10101453 3300025931 Bacteria 2162
307 Ga0207644_10122700 3300025931 Bacteria 1980
308 Ga0207644_10736587 3300025931 Bacteria 823
309 Ga0207690_10000712 3300025932 Bacteria 21429
310 Ga0207690_10246001 3300025932 Bacteria 1379
311 Ga0207706_10001019 3300025933 Bacteria 28600
312 Ga0207706_10001042 3300025933 Bacteria 28146
313 Ga0207706_10013070 3300025933 Bacteria 7554
314 Ga0207706_10069176 3300025933 Bacteria 3105
315 Ga0207706_10371119 3300025933 Bacteria 1243
316 Ga0207709_10032416 3300025935 Bacteria 3059
317 Ga0207709_10040187 3300025935 Bacteria 2799
318 Ga0207709_10276614 3300025935 Bacteria 1238
319 Ga0207709_10473660 3300025935 Bacteria 972
320 Ga0207669_10024687 3300025937 Bacteria 3235
321 Ga0207669_10152781 3300025937 Bacteria 1619
322 Ga0207669_10302790 3300025937 Bacteria 1216
323 Ga0207669_10316018 3300025937 Bacteria 1193
324 Ga0207704_10146711 3300025938 Bacteria 1659
325 Ga0207704_10210134 3300025938 Bacteria 1432
326 Ga0207691_10001693 3300025940 Bacteria 21768
327 Ga0207691_10015304 3300025940 Bacteria 7298
328 Ga0207691_10038648 3300025940 Bacteria 4417
329 Ga0207691_10041950 3300025940 Bacteria 4221
330 Ga0207691_10050789 3300025940 Bacteria 3794
331 Ga0207691_10062196 3300025940 Bacteria 3389
332 Ga0207691_10082380 3300025940 Bacteria 2890
333 Ga0207691_10192848 3300025940 Unclassified 1776
334 Ga0207691_10386965 3300025940 Bacteria 1194
335 Ga0207711_10023180 3300025941 Bacteria 5196
336 Ga0207711_10049116 3300025941 Bacteria 3612
337 Ga0207711_10069371 3300025941 Bacteria 3055
338 Ga0207711_10073139 3300025941 Bacteria 2979
339 Ga0207711_10077337 3300025941 Bacteria 2900
340 Ga0207689_10000267 3300025942 Bacteria 47185
341 Ga0207689_10006479 3300025942 Bacteria 10344
342 Ga0207689_10016740 3300025942 Bacteria 6206
343 Ga0207689_10111993 3300025942 Bacteria 2243
344 Ga0207689_10199640 3300025942 Bacteria 1651
345 Ga0207689_10207067 3300025942 Bacteria 1620
346 Ga0207679_10000430 3300025945 Bacteria 29840
347 Ga0207679_10065590 3300025945 Bacteria 2718
348 Ga0207679_10214330 3300025945 Bacteria 1617
349 Ga0207679_10521019 3300025945 Bacteria 1063
350 Ga0207679_11113258 3300025945 Bacteria 724
351 Ga0207667_10061680 3300025949 Bacteria 3923
352 Ga0207667_10157996 3300025949 Bacteria 2333
353 Ga0207667_10304060 3300025949 Bacteria 1629
354 Ga0207651_10003948 3300025960 Bacteria 7364
355 Ga0207651_10012528 3300025960 Bacteria 4804
356 Ga0207651_10058961 3300025960 Bacteria 2655
357 Ga0207651_10059914 3300025960 Bacteria 2639
358 Ga0207651_10104284 3300025960 Bacteria 2112
359 Ga0207651_10164830 3300025960 Bacteria 1741
360 Ga0207651_10234657 3300025960 Bacteria 1491
361 Ga0207712_10024137 3300025961 Bacteria 4023
362 Ga0207712_10283089 3300025961 Bacteria 1354
363 Ga0207668_10043704 3300025972 Bacteria 3043
364 Ga0207668_10052090 3300025972 Bacteria 2830
365 Ga0207668_10160508 3300025972 Bacteria 1751
366 Ga0207668_11040171 3300025972 Bacteria 733
367 Ga0207640_10095773 3300025981 Bacteria 2068
368 Ga0207640_10158709 3300025981 Bacteria 1671
369 Ga0207658_10071756 3300025986 Bacteria 2623
370 Ga0207658_10169107 3300025986 Bacteria 1799
371 Ga0207658_10316693 3300025986 Bacteria 1349
372 Ga0207658_10328824 3300025986 Bacteria 1325
373 Ga0207658_10342735 3300025986 Bacteria 1299
374 Ga0207658_10351117 3300025986 Bacteria 1284
375 Ga0207677_10002208 3300026023 Bacteria 10221
376 Ga0207677_10011025 3300026023 Bacteria 5135
377 Ga0207677_10136347 3300026023 Bacteria 1872
378 Ga0207677_10228903 3300026023 Bacteria 1496
379 Ga0207677_10335051 3300026023 Bacteria 1262
380 Ga0207677_10960625 3300026023 Bacteria 773
381 Ga0207703_10006782 3300026035 Bacteria 9129
382 Ga0207639_10038369 3300026041 Bacteria 3563
383 Ga0207678_10074639 3300026067 Bacteria 2906
384 Ga0207678_10251920 3300026067 Bacteria 1512
385 Ga0207708_10006289 3300026075 Bacteria 8801
386 Ga0207702_10025659 3300026078 Bacteria 4891
387 Ga0207702_10050832 3300026078 Bacteria 3500
388 Ga0207641_10027163 3300026088 Bacteria 4726
389 Ga0207641_10027422 3300026088 Bacteria 4703
390 Ga0207641_10047636 3300026088 Bacteria 3615
391 Ga0207641_10050734 3300026088 Bacteria 3511
392 Ga0207641_10089877 3300026088 Bacteria 2684
393 Ga0207641_10281343 3300026088 Bacteria 1565
394 Ga0207641_10693483 3300026088 Bacteria 1002
395 Ga0207648_10010031 3300026089 Bacteria 9009
396 Ga0207648_10016656 3300026089 Bacteria 6708
397 Ga0207648_10087750 3300026089 Bacteria 2715
398 Ga0207648_10132622 3300026089 Bacteria 2193
399 Ga0207648_10285676 3300026089 Bacteria 1476
400 Ga0207648_10747020 3300026089 Bacteria 908
401 Ga0207676_10007554 3300026095 Bacteria 7712
402 Ga0207676_10063679 3300026095 Bacteria 2929
403 Ga0207676_10303574 3300026095 Unclassified 1458
404 Ga0207676_10418378 3300026095 Bacteria 1256
405 Ga0207674_10015845 3300026116 Bacteria 8266
406 Ga0207674_10364089 3300026116 Bacteria 1398
407 Ga0207674_10548239 3300026116 Bacteria 1117
408 Ga0207675_100000232 3300026118 Bacteria 52682
409 Ga0207675_100202940 3300026118 Bacteria 1905
410 Ga0207675_100770386 3300026118 Bacteria 974
411 Ga0207675_101197980 3300026118 Bacteria 780
412 Ga0207683_10014270 3300026121 Bacteria 6768
413 Ga0207683_10030177 3300026121 Bacteria 4697
414 Ga0207683_10047996 3300026121 Bacteria 3739
415 Ga0207683_10079678 3300026121 Bacteria 2904
416 Ga0207683_10107537 3300026121 Bacteria 2495
417 Ga0207683_10273178 3300026121 Bacteria 1544
418 Ga0207683_10539171 3300026121 Bacteria 1079
419 Ga0207683_10611758 3300026121 Bacteria 1009
420 Ga0207683_10614781 3300026121 Bacteria 1006
421 Ga0207683_10787487 3300026121 Bacteria 882
422 Ga0207698_10003465 3300026142 Bacteria 9501
423 Ga0207698_10013930 3300026142 Bacteria 5326
424 Ga0207698_10145359 3300026142 Bacteria 2050
425 Ga0207698_10305621 3300026142 Bacteria 1483
426 Ga0207698_10449948 3300026142 Bacteria 1243
427 Ga0207698_11115175 3300026142 Bacteria 802
428 Ga0209813_10075345 3300027866 Bacteria 1105
429 Ga0268266_10007234 3300028379 Bacteria 10040
430 Ga0268266_10078956 3300028379 Bacteria 2865
431 Ga0268266_10206249 3300028379 Bacteria 1801
432 Ga0268265_10457338 3300028380 Bacteria 1194
433 Ga0268265_10875536 3300028380 Bacteria 880
434 Ga0268264_10080522 3300028381 Bacteria 2781
435 Ga0268264_10410766 3300028381 Bacteria 1303
436 Ga0265336_10000044 3300028666 Bacteria 131932
437 Ga0307515_10113992 3300028794 Bacteria 3128
438 Ga0307515_10406290 3300028794 Bacteria 986
439 Ga0307515_10518801 3300028794 Bacteria 801
440 Ga0265324_10002851 3300029957 Bacteria 8502
441 Ga0307513_10000014 3300031456 Bacteria 303157
442 Ga0307513_10134556 3300031456 Bacteria 2410
443 Ga0307513_10134696 3300031456 Bacteria 2408
444 Ga0307513_10382713 3300031456 Bacteria 1146
445 Ga0307513_10413578 3300031456 Bacteria 1080
446 Ga0307509_10085390 3300031507 Bacteria 3248
447 Ga0307509_10232299 3300031507 Bacteria 1646
448 Ga0307408_100096184 3300031548 Bacteria 2246
449 Ga0307408_100127055 3300031548 Bacteria 1984
450 Ga0307408_100400986 3300031548 Bacteria 1178
451 Ga0307408_100809676 3300031548 Bacteria 851
452 Ga0307508_10001639 3300031616 Bacteria 24934
453 Ga0307405_10010745 3300031731 Bacteria 4759
454 Ga0307405_10763684 3300031731 Bacteria 806
455 Ga0307405_10765172 3300031731 Bacteria 806
456 Ga0307413_10101481 3300031824 Bacteria 1902
457 Ga0307413_10235981 3300031824 Bacteria 1347
458 Ga0307410_10146790 3300031852 Bacteria 1751
459 Ga0307410_10351137 3300031852 Bacteria 1178
460 Ga0307406_10080558 3300031901 Bacteria 2162
461 Ga0307406_10354195 3300031901 Bacteria 1148
462 Ga0307407_10059464 3300031903 Bacteria 2226
463 Ga0307407_10260101 3300031903 Bacteria 1193
464 Ga0307412_10007419 3300031911 Bacteria 6221
465 Ga0307409_100197283 3300031995 Bacteria 1797
466 Ga0307409_100362329 3300031995 Bacteria 1372
467 Ga0307416_100010130 3300032002 Bacteria 6211
468 Ga0307416_100577807 3300032002 Bacteria 1201
469 Ga0307416_101282917 3300032002 Bacteria 838
470 Ga0307414_10394584 3300032004 Bacteria 1200
471 Ga0307411_10000694 3300032005 Bacteria 12373
472 Ga0307411_10106385 3300032005 Bacteria 1997
473 Ga0307415_100064266 3300032126 Bacteria 2553
474 Ga0307507_10376972 3300033179 Bacteria 819
475 Ga0307510_10010547 3300033180 Bacteria 10975
476 Ga0373959_0035691 3300034820 Bacteria 1023
477 Ga0373941_0105124 3300035115 Bacteria 988
478 Ga0373962_0055748 3300035242 Bacteria 1149
479 Ga0373947_0110925 3300035725 Bacteria 1733
480 Ga0395898_0012004 3300037466 Bacteria 8968
481 Ga0436365_1260691 3300039437 Bacteria 2287
482 Ga0451853_3131359 3300041512 Bacteria 1366
483 Ga0439462_0027464 3300042015 Bacteria 1502
484 Ga0450918_000001 3300042531 Bacteria 65425
485 Ga0451577_0068516 3300042876 Bacteria 3164
486 Ga0466969_0020537 3300044656 Bacteria 3419
487 Ga0466972_0082037 3300044658 Bacteria 1535
488 Ga0466965_0158924 3300044683 Bacteria 1184
489 Ga0466966_0312327 3300044684 Bacteria 945
490 Ga0466961_0010327 3300044693 Bacteria 5952
491 Ga0466961_0177134 3300044693 Bacteria 1324
492 Ga0466964_0006179 3300044706 Bacteria 4461
493 Ga0453684_0195714 3300044712 Bacteria 2361
494 Ga0453684_0314739 3300044712 Bacteria 1775
495 Ga0453684_0708988 3300044712 Bacteria 1093
496 Ga0466970_0018622 3300044765 Bacteria 3597
497 Ga0466957_0030838 3300044842 Bacteria 3201
498 Ga0466957_0270299 3300044842 Bacteria 1135
499 Ga0466959_0000284 3300045049 Bacteria 30923
500 Ga0451576_0000545 3300045051 Bacteria 80903
501 Ga0451576_0449396 3300045051 Bacteria 1353
502 Ga0451576_1287075 3300045051 Bacteria 762
503 Ga0466958_0024665 3300045836 Bacteria 3538
504 Ga0466967_0020123 3300045976 Bacteria 5384
505 Ga0495592_0009238 3300046454 Bacteria 7415
506 Ga0495651_0319314 3300046462 Bacteria 1036
507 Ga0495650_0003973 3300046471 Bacteria 10393
508 Ga0495650_0051677 3300046471 Bacteria 1692
509 Ga0495639_0010501 3300046475 Bacteria 3987
510 Ga0495639_0340805 3300046475 Unclassified 752
511 Ga0495616_0047284 3300046513 Bacteria 2168
512 Ga0495620_0046608 3300046515 Bacteria 1871
513 Ga0495631_0054378 3300046518 Bacteria 1746
514 Ga0495632_0041238 3300046519 Bacteria 2320
515 Ga0495643_0028760 3300046522 Bacteria 3113
516 Ga0495642_0115094 3300046528 Bacteria 1152
517 Ga0495642_0300753 3300046528 Bacteria 703
518 Ga0495640_0284305 3300046533 Bacteria 1030
519 Ga0495586_0292562 3300046535 Bacteria 933
520 Ga0495598_0028914 3300046537 Bacteria 1541
521 Ga0495621_0003038 3300046539 Bacteria 4579
522 Ga0495621_0011263 3300046539 Bacteria 2761
523 Ga0495621_0044068 3300046539 Bacteria 1576
524 Ga0495597_0026511 3300046542 Bacteria 2662
525 Ga0495597_0032771 3300046542 Bacteria 2356
526 Ga0495645_0316318 3300046543 Bacteria 1015
527 Ga0495656_0000076 3300046615 Bacteria 44185
528 Ga0495611_0058896 3300046648 Bacteria 1743
529 Ga0495670_0073310 3300046691 Bacteria 1735
530 Ga0495649_0005646 3300046694 Bacteria 7901
531 Ga0495660_0013104 3300046810 Bacteria 4806
532 Ga0495687_000421 3300047443 Bacteria 52470
533 Ga0495687_008531 3300047443 Bacteria 5856
534 Ga0495673_0129828 3300047469 Bacteria 991
535 Ga0495614_0249032 3300048089 Bacteria 812
536 Ga0495615_0002143 3300048090 Bacteria 3107
537 Ga0495626_0013367 3300048091 Bacteria 4266
538 Ga0496100_0006090 3300048903 Bacteria 6556
539 Ga0496101_0013581 3300048904 Bacteria 5461
540 Ga0496101_0463623 3300048904 Bacteria 1000
541 Ga0496103_0366060 3300048906 Bacteria 927
542 Ga0496104_0000625 3300048907 Bacteria 30296
543 Ga0496104_0138615 3300048907 Bacteria 2338
544 Ga0496105_0000638 3300048908 Bacteria 23463
545 Ga0496106_0104830 3300048909 Bacteria 2196
546 Ga0496107_0032494 3300048910 Bacteria 3730
547 Ga0496107_0106993 3300048910 Bacteria 2054
548 Ga0496107_0177404 3300048910 Bacteria 1582
549 Ga0496108_0035893 3300048911 Bacteria 4123
550 Ga0496108_0061430 3300048911 Bacteria 3162
551 Ga0496109_0289074 3300048912 Bacteria 1545
552 Ga0496110_0252019 3300048913 Bacteria 1607
553 Ga0496110_0353289 3300048913 Bacteria 1339
554 Ga0496110_0355375 3300048913 Bacteria 1335
555 Ga0496111_0451641 3300048914 Bacteria 948
556 Ga0496112_0083295 3300048915 Bacteria 3163
557 Ga0496114_0142335 3300048917 Bacteria 2077
558 Ga0496121_0520061 3300048924 Bacteria 751
559 Ga0495682_0021700 3300049460 Bacteria 2405
560 Ga0501036_0219216 3300049572 Bacteria 1598
561 Ga0501037_0086442 3300049573 Bacteria 2270
562 Ga0501038_0383953 3300049574 Unclassified 1089
563 Ga0501039_0024530 3300049575 Bacteria 4633
564 Ga0501048_0212511 3300049582 Bacteria 1372
565 Ga0501075_0075153 3300049591 Bacteria 2555
566 Ga0501079_0187780 3300049741 Bacteria 1613
567 Ga0501080_0182455 3300049742 Bacteria 1931
568 Ga0501266_000897 3300049763 Bacteria 3871
569 Ga0501035_0275057 3300049822 Bacteria 1424
570 Ga0501044_0156511 3300049823 Bacteria 2258
571 Ga0501045_0070973 3300049824 Bacteria 2563
572 nmdc:mga03683_79877_c1 3300050489 Bacteria 1411
573 nmdc:mga03n38_5718_c2 3300050490 Bacteria 3372
574 nmdc:mga03n38_59226_c1 3300050490 Bacteria 1737
575 nmdc:mga00v17_88534_c1 3300050491 Bacteria 1941
576 nmdc:mga0k408_13406_c1 3300050493 Bacteria 4495
577 nmdc:mga0k408_17586_c1 3300050493 Bacteria 3985
578 nmdc:mga0k408_3045_c1 3300050493 Bacteria 8895
579 nmdc:mga0k408_389_c1 3300050493 Bacteria 24057
580 nmdc:mga0k408_4055_c1 3300050493 Bacteria 7769
581 nmdc:mga0k408_654_c1 3300050493 Bacteria 18954
582 nmdc:mga0k408_660_c1 3300050493 Bacteria 18895
583 nmdc:mga0k408_71633_c1 3300050493 Bacteria 2023
584 nmdc:mga06z11_5982_c1 3300050494 Bacteria 4917
585 nmdc:mga07m45_119068_c1 3300050496 Bacteria 1525
586 nmdc:mga07m45_1493_c1 3300050496 Bacteria 10739
587 nmdc:mga07m45_360_c1 3300050496 Bacteria 18571
588 nmdc:mga07m45_4529_c1 3300050496 Bacteria 6498
589 nmdc:mga09592_6121_c1 3300050508 Bacteria 9806
590 nmdc:mga0qj67_204054_c1 3300050509 Bacteria 1606
591 nmdc:mga0n895_645020_c1 3300050512 Bacteria 1058
592 nmdc:mga0sz30_80117_c1 3300050516 Bacteria 1413
593 Ga0500635_0000141 3300053080 Bacteria 40938
594 Ga0500578_0427298 3300053086 Bacteria 758
595 Ga0500643_088656 3300053087 Bacteria 845
596 Ga0500583_0062082 3300053092 Bacteria 1766
597 Ga0500651_0213860 3300053093 Bacteria 1133
598 Ga0500608_150837 3300053122 Bacteria 1019
599 Ga0500559_0001807 3300053136 Bacteria 11716
600 Ga0500568_0017510 3300053139 Bacteria 3162
601 Ga0500573_0004459 3300053140 Bacteria 7384
602 Ga0500586_027562 3300053145 Bacteria 1847
603 Ga0500619_000034 3300053154 Bacteria 41838
604 Ga0500619_032914 3300053154 Bacteria 1592
605 Ga0500620_012540 3300053155 Bacteria 2312
606 Ga0500645_000100 3300053730 Bacteria 68299
607 Ga0500645_002016 3300053730 Bacteria 9498
608 Ga0590075_021381 3300059424 Bacteria 1614
609 Ga0466962_0163151 3300061719 Bacteria 1083
610 2643865708 2643221570 Bacteria 5103772
611 2644244420 2643221644 Bacteria 6865017
612 2644294414 2643221652 Bacteria 5140275
613 2644305201 2643221654 Bacteria 5273570
614 2644647609 2643221717 Bacteria 5676132
615 2842749066 2842747753 Bacteria 5578255
616 2894025752 2894023352 Bacteria 5167372
617 Ga0307516_10139529
618 JGI25152J39213_1026168
619 JGI25151J46595_10000913
620 Ga0055535_1001892
621 Ga0055529_1001389
622 Ga0070658_10067963
623 Ga0070658_10246301
624 Ga0070658_10657158
625 Ga0070658_10879830
626 Ga0070676_10102174
627 Ga0070676_10149054
628 Ga0070676_10442975
629 Ga0070670_100004429
630 Ga0070670_100033175
631 Ga0070670_100092030
632 Ga0070670_100114544
633 Ga0070670_100181295
634 Ga0070677_10014615
635 Ga0070677_10018947
636 Ga0070677_10125188
637 Ga0070677_10176692
638 Ga0068869_100035885
639 Ga0070666_10264664
640 Ga0070680_100007148
641 Ga0070680_100206703
642 Ga0068868_100005325
643 Ga0068868_100137356
644 Ga0068868_100153217
645 Ga0070660_100027786
646 Ga0070660_100178428
647 Ga0070661_100006922
648 Ga0070661_100125165
649 Ga0070661_100139908
650 Ga0070661_100176204
651 Ga0070668_100034394
652 Ga0070668_100036293
653 Ga0070668_100108677
654 Ga0070668_101047098
655 Ga0070669_100009248
656 Ga0070669_100011470
657 Ga0070669_100030741
658 Ga0070669_100279441
659 Ga0070675_100001542
660 Ga0070675_100021409
661 Ga0070675_100159566
662 Ga0070675_100451086
663 Ga0070671_100000711
664 Ga0070671_100046017
665 Ga0070671_100081949
666 Ga0070671_100090261
667 Ga0070671_100121651
668 Ga0070671_100987027
669 Ga0070674_100014342
670 Ga0070674_100039585
671 Ga0070674_100337149
672 Ga0070674_100578821
673 Ga0070674_100592628
674 Ga0070673_100052039
675 Ga0070673_100056250
676 Ga0070673_100056561
677 Ga0070673_100122253
678 Ga0070673_100137451
679 Ga0070673_101277559
680 Ga0070688_100132528
681 Ga0070659_100001414
682 Ga0070659_100052681
683 Ga0070659_100142028
684 Ga0070659_100236803
685 Ga0070659_100266659
686 Ga0070659_100320965
687 Ga0070659_100702779
688 Ga0070667_100097079
689 Ga0070667_100099891
690 Ga0070667_100343169
691 Ga0070667_100436916
692 Ga0070700_100070638
693 Ga0070708_100241478
694 Ga0070663_100058392
695 Ga0070678_100003295
696 Ga0070678_100026686
697 Ga0070678_100059248
698 Ga0070678_100061704
699 Ga0070678_100138304
700 Ga0070678_100582855
701 Ga0070678_100651938
702 Ga0070678_100809489
703 Ga0070678_100833018
704 Ga0070662_100003018
705 Ga0070662_100120546
706 Ga0068867_100017020
707 Ga0068867_100021462
708 Ga0068867_100021515
709 Ga0068867_100062461
710 Ga0068867_100075684
711 Ga0068867_100092426
712 Ga0070684_100045454
713 Ga0068853_100042371
714 Ga0068853_100261734
715 Ga0068853_100669155
716 Ga0070672_100005741
717 Ga0070672_100011714
718 Ga0070672_100027112
719 Ga0070672_100061450
720 Ga0070672_100092593
721 Ga0070672_100328593
722 Ga0070672_100364690
723 Ga0070672_100733072
724 Ga0070672_100809378
725 Ga0070672_100871395
726 Ga0070693_100206693
727 Ga0070693_100328488
728 Ga0070665_100126200
729 Ga0070665_100641637
730 Ga0068855_100018671
731 Ga0068855_100036782
732 Ga0068855_100681197
733 Ga0070664_100001442
734 Ga0070664_100058670
735 Ga0070664_100130097
736 Ga0070664_100222377
737 Ga0070664_100611970
738 Ga0068857_100192893
739 Ga0068854_100100823
740 Ga0068854_100253676
741 Ga0068856_100030895
742 Ga0068856_100041213
743 Ga0070702_100702570
744 Ga0068852_100061937
745 Ga0068852_100090358
746 Ga0068852_100205238
747 Ga0068852_100205786
748 Ga0068852_100209461
749 Ga0068852_100772978
750 Ga0068859_100023232
751 Ga0068859_100053222
752 Ga0068859_101744344
753 Ga0068864_100052945
754 Ga0068864_100207936
755 Ga0068864_100514887
756 Ga0068866_10479336
757 Ga0068861_100003160
758 Ga0068861_100017921
759 Ga0068861_100435663
760 Ga0068851_10002126
761 Ga0068851_10039824
762 Ga0068870_10018190
763 Ga0068870_10159117
764 Ga0068863_100042091
765 Ga0068863_100263481
766 Ga0068863_100289600
767 Ga0068863_100299029
768 Ga0068862_100949386
769 Ga0075363_100019397
770 Ga0075363_100037499
771 Ga0075364_10045931
772 Ga0075362_10020603
773 Ga0075362_10042675
774 Ga0075362_10056052
775 Ga0075367_10001732
776 Ga0075367_10010067
777 Ga0075367_10051822
778 Ga0075367_10182791
779 Ga0075369_10062810
780 Ga0075366_10000104
781 Ga0075366_10000464
782 Ga0075366_10006458
783 Ga0075366_10114583
784 Ga0075366_10170624
785 Ga0075366_10176176
786 Ga0097621_100043698
787 Ga0097621_100076151
788 Ga0097621_100089566
789 Ga0097621_100118102
790 Ga0097621_100243943
791 Ga0097621_100914812
792 Ga0075370_10004415
793 Ga0075370_10006066
794 Ga0075370_10207066
795 Ga0075370_10330756
796 Ga0075370_10389010
797 Ga0068871_100092191
798 Ga0068871_100126617
799 Ga0068871_101122095
800 Ga0075431_100405939
801 Ga0075434_100322539
802 Ga0075429_100003387
803 Ga0068865_100108998
804 Ga0068865_100246875
805 Ga0068865_100247015
806 Ga0097620_100023232
807 Ga0097620_100053222
808 Ga0097620_101744335
809 Ga0105240_10010419
810 Ga0105240_10104473
811 Ga0105240_10484984
812 Ga0105245_10399927
813 Ga0105243_10056067
814 Ga0105243_10167640
815 Ga0105243_10948834
816 Ga0105242_10188615
817 Ga0105242_10221538
818 Ga0105248_10013789
819 Ga0105248_10014088
820 Ga0105248_10107670
821 Ga0105237_10004927
822 Ga0105238_11132622
823 Ga0105249_10011327
824 Ga0105249_10137882
825 Ga0105239_10231408
826 Ga0105246_10251135
827 Ga0157369_10655266
828 Ga0157374_10007940
829 Ga0157374_10747586
830 Ga0157378_10184600
831 Ga0157378_11118679
832 Ga0163162_10003553
833 Ga0163162_10026145
834 Ga0163162_10605632
835 Ga0157375_10013906
836 Ga0157375_10054303
837 Ga0157375_10071341
838 Ga0157375_10084931
839 Ga0157375_10307025
840 Ga0157375_10316409
841 Ga0157375_11393062
842 Ga0163163_10012882
843 Ga0163163_10272358
844 Ga0157380_10015076
845 Ga0157380_10066199
846 Ga0157380_10207187
847 Ga0182008_10003595
848 Ga0157377_10000781
849 Ga0157377_10804610
850 Ga0157379_10009134
851 Ga0157379_10200423
852 Ga0157379_10379466
853 Ga0157376_10034183
854 Ga0157376_10617979
855 Ga0157376_10978020
856 Ga0163161_10019360
857 Ga0163161_10027391
858 Ga0163161_10336793
859 Ga0213876_10060768
860 Ga0209258_100559
861 Ga0209677_102956
862 Ga0209759_1001628
863 Ga0209759_1024977
864 Ga0209129_1003748
865 Ga0207666_1028675
866 Ga0209455_1000643
867 Ga0209025_1000217
868 Ga0209025_1004428
869 Ga0209051_1012311
870 Ga0209257_1037944
871 Ga0207697_10008867
872 Ga0207656_10042957
873 Ga0207656_10051339
874 Ga0207656_10058835
875 Ga0207682_10002474
876 Ga0207682_10013686
877 Ga0207682_10040232
878 Ga0207682_10042297
879 Ga0207682_10080125
880 Ga0207682_10098178
881 Ga0207688_10139725
882 Ga0207680_10022913
883 Ga0207680_10138469
884 Ga0207645_10028497
885 Ga0207645_10126511
886 Ga0207645_10157511
887 Ga0207645_10159152
888 Ga0207643_10038357
889 Ga0207643_10543583
890 Ga0207705_10152935
891 Ga0207684_10166419
892 Ga0207707_10127546
893 Ga0207695_10049379
894 Ga0207695_10076647
895 Ga0207671_10020807
896 Ga0207660_10026715
897 Ga0207660_10300572
898 Ga0207657_10037305
899 Ga0207657_10247866
900 Ga0207657_10292723
901 Ga0207649_10000814
902 Ga0207649_10073620
903 Ga0207649_10080647
904 Ga0207652_10032317
905 Ga0207652_10033064
906 Ga0207681_10009273
907 Ga0207681_10113234
908 Ga0207650_10000494
909 Ga0207650_10088278
910 Ga0207650_10327371
911 Ga0207650_10890743
912 Ga0207650_10893165
913 Ga0207650_10925446
914 Ga0207650_10934739
915 Ga0207659_10000668
916 Ga0207659_10001917
917 Ga0207659_10123622
918 Ga0207687_10074199
919 Ga0207644_10000432
920 Ga0207644_10013080
921 Ga0207644_10038180
922 Ga0207644_10101453
923 Ga0207644_10122700
924 Ga0207644_10736587
925 Ga0207690_10000712
926 Ga0207690_10246001
927 Ga0207706_10001019
928 Ga0207706_10001042
929 Ga0207706_10013070
930 Ga0207706_10069176
931 Ga0207706_10371119
932 Ga0207709_10032416
933 Ga0207709_10040187
934 Ga0207709_10276614
935 Ga0207709_10473660
936 Ga0207669_10024687
937 Ga0207669_10152781
938 Ga0207669_10302790
939 Ga0207669_10316018
940 Ga0207704_10146711
941 Ga0207704_10210134
942 Ga0207691_10001693
943 Ga0207691_10015304
944 Ga0207691_10038648
945 Ga0207691_10041950
946 Ga0207691_10050789
947 Ga0207691_10062196
948 Ga0207691_10082380
949 Ga0207691_10192848
950 Ga0207691_10386965
951 Ga0207711_10023180
952 Ga0207711_10049116
953 Ga0207711_10069371
954 Ga0207711_10073139
955 Ga0207711_10077337
956 Ga0207689_10000267
957 Ga0207689_10006479
958 Ga0207689_10016740
959 Ga0207689_10111993
960 Ga0207689_10199640
961 Ga0207689_10207067
962 Ga0207679_10000430
963 Ga0207679_10065590
964 Ga0207679_10214330
965 Ga0207679_10521019
966 Ga0207679_11113258
967 Ga0207667_10061680
968 Ga0207667_10157996
969 Ga0207667_10304060
970 Ga0207651_10003948
971 Ga0207651_10012528
972 Ga0207651_10058961
973 Ga0207651_10059914
974 Ga0207651_10104284
975 Ga0207651_10164830
976 Ga0207651_10234657
977 Ga0207712_10024137
978 Ga0207712_10283089
979 Ga0207668_10043704
980 Ga0207668_10052090
981 Ga0207668_10160508
982 Ga0207668_11040171
983 Ga0207640_10095773
984 Ga0207640_10158709
985 Ga0207658_10071756
986 Ga0207658_10169107
987 Ga0207658_10316693
988 Ga0207658_10328824
989 Ga0207658_10342735
990 Ga0207658_10351117
991 Ga0207677_10002208
992 Ga0207677_10011025
993 Ga0207677_10136347
994 Ga0207677_10228903
995 Ga0207677_10335051
996 Ga0207677_10960625
997 Ga0207703_10006782
998 Ga0207639_10038369
999 Ga0207678_10074639
1000 Ga0207678_10251920
1001 Ga0207708_10006289
1002 Ga0207702_10025659
1003 Ga0207702_10050832
1004 Ga0207641_10027163
1005 Ga0207641_10027422
1006 Ga0207641_10047636
1007 Ga0207641_10050734
1008 Ga0207641_10089877
1009 Ga0207641_10281343
1010 Ga0207641_10693483
1011 Ga0207648_10010031
1012 Ga0207648_10016656
1013 Ga0207648_10087750
1014 Ga0207648_10132622
1015 Ga0207648_10285676
1016 Ga0207648_10747020
1017 Ga0207676_10007554
1018 Ga0207676_10063679
1019 Ga0207676_10303574
1020 Ga0207676_10418378
1021 Ga0207674_10015845
1022 Ga0207674_10364089
1023 Ga0207674_10548239
1024 Ga0207675_100000232
1025 Ga0207675_100202940
1026 Ga0207675_100770386
1027 Ga0207675_101197980
1028 Ga0207683_10014270
1029 Ga0207683_10030177
1030 Ga0207683_10047996
1031 Ga0207683_10079678
1032 Ga0207683_10107537
1033 Ga0207683_10273178
1034 Ga0207683_10539171
1035 Ga0207683_10611758
1036 Ga0207683_10614781
1037 Ga0207683_10787487
1038 Ga0207698_10003465
1039 Ga0207698_10013930
1040 Ga0207698_10145359
1041 Ga0207698_10305621
1042 Ga0207698_10449948
1043 Ga0207698_11115175
1044 Ga0209813_10075345
1045 Ga0268266_10007234
1046 Ga0268266_10078956
1047 Ga0268266_10206249
1048 Ga0268265_10457338
1049 Ga0268265_10875536
1050 Ga0268264_10080522
1051 Ga0268264_10410766
1052 Ga0265336_10000044
1053 Ga0307515_10113992
1054 Ga0307515_10406290
1055 Ga0307515_10518801
1056 Ga0265324_10002851
1057 Ga0307513_10000014
1058 Ga0307513_10134556
1059 Ga0307513_10134696
1060 Ga0307513_10382713
1061 Ga0307513_10413578
1062 Ga0307509_10085390
1063 Ga0307509_10232299
1064 Ga0307408_100096184
1065 Ga0307408_100127055
1066 Ga0307408_100400986
1067 Ga0307408_100809676
1068 Ga0307508_10001639
1069 Ga0307405_10010745
1070 Ga0307405_10763684
1071 Ga0307405_10765172
1072 Ga0307413_10101481
1073 Ga0307413_10235981
1074 Ga0307410_10146790
1075 Ga0307410_10351137
1076 Ga0307406_10080558
1077 Ga0307406_10354195
1078 Ga0307407_10059464
1079 Ga0307407_10260101
1080 Ga0307412_10007419
1081 Ga0307409_100197283
1082 Ga0307409_100362329
1083 Ga0307416_100010130
1084 Ga0307416_100577807
1085 Ga0307416_101282917
1086 Ga0307414_10394584
1087 Ga0307411_10000694
1088 Ga0307411_10106385
1089 Ga0307415_100064266
1090 Ga0307507_10376972
1091 Ga0307510_10010547
1092 Ga0373959_0035691
1093 Ga0373941_0105124
1094 Ga0373962_0055748
1095 Ga0373947_0110925
1096 Ga0395898_0012004
1097 Ga0436365_1260691
1098 Ga0451853_3131359
1099 Ga0439462_0027464
1100 Ga0450918_000001
1101 Ga0451577_0068516
1102 Ga0466969_0020537
1103 Ga0466972_0082037
1104 Ga0466965_0158924
1105 Ga0466966_0312327
1106 Ga0466961_0010327
1107 Ga0466961_0177134
1108 Ga0466964_0006179
1109 Ga0453684_0195714
1110 Ga0453684_0314739
1111 Ga0453684_0708988
1112 Ga0466970_0018622
1113 Ga0466957_0030838
1114 Ga0466957_0270299
1115 Ga0466959_0000284
1116 Ga0451576_0000545
1117 Ga0451576_0449396
1118 Ga0451576_1287075
1119 Ga0466958_0024665
1120 Ga0466967_0020123
1121 Ga0495592_0009238
1122 Ga0495651_0319314
1123 Ga0495650_0003973
1124 Ga0495650_0051677
1125 Ga0495639_0010501
1126 Ga0495639_0340805
1127 Ga0495616_0047284
1128 Ga0495620_0046608
1129 Ga0495631_0054378
1130 Ga0495632_0041238
1131 Ga0495643_0028760
1132 Ga0495642_0115094
1133 Ga0495642_0300753
1134 Ga0495640_0284305
1135 Ga0495586_0292562
1136 Ga0495598_0028914
1137 Ga0495621_0003038
1138 Ga0495621_0011263
1139 Ga0495621_0044068
1140 Ga0495597_0026511
1141 Ga0495597_0032771
1142 Ga0495645_0316318
1143 Ga0495656_0000076
1144 Ga0495611_0058896
1145 Ga0495670_0073310
1146 Ga0495649_0005646
1147 Ga0495660_0013104
1148 Ga0495687_000421
1149 Ga0495687_008531
1150 Ga0495673_0129828
1151 Ga0495614_0249032
1152 Ga0495615_0002143
1153 Ga0495626_0013367
1154 Ga0496100_0006090
1155 Ga0496101_0013581
1156 Ga0496101_0463623
1157 Ga0496103_0366060
1158 Ga0496104_0000625
1159 Ga0496104_0138615
1160 Ga0496105_0000638
1161 Ga0496106_0104830
1162 Ga0496107_0032494
1163 Ga0496107_0106993
1164 Ga0496107_0177404
1165 Ga0496108_0035893
1166 Ga0496108_0061430
1167 Ga0496109_0289074
1168 Ga0496110_0252019
1169 Ga0496110_0353289
1170 Ga0496110_0355375
1171 Ga0496111_0451641
1172 Ga0496112_0083295
1173 Ga0496114_0142335
1174 Ga0496121_0520061
1175 Ga0495682_0021700
1176 Ga0501036_0219216
1177 Ga0501037_0086442
1178 Ga0501038_0383953
1179 Ga0501039_0024530
1180 Ga0501048_0212511
1181 Ga0501075_0075153
1182 Ga0501079_0187780
1183 Ga0501080_0182455
1184 Ga0501266_000897
1185 Ga0501035_0275057
1186 Ga0501044_0156511
1187 Ga0501045_0070973
1188 nmdc:mga03683_79877_c1
1189 nmdc:mga03n38_5718_c2
1190 nmdc:mga03n38_59226_c1
1191 nmdc:mga00v17_88534_c1
1192 nmdc:mga0k408_13406_c1
1193 nmdc:mga0k408_17586_c1
1194 nmdc:mga0k408_3045_c1
1195 nmdc:mga0k408_389_c1
1196 nmdc:mga0k408_4055_c1
1197 nmdc:mga0k408_654_c1
1198 nmdc:mga0k408_660_c1
1199 nmdc:mga0k408_71633_c1
1200 nmdc:mga06z11_5982_c1
1201 nmdc:mga07m45_119068_c1
1202 nmdc:mga07m45_1493_c1
1203 nmdc:mga07m45_360_c1
1204 nmdc:mga07m45_4529_c1
1205 nmdc:mga09592_6121_c1
1206 nmdc:mga0qj67_204054_c1
1207 nmdc:mga0n895_645020_c1
1208 nmdc:mga0sz30_80117_c1
1209 Ga0500635_0000141
1210 Ga0500578_0427298
1211 Ga0500643_088656
1212 Ga0500583_0062082
1213 Ga0500651_0213860
1214 Ga0500608_150837
1215 Ga0500559_0001807
1216 Ga0500568_0017510
1217 Ga0500573_0004459
1218 Ga0500586_027562
1219 Ga0500619_000034
1220 Ga0500619_032914
1221 Ga0500620_012540
1222 Ga0500645_000100
1223 Ga0500645_002016
1224 Ga0590075_021381
1225 Ga0466962_0163151
1226 2643865708
1227 2644244420
1228 2644294414
1229 2644305201
1230 2644647609
1231 2842749066
1232 2894025752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02417

Chromate_transp

Chromate transporter

21

177

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6spf-assembly1.cif.gz_d pseudomonas aeruginosa 70s ribosome from an aminoglycoside resistant clinical isolate 0.685 35 80
1qd7-assembly1.cif.gz_C partial model for 30s ribosomal subunit 0.6231 25 82
7z6h-assembly1.cif.gz_G structure of dna-bound human rad17-rfc clamp loader and 9-1-1 checkpoint clamp 0.2834 22 99
5b57-assembly1.cif.gz_C inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.2785 9 99
2zop-assembly1.cif.gz_A x-ray crystal structure of a crispr-associated cmr5 family protein from thermus thermophilus hb8 0.2552 18 95
ID Description Score Start End Superfamily
1vs7D01 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S4 Delta 41; Chain A, domain 1;Ribosomal protein S4/S9, N-terminal domain 0.4497 18 97 1.10.1050.10
af_Q96DT5_3705_3795_1.10.8.1220 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.4048 20 97 1.10.8.1220
af_Q8IVF4_3648_3738_1.10.8.1220 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.3772 20 97 1.10.8.1220
af_Q96DT5_3705_3795_1.10.8.1220 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.3587 20 97 1.10.8.1220
af_Q8TE73_3816_3904_1.10.8.1220 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.3514 20 97 1.10.8.1220
ID Description Score Start End GO Terms
AF-A0A519GM40-F1-model_v4 Chromate transporter 0.9604 9 114 GO:0005886
GO:0015109
AF-A0A519GM40-F1-model_v4 Chromate transporter 0.9517 9 114 GO:0005886
GO:0015109
AF-A0A847VF89-F1-model_v4 Chromate transporter 0.9504 8 97 GO:0005886
GO:0015109
AF-A0A258LKJ7-F1-model_v4 Chromate transporter 0.9492 16 115 GO:0005886
GO:0015109
AF-A0A3D3PLJ7-F1-model_v4 Chromate transporter 0.9401 6 98 GO:0005886
GO:0015109

Map