F469522
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 616 | 317 | 616 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300005530|Ga0070679_100449118|Ga0070679_1004491182 |
| Length | 152 |
| Sequence | MSLLSRSHKQDSPAPSGSMRAVARQREKYTHDVKMGNHQLVADEPTEQGGHDEGPNPQELLAASLASCTAVTMEMYAQRKGWDIGGVEVVCEYTPAERGCPTKFDLVLRLSDDLSDEQVERLRVIAAKCPVHRTLDGEVMFDERVERVTLAH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 109 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 112 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 170 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 175 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 184 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 194 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 195 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 196 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 200 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 201 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 202 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 203 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 204 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 207 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 208 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 209 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 210 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 211 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 212 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 255 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 256 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 257 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 258 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 259 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 260 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 263 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 266 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 269 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 270 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 271 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 272 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 309 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 310 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 311 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 312 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.92 |
| Metatranscriptomes | 3.08 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.81 |
| Nodule | 0 |
| Rhizoplane | 12.34 |
| Rhizosphere | 81.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1020692 | 3300000549 | Bacteria | 765 |
| 2 | Ga0070683_100001798 | 3300005329 | Bacteria | 16709 |
| 3 | Ga0070683_100373327 | 3300005329 | Bacteria | 1359 |
| 4 | Ga0070690_100344330 | 3300005330 | Bacteria | 1080 |
| 5 | Ga0068869_100051454 | 3300005334 | Bacteria | 2989 |
| 6 | Ga0068869_100757719 | 3300005334 | Bacteria | 832 |
| 7 | Ga0070680_100337163 | 3300005336 | Unclassified | 1281 |
| 8 | Ga0070680_100566338 | 3300005336 | Bacteria | 974 |
| 9 | Ga0070680_100789632 | 3300005336 | Bacteria | 818 |
| 10 | Ga0070682_100009060 | 3300005337 | Bacteria | 5626 |
| 11 | Ga0070682_100041971 | 3300005337 | Bacteria | 2822 |
| 12 | Ga0070682_100715011 | 3300005337 | Bacteria | 805 |
| 13 | Ga0068868_100008651 | 3300005338 | Bacteria | 7288 |
| 14 | Ga0068868_100332540 | 3300005338 | Bacteria | 1297 |
| 15 | Ga0068868_100724343 | 3300005338 | Bacteria | 892 |
| 16 | Ga0070660_100177501 | 3300005339 | Bacteria | 1723 |
| 17 | Ga0070660_100184302 | 3300005339 | Bacteria | 1690 |
| 18 | Ga0070660_100547721 | 3300005339 | Bacteria | 965 |
| 19 | Ga0070660_101331383 | 3300005339 | Bacteria | 610 |
| 20 | Ga0070689_100144614 | 3300005340 | Bacteria | 1914 |
| 21 | Ga0070691_10020996 | 3300005341 | Bacteria | 3020 |
| 22 | Ga0070661_100072394 | 3300005344 | Bacteria | 2536 |
| 23 | Ga0070661_100456057 | 3300005344 | Bacteria | 1018 |
| 24 | Ga0070692_10092109 | 3300005345 | Unclassified | 1649 |
| 25 | Ga0070692_10274015 | 3300005345 | Bacteria | 1020 |
| 26 | Ga0070668_100287799 | 3300005347 | Bacteria | 1374 |
| 27 | Ga0070668_100469898 | 3300005347 | Bacteria | 1084 |
| 28 | Ga0070669_100019081 | 3300005353 | Bacteria | 4902 |
| 29 | Ga0070675_100034760 | 3300005354 | Bacteria | 4091 |
| 30 | Ga0070671_100264832 | 3300005355 | Bacteria | 1461 |
| 31 | Ga0070671_101301640 | 3300005355 | Bacteria | 641 |
| 32 | Ga0070674_100082894 | 3300005356 | Bacteria | 2295 |
| 33 | Ga0070673_100306157 | 3300005364 | Bacteria | 1400 |
| 34 | Ga0070688_100133986 | 3300005365 | Bacteria | 1675 |
| 35 | Ga0070688_100486115 | 3300005365 | Bacteria | 929 |
| 36 | Ga0070659_100000077 | 3300005366 | Bacteria | 76934 |
| 37 | Ga0070659_100110662 | 3300005366 | Bacteria | 2217 |
| 38 | Ga0070667_100594130 | 3300005367 | Bacteria | 1019 |
| 39 | Ga0070709_10291791 | 3300005434 | Bacteria | 1189 |
| 40 | Ga0070709_10827507 | 3300005434 | Bacteria | 728 |
| 41 | Ga0070714_100022302 | 3300005435 | Bacteria | 5191 |
| 42 | Ga0070714_100764360 | 3300005435 | Bacteria | 935 |
| 43 | Ga0070713_101328556 | 3300005436 | Bacteria | 697 |
| 44 | Ga0070713_101704262 | 3300005436 | Unclassified | 612 |
| 45 | Ga0070710_10000008 | 3300005437 | Bacteria | 198148 |
| 46 | Ga0070710_10037752 | 3300005437 | Bacteria | 2650 |
| 47 | Ga0070710_10083974 | 3300005437 | Unclassified | 1865 |
| 48 | Ga0070701_10174389 | 3300005438 | Bacteria | 1254 |
| 49 | Ga0070711_100155062 | 3300005439 | Bacteria | 1731 |
| 50 | Ga0070711_101108582 | 3300005439 | Unclassified | 682 |
| 51 | Ga0070711_101259812 | 3300005439 | Bacteria | 641 |
| 52 | Ga0070705_100000672 | 3300005440 | Bacteria | 19566 |
| 53 | Ga0070700_100003076 | 3300005441 | Bacteria | 8556 |
| 54 | Ga0070708_101433992 | 3300005445 | Bacteria | 644 |
| 55 | Ga0070663_100099987 | 3300005455 | Bacteria | 2163 |
| 56 | Ga0070678_100302542 | 3300005456 | Unclassified | 1359 |
| 57 | Ga0070678_101234579 | 3300005456 | Bacteria | 694 |
| 58 | Ga0070662_100032258 | 3300005457 | Bacteria | 3681 |
| 59 | Ga0070681_10252251 | 3300005458 | Bacteria | 1677 |
| 60 | Ga0070681_10989201 | 3300005458 | Archaea | 761 |
| 61 | Ga0070685_10098642 | 3300005466 | Bacteria | 1780 |
| 62 | Ga0070685_10244541 | 3300005466 | Bacteria | 1186 |
| 63 | Ga0070707_100144558 | 3300005468 | Bacteria | 2315 |
| 64 | Ga0070679_100449118 | 3300005530 | Bacteria | 1234 |
| 65 | Ga0070679_100583151 | 3300005530 | Bacteria | 1062 |
| 66 | Ga0070679_101178600 | 3300005530 | Bacteria | 711 |
| 67 | Ga0070679_101840826 | 3300005530 | Bacteria | 554 |
| 68 | Ga0070684_100163401 | 3300005535 | Bacteria | 2021 |
| 69 | Ga0070684_100574782 | 3300005535 | Bacteria | 1047 |
| 70 | Ga0070684_100765790 | 3300005535 | Bacteria | 901 |
| 71 | Ga0070672_100197559 | 3300005543 | Bacteria | 1681 |
| 72 | Ga0070686_100625536 | 3300005544 | Bacteria | 851 |
| 73 | Ga0070686_100692156 | 3300005544 | Bacteria | 812 |
| 74 | Ga0070665_100091723 | 3300005548 | Bacteria | 3043 |
| 75 | Ga0070704_100435971 | 3300005549 | Bacteria | 1125 |
| 76 | Ga0068855_100558006 | 3300005563 | Bacteria | 1239 |
| 77 | Ga0070664_100536963 | 3300005564 | Bacteria | 1080 |
| 78 | Ga0070664_100572651 | 3300005564 | Bacteria | 1046 |
| 79 | Ga0068857_100075708 | 3300005577 | Bacteria | 3001 |
| 80 | Ga0068857_100267992 | 3300005577 | Bacteria | 1569 |
| 81 | Ga0068854_100144634 | 3300005578 | Bacteria | 1828 |
| 82 | Ga0068856_100020785 | 3300005614 | Bacteria | 6380 |
| 83 | Ga0068856_100563078 | 3300005614 | Bacteria | 1161 |
| 84 | Ga0068856_100680071 | 3300005614 | Bacteria | 1050 |
| 85 | Ga0070702_100021806 | 3300005615 | Bacteria | 3377 |
| 86 | Ga0068852_100087150 | 3300005616 | Bacteria | 2785 |
| 87 | Ga0068852_101458175 | 3300005616 | Bacteria | 707 |
| 88 | Ga0068864_100725836 | 3300005618 | Bacteria | 972 |
| 89 | Ga0068866_10066706 | 3300005718 | Unclassified | 1887 |
| 90 | Ga0068861_100167093 | 3300005719 | Bacteria | 1820 |
| 91 | Ga0068861_100991632 | 3300005719 | Bacteria | 801 |
| 92 | Ga0068851_10060580 | 3300005834 | Bacteria | 1938 |
| 93 | Ga0068851_10187658 | 3300005834 | Bacteria | 1148 |
| 94 | Ga0068870_10428312 | 3300005840 | Bacteria | 867 |
| 95 | Ga0068863_101386097 | 3300005841 | Bacteria | 711 |
| 96 | Ga0068860_100375346 | 3300005843 | Bacteria | 1403 |
| 97 | Ga0081455_10008319 | 3300005937 | Bacteria | 10809 |
| 98 | Ga0081455_10092830 | 3300005937 | Bacteria | 2441 |
| 99 | Ga0081540_1004173 | 3300005983 | Bacteria | 11118 |
| 100 | Ga0081539_10007659 | 3300005985 | Bacteria | 9717 |
| 101 | Ga0081539_10082721 | 3300005985 | Bacteria | 1682 |
| 102 | Ga0070717_10000004 | 3300006028 | Bacteria | 365525 |
| 103 | Ga0070717_10954532 | 3300006028 | Bacteria | 781 |
| 104 | Ga0075432_10059069 | 3300006058 | Bacteria | 1363 |
| 105 | Ga0070715_11031358 | 3300006163 | Bacteria | 514 |
| 106 | Ga0070716_101519850 | 3300006173 | Bacteria | 548 |
| 107 | Ga0070712_100000008 | 3300006175 | Bacteria | 149644 |
| 108 | Ga0070712_100031283 | 3300006175 | Bacteria | 3584 |
| 109 | Ga0070712_100190508 | 3300006175 | Bacteria | 1605 |
| 110 | Ga0070712_101252477 | 3300006175 | Unclassified | 646 |
| 111 | Ga0097621_100588395 | 3300006237 | Bacteria | 1016 |
| 112 | Ga0068871_102124377 | 3300006358 | Bacteria | 535 |
| 113 | Ga0075428_102426713 | 3300006844 | Bacteria | 538 |
| 114 | Ga0075430_100002873 | 3300006846 | Bacteria | 14412 |
| 115 | Ga0075431_100083633 | 3300006847 | Bacteria | 3295 |
| 116 | Ga0075433_10045774 | 3300006852 | Bacteria | 3804 |
| 117 | Ga0075434_100026628 | 3300006871 | Bacteria | 5667 |
| 118 | Ga0075434_100415070 | 3300006871 | Bacteria | 1367 |
| 119 | Ga0075429_100046787 | 3300006880 | Bacteria | 3764 |
| 120 | Ga0068865_100115175 | 3300006881 | Bacteria | 1989 |
| 121 | Ga0075435_101105893 | 3300007076 | Bacteria | 693 |
| 122 | Ga0105240_10007645 | 3300009093 | Bacteria | 15655 |
| 123 | Ga0105240_10112780 | 3300009093 | Bacteria | 3286 |
| 124 | Ga0105240_10598127 | 3300009093 | Bacteria | 1215 |
| 125 | Ga0111539_10105520 | 3300009094 | Bacteria | 3305 |
| 126 | Ga0111539_10367904 | 3300009094 | Bacteria | 1673 |
| 127 | Ga0111539_11326795 | 3300009094 | Bacteria | 835 |
| 128 | Ga0105245_10006591 | 3300009098 | Bacteria | 10193 |
| 129 | Ga0105245_10097986 | 3300009098 | Bacteria | 2709 |
| 130 | Ga0105245_10576849 | 3300009098 | Bacteria | 1149 |
| 131 | Ga0105245_10899125 | 3300009098 | Bacteria | 927 |
| 132 | Ga0105245_11384834 | 3300009098 | Bacteria | 753 |
| 133 | Ga0105247_10569664 | 3300009101 | Bacteria | 835 |
| 134 | Ga0114129_11369610 | 3300009147 | Bacteria | 874 |
| 135 | Ga0105243_10423616 | 3300009148 | Bacteria | 1242 |
| 136 | Ga0105243_10700352 | 3300009148 | Bacteria | 987 |
| 137 | Ga0105241_10128389 | 3300009174 | Bacteria | 2050 |
| 138 | Ga0105242_11080562 | 3300009176 | Bacteria | 815 |
| 139 | Ga0105248_10065118 | 3300009177 | Bacteria | 4091 |
| 140 | Ga0105248_10266355 | 3300009177 | Bacteria | 1929 |
| 141 | Ga0105237_10650610 | 3300009545 | Bacteria | 1061 |
| 142 | Ga0105237_10675430 | 3300009545 | Bacteria | 1040 |
| 143 | Ga0105238_10701518 | 3300009551 | Bacteria | 1024 |
| 144 | Ga0105249_10994646 | 3300009553 | Bacteria | 907 |
| 145 | Ga0105249_11508022 | 3300009553 | Bacteria | 745 |
| 146 | Ga0105239_10042058 | 3300010375 | Bacteria | 5007 |
| 147 | Ga0105239_10227359 | 3300010375 | Bacteria | 2093 |
| 148 | Ga0105239_10377028 | 3300010375 | Unclassified | 1604 |
| 149 | Ga0105239_10585561 | 3300010375 | Bacteria | 1272 |
| 150 | Ga0105239_10767126 | 3300010375 | Bacteria | 1104 |
| 151 | Ga0157322_1007991 | 3300012490 | Bacteria | 798 |
| 152 | Ga0157369_10346602 | 3300013105 | Bacteria | 1543 |
| 153 | Ga0157369_11068067 | 3300013105 | Bacteria | 826 |
| 154 | Ga0157369_11372197 | 3300013105 | Bacteria | 720 |
| 155 | Ga0157374_10039180 | 3300013296 | Bacteria | 4361 |
| 156 | Ga0157374_10671169 | 3300013296 | Bacteria | 1049 |
| 157 | Ga0157378_10170348 | 3300013297 | Bacteria | 2042 |
| 158 | Ga0157378_10537119 | 3300013297 | Bacteria | 1173 |
| 159 | Ga0157378_10737876 | 3300013297 | Bacteria | 1007 |
| 160 | Ga0157378_12814262 | 3300013297 | Bacteria | 539 |
| 161 | Ga0163162_10091804 | 3300013306 | Bacteria | 3120 |
| 162 | Ga0163162_10594298 | 3300013306 | Bacteria | 1233 |
| 163 | Ga0163162_11365603 | 3300013306 | Bacteria | 806 |
| 164 | Ga0157372_10008742 | 3300013307 | Bacteria | 10752 |
| 165 | Ga0157372_10617333 | 3300013307 | Bacteria | 1264 |
| 166 | Ga0157372_10701359 | 3300013307 | Bacteria | 1178 |
| 167 | Ga0157372_10821912 | 3300013307 | Bacteria | 1079 |
| 168 | Ga0157372_11459464 | 3300013307 | Unclassified | 788 |
| 169 | Ga0157375_11026411 | 3300013308 | Bacteria | 963 |
| 170 | Ga0157375_11313413 | 3300013308 | Bacteria | 851 |
| 171 | Ga0163163_10054198 | 3300014325 | Bacteria | 3961 |
| 172 | Ga0163163_10228497 | 3300014325 | Bacteria | 1910 |
| 173 | Ga0163163_10587441 | 3300014325 | Bacteria | 1177 |
| 174 | Ga0163163_11106452 | 3300014325 | Bacteria | 855 |
| 175 | Ga0157380_10403702 | 3300014326 | Bacteria | 1297 |
| 176 | Ga0157380_10590885 | 3300014326 | Bacteria | 1097 |
| 177 | Ga0157380_11069956 | 3300014326 | Bacteria | 844 |
| 178 | Ga0157380_11652968 | 3300014326 | Bacteria | 697 |
| 179 | Ga0182008_10453387 | 3300014497 | Bacteria | 698 |
| 180 | Ga0182008_10833102 | 3300014497 | Bacteria | 538 |
| 181 | Ga0157377_10024201 | 3300014745 | Bacteria | 3226 |
| 182 | Ga0157377_10694981 | 3300014745 | Bacteria | 738 |
| 183 | Ga0157379_10000487 | 3300014968 | Bacteria | 32201 |
| 184 | Ga0157376_10014343 | 3300014969 | Bacteria | 5945 |
| 185 | Ga0157376_10033638 | 3300014969 | Bacteria | 4129 |
| 186 | Ga0157376_11398135 | 3300014969 | Bacteria | 731 |
| 187 | Ga0157376_12760325 | 3300014969 | Bacteria | 531 |
| 188 | Ga0182005_1261758 | 3300015265 | Bacteria | 538 |
| 189 | Ga0163161_10117735 | 3300017792 | Bacteria | 1993 |
| 190 | Ga0206356_10101599 | 3300020070 | Bacteria | 1081 |
| 191 | Ga0206356_10158681 | 3300020070 | Bacteria | 555 |
| 192 | Ga0206352_10927028 | 3300020078 | Bacteria | 767 |
| 193 | Ga0206350_10920932 | 3300020080 | Bacteria | 701 |
| 194 | Ga0206354_10680993 | 3300020081 | Bacteria | 529 |
| 195 | Ga0206354_11048809 | 3300020081 | Bacteria | 532 |
| 196 | Ga0206354_11561584 | 3300020081 | Bacteria | 952 |
| 197 | Ga0206353_11118769 | 3300020082 | Bacteria | 750 |
| 198 | Ga0206353_11364911 | 3300020082 | Bacteria | 684 |
| 199 | Ga0206353_11473877 | 3300020082 | Bacteria | 1439 |
| 200 | Ga0206353_11477553 | 3300020082 | Bacteria | 1286 |
| 201 | Ga0206353_11867908 | 3300020082 | Bacteria | 867 |
| 202 | Ga0213873_10132701 | 3300021358 | Bacteria | 739 |
| 203 | Ga0213874_10002209 | 3300021377 | Bacteria | 4139 |
| 204 | Ga0213874_10169425 | 3300021377 | Unclassified | 771 |
| 205 | Ga0213876_10013700 | 3300021384 | Bacteria | 4298 |
| 206 | Ga0213876_10036084 | 3300021384 | Bacteria | 2607 |
| 207 | Ga0213876_10091881 | 3300021384 | Bacteria | 1607 |
| 208 | Ga0213875_10008882 | 3300021388 | Bacteria | 5126 |
| 209 | Ga0213875_10030530 | 3300021388 | Bacteria | 2550 |
| 210 | Ga0224712_10448657 | 3300022467 | Bacteria | 619 |
| 211 | Ga0224712_10536569 | 3300022467 | Bacteria | 568 |
| 212 | Ga0224712_10544630 | 3300022467 | Bacteria | 564 |
| 213 | Ga0207656_10162647 | 3300025321 | Unclassified | 1063 |
| 214 | Ga0207653_10056992 | 3300025885 | Unclassified | 1311 |
| 215 | Ga0207692_10000034 | 3300025898 | Bacteria | 45780 |
| 216 | Ga0207692_10027926 | 3300025898 | Bacteria | 2663 |
| 217 | Ga0207692_10040626 | 3300025898 | Bacteria | 2297 |
| 218 | Ga0207692_10174716 | 3300025898 | Bacteria | 1247 |
| 219 | Ga0207692_10403355 | 3300025898 | Bacteria | 853 |
| 220 | Ga0207692_10426774 | 3300025898 | Bacteria | 831 |
| 221 | Ga0207688_10001339 | 3300025901 | Bacteria | 12802 |
| 222 | Ga0207685_10149367 | 3300025905 | Unclassified | 1056 |
| 223 | Ga0207699_10099663 | 3300025906 | Bacteria | 1841 |
| 224 | Ga0207643_10353797 | 3300025908 | Bacteria | 922 |
| 225 | Ga0207705_10594399 | 3300025909 | Bacteria | 861 |
| 226 | Ga0207654_10079134 | 3300025911 | Bacteria | 1974 |
| 227 | Ga0207707_10093676 | 3300025912 | Bacteria | 2624 |
| 228 | Ga0207695_10005084 | 3300025913 | Bacteria | 17633 |
| 229 | Ga0207671_10042892 | 3300025914 | Bacteria | 3347 |
| 230 | Ga0207671_10664013 | 3300025914 | Bacteria | 830 |
| 231 | Ga0207693_10000002 | 3300025915 | Bacteria | 304011 |
| 232 | Ga0207693_10011166 | 3300025915 | Bacteria | 7273 |
| 233 | Ga0207693_10064775 | 3300025915 | Bacteria | 2862 |
| 234 | Ga0207693_10822597 | 3300025915 | Bacteria | 715 |
| 235 | Ga0207663_10004901 | 3300025916 | Bacteria | 6699 |
| 236 | Ga0207663_10139485 | 3300025916 | Bacteria | 1687 |
| 237 | Ga0207663_10297611 | 3300025916 | Bacteria | 1204 |
| 238 | Ga0207663_10646045 | 3300025916 | Bacteria | 835 |
| 239 | Ga0207663_11082142 | 3300025916 | Bacteria | 644 |
| 240 | Ga0207657_10005964 | 3300025919 | Bacteria | 12677 |
| 241 | Ga0207657_10152395 | 3300025919 | Bacteria | 1882 |
| 242 | Ga0207657_10370482 | 3300025919 | Bacteria | 1128 |
| 243 | Ga0207657_10622615 | 3300025919 | Bacteria | 841 |
| 244 | Ga0207649_10049977 | 3300025920 | Bacteria | 2585 |
| 245 | Ga0207649_11051495 | 3300025920 | Bacteria | 641 |
| 246 | Ga0207649_11121593 | 3300025920 | Bacteria | 621 |
| 247 | Ga0207652_10750527 | 3300025921 | Bacteria | 868 |
| 248 | Ga0207652_11014785 | 3300025921 | Bacteria | 729 |
| 249 | Ga0207659_10036621 | 3300025926 | Bacteria | 3400 |
| 250 | Ga0207687_10053679 | 3300025927 | Bacteria | 2817 |
| 251 | Ga0207687_10387561 | 3300025927 | Bacteria | 1146 |
| 252 | Ga0207687_11392381 | 3300025927 | Bacteria | 603 |
| 253 | Ga0207687_11673502 | 3300025927 | Bacteria | 546 |
| 254 | Ga0207700_11283702 | 3300025928 | Bacteria | 652 |
| 255 | Ga0207664_10000006 | 3300025929 | Bacteria | 408702 |
| 256 | Ga0207664_10011196 | 3300025929 | Bacteria | 6361 |
| 257 | Ga0207664_10258536 | 3300025929 | Bacteria | 1522 |
| 258 | Ga0207664_11032147 | 3300025929 | Bacteria | 736 |
| 259 | Ga0207664_11210544 | 3300025929 | Bacteria | 673 |
| 260 | Ga0207664_11610765 | 3300025929 | Bacteria | 571 |
| 261 | Ga0207644_10081260 | 3300025931 | Bacteria | 2395 |
| 262 | Ga0207690_10000017 | 3300025932 | Bacteria | 243513 |
| 263 | Ga0207690_10198866 | 3300025932 | Bacteria | 1521 |
| 264 | Ga0207690_11110390 | 3300025932 | Bacteria | 659 |
| 265 | Ga0207706_10071097 | 3300025933 | Bacteria | 3060 |
| 266 | Ga0207706_10273707 | 3300025933 | Bacteria | 1473 |
| 267 | Ga0207686_10921506 | 3300025934 | Bacteria | 706 |
| 268 | Ga0207686_11299563 | 3300025934 | Bacteria | 597 |
| 269 | Ga0207670_10690756 | 3300025936 | Bacteria | 844 |
| 270 | Ga0207669_10054442 | 3300025937 | Bacteria | 2417 |
| 271 | Ga0207704_10018097 | 3300025938 | Bacteria | 3670 |
| 272 | Ga0207665_10211331 | 3300025939 | Bacteria | 1417 |
| 273 | Ga0207691_10337024 | 3300025940 | Bacteria | 1291 |
| 274 | Ga0207691_11130799 | 3300025940 | Bacteria | 651 |
| 275 | Ga0207711_10095876 | 3300025941 | Bacteria | 2617 |
| 276 | Ga0207711_10657735 | 3300025941 | Bacteria | 977 |
| 277 | Ga0207689_10177076 | 3300025942 | Bacteria | 1759 |
| 278 | Ga0207689_10251601 | 3300025942 | Bacteria | 1461 |
| 279 | Ga0207661_10908270 | 3300025944 | Bacteria | 811 |
| 280 | Ga0207679_10454393 | 3300025945 | Bacteria | 1137 |
| 281 | Ga0207679_11177016 | 3300025945 | Bacteria | 703 |
| 282 | Ga0207667_10495225 | 3300025949 | Bacteria | 1240 |
| 283 | Ga0207667_10691583 | 3300025949 | Bacteria | 1023 |
| 284 | Ga0207651_10457279 | 3300025960 | Bacteria | 1096 |
| 285 | Ga0207651_10567056 | 3300025960 | Bacteria | 989 |
| 286 | Ga0207668_10215881 | 3300025972 | Bacteria | 1537 |
| 287 | Ga0207640_10138045 | 3300025981 | Bacteria | 1773 |
| 288 | Ga0207677_10061899 | 3300026023 | Bacteria | 2594 |
| 289 | Ga0207678_10040159 | 3300026067 | Bacteria | 4059 |
| 290 | Ga0207678_10735007 | 3300026067 | Bacteria | 870 |
| 291 | Ga0207708_10001261 | 3300026075 | Bacteria | 19065 |
| 292 | Ga0207702_10050339 | 3300026078 | Bacteria | 3517 |
| 293 | Ga0207702_10129046 | 3300026078 | Bacteria | 2273 |
| 294 | Ga0207702_10132417 | 3300026078 | Bacteria | 2245 |
| 295 | Ga0207641_12082520 | 3300026088 | Bacteria | 568 |
| 296 | Ga0207648_10729879 | 3300026089 | Bacteria | 919 |
| 297 | Ga0207676_10678429 | 3300026095 | Bacteria | 996 |
| 298 | Ga0207674_10072347 | 3300026116 | Bacteria | 3464 |
| 299 | Ga0207674_10176166 | 3300026116 | Bacteria | 2091 |
| 300 | Ga0207675_100074936 | 3300026118 | Bacteria | 3167 |
| 301 | Ga0207683_10176030 | 3300026121 | Bacteria | 1939 |
| 302 | Ga0207698_10071476 | 3300026142 | Bacteria | 2754 |
| 303 | Ga0207428_10257929 | 3300027907 | Bacteria | 1299 |
| 304 | Ga0268266_10098051 | 3300028379 | Bacteria | 2579 |
| 305 | Ga0268266_10503965 | 3300028379 | Bacteria | 1156 |
| 306 | Ga0268264_10135004 | 3300028381 | Bacteria | 2192 |
| 307 | Ga0268264_10244191 | 3300028381 | Bacteria | 1665 |
| 308 | Ga0265337_1012393 | 3300028556 | Bacteria | 2900 |
| 309 | Ga0265337_1083264 | 3300028556 | Bacteria | 874 |
| 310 | Ga0265326_10000310 | 3300028558 | Bacteria | 21412 |
| 311 | Ga0265319_1002084 | 3300028563 | Bacteria | 11220 |
| 312 | Ga0265318_10005827 | 3300028577 | Bacteria | 5741 |
| 313 | Ga0265322_10050448 | 3300028654 | Bacteria | 1181 |
| 314 | Ga0265322_10140501 | 3300028654 | Bacteria | 690 |
| 315 | Ga0265336_10000004 | 3300028666 | Bacteria | 418303 |
| 316 | Ga0265338_10000012 | 3300028800 | Bacteria | 418599 |
| 317 | Ga0265338_10063099 | 3300028800 | Bacteria | 3233 |
| 318 | Ga0265324_10017557 | 3300029957 | Bacteria | 2602 |
| 319 | Ga0265320_10019761 | 3300031240 | Bacteria | 3672 |
| 320 | Ga0265340_10000001 | 3300031247 | Bacteria | 1647668 |
| 321 | Ga0265331_10430770 | 3300031250 | Bacteria | 592 |
| 322 | Ga0265327_10004953 | 3300031251 | Bacteria | 11447 |
| 323 | Ga0265327_10132515 | 3300031251 | Bacteria | 1171 |
| 324 | Ga0265316_10008873 | 3300031344 | Bacteria | 9286 |
| 325 | Ga0265316_10048130 | 3300031344 | Bacteria | 3369 |
| 326 | Ga0307408_100393073 | 3300031548 | Bacteria | 1189 |
| 327 | Ga0265314_10031831 | 3300031711 | Bacteria | 3888 |
| 328 | Ga0265314_10072187 | 3300031711 | Bacteria | 2307 |
| 329 | Ga0307406_10641631 | 3300031901 | Bacteria | 880 |
| 330 | Ga0307409_102573717 | 3300031995 | Bacteria | 537 |
| 331 | Ga0307416_100857104 | 3300032002 | Bacteria | 1007 |
| 332 | Ga0307416_100950772 | 3300032002 | Bacteria | 961 |
| 333 | Ga0307415_100073302 | 3300032126 | Bacteria | 2415 |
| 334 | Ga0307415_100968016 | 3300032126 | Bacteria | 789 |
| 335 | Ga0373962_0106543 | 3300035242 | Bacteria | 880 |
| 336 | Ga0373935_0519707 | 3300035692 | Bacteria | 866 |
| 337 | Ga0265778_045165 | 3300036457 | Bacteria | 594 |
| 338 | Ga0395899_0189246 | 3300037312 | Bacteria | 1441 |
| 339 | Ga0395900_0084021 | 3300037418 | Bacteria | 3271 |
| 340 | Ga0395900_0122633 | 3300037418 | Bacteria | 2666 |
| 341 | Ga0395900_0946404 | 3300037418 | Bacteria | 783 |
| 342 | Ga0395900_0982323 | 3300037418 | Bacteria | 765 |
| 343 | Ga0395900_1078429 | 3300037418 | Bacteria | 721 |
| 344 | Ga0395900_1223319 | 3300037418 | Bacteria | 666 |
| 345 | Ga0395898_0086730 | 3300037466 | Bacteria | 3016 |
| 346 | Ga0395898_0160642 | 3300037466 | Bacteria | 2149 |
| 347 | Ga0395898_0233696 | 3300037466 | Bacteria | 1753 |
| 348 | Ga0395898_0247248 | 3300037466 | Bacteria | 1701 |
| 349 | Ga0395898_0377603 | 3300037466 | Bacteria | 1352 |
| 350 | Ga0395898_0450523 | 3300037466 | Unclassified | 1226 |
| 351 | Ga0395905_0229515 | 3300037471 | Bacteria | 1736 |
| 352 | Ga0395905_0338718 | 3300037471 | Bacteria | 1395 |
| 353 | Ga0436364_0329358 | 3300037853 | Bacteria | 14756 |
| 354 | Ga0436364_0609270 | 3300037853 | Bacteria | 12154 |
| 355 | Ga0436364_0796475 | 3300037853 | Bacteria | 1102 |
| 356 | Ga0436364_1012143 | 3300037853 | Unclassified | 668 |
| 357 | Ga0436364_1218841 | 3300037853 | Bacteria | 10852 |
| 358 | Ga0395901_0004053 | 3300038443 | Bacteria | 14750 |
| 359 | Ga0395901_0085916 | 3300038443 | Bacteria | 3289 |
| 360 | Ga0395901_0100846 | 3300038443 | Bacteria | 3029 |
| 361 | Ga0395901_0357708 | 3300038443 | Bacteria | 1506 |
| 362 | Ga0395901_1040896 | 3300038443 | Unclassified | 792 |
| 363 | Ga0395901_1084100 | 3300038443 | Bacteria | 772 |
| 364 | Ga0395901_1216940 | 3300038443 | Bacteria | 718 |
| 365 | Ga0395901_1385755 | 3300038443 | Bacteria | 662 |
| 366 | Ga0436365_0561077 | 3300039437 | Bacteria | 806 |
| 367 | Ga0436365_0705902 | 3300039437 | Bacteria | 13387 |
| 368 | Ga0436365_0889001 | 3300039437 | Bacteria | 2852 |
| 369 | Ga0436365_0999899 | 3300039437 | Bacteria | 2415 |
| 370 | Ga0436365_1109639 | 3300039437 | Bacteria | 1053 |
| 371 | Ga0436365_1213556 | 3300039437 | Bacteria | 2407 |
| 372 | Ga0436365_1246407 | 3300039437 | Bacteria | 1573 |
| 373 | Ga0436365_1821223 | 3300039437 | Bacteria | 2662 |
| 374 | Ga0436363_0484789 | 3300039450 | Unclassified | 1048 |
| 375 | Ga0436363_0537896 | 3300039450 | Bacteria | 1198 |
| 376 | Ga0436363_0613327 | 3300039450 | Bacteria | 907 |
| 377 | Ga0436363_0712334 | 3300039450 | Bacteria | 4665 |
| 378 | Ga0436363_1475091 | 3300039450 | Bacteria | 1785 |
| 379 | Ga0436363_1627320 | 3300039450 | Bacteria | 6919 |
| 380 | Ga0436362_0104098 | 3300039453 | Bacteria | 1940 |
| 381 | Ga0436362_0226952 | 3300039453 | Bacteria | 625 |
| 382 | Ga0436362_0267224 | 3300039453 | Bacteria | 1422 |
| 383 | Ga0436362_0670333 | 3300039453 | Bacteria | 2338 |
| 384 | Ga0436362_0961579 | 3300039453 | Bacteria | 1559 |
| 385 | Ga0451791_0001963 | 3300041451 | Bacteria | 1116 |
| 386 | Ga0451797_0669698 | 3300041453 | Bacteria | 780 |
| 387 | Ga0451802_1928281 | 3300041460 | Bacteria | 595 |
| 388 | Ga0451833_0906112 | 3300041491 | Bacteria | 548 |
| 389 | Ga0451835_0043310 | 3300041492 | Bacteria | 765 |
| 390 | Ga0451843_0633562 | 3300041509 | Bacteria | 648 |
| 391 | Ga0439463_084049 | 3300042016 | Bacteria | 819 |
| 392 | Ga0439459_0062036 | 3300042438 | Bacteria | 847 |
| 393 | Ga0466972_0213047 | 3300044658 | Bacteria | 904 |
| 394 | Ga0466972_0360437 | 3300044658 | Bacteria | 680 |
| 395 | Ga0466966_0099819 | 3300044684 | Bacteria | 1796 |
| 396 | Ga0466966_0259522 | 3300044684 | Bacteria | 1046 |
| 397 | Ga0466966_0354980 | 3300044684 | Bacteria | 881 |
| 398 | Ga0466961_0087252 | 3300044693 | Bacteria | 1972 |
| 399 | Ga0466961_0159644 | 3300044693 | Bacteria | 1405 |
| 400 | Ga0466963_0060540 | 3300044694 | Bacteria | 2529 |
| 401 | Ga0466963_0101181 | 3300044694 | Bacteria | 1973 |
| 402 | Ga0466963_0275139 | 3300044694 | Bacteria | 1183 |
| 403 | Ga0466963_0282802 | 3300044694 | Bacteria | 1166 |
| 404 | Ga0466964_0289310 | 3300044706 | Bacteria | 822 |
| 405 | Ga0466968_0112550 | 3300044735 | Bacteria | 1225 |
| 406 | Ga0466968_0171883 | 3300044735 | Bacteria | 1004 |
| 407 | Ga0466968_0362065 | 3300044735 | Bacteria | 706 |
| 408 | Ga0466968_0398273 | 3300044735 | Bacteria | 675 |
| 409 | Ga0466970_0138781 | 3300044765 | Bacteria | 1338 |
| 410 | Ga0466957_0055331 | 3300044842 | Bacteria | 2425 |
| 411 | Ga0466957_0069088 | 3300044842 | Bacteria | 2182 |
| 412 | Ga0466957_0142504 | 3300044842 | Bacteria | 1545 |
| 413 | Ga0466957_0259328 | 3300044842 | Bacteria | 1158 |
| 414 | Ga0466957_0942431 | 3300044842 | Bacteria | 618 |
| 415 | Ga0466957_1151146 | 3300044842 | Bacteria | 560 |
| 416 | Ga0466960_0000024 | 3300044901 | Bacteria | 53231 |
| 417 | Ga0466960_0015842 | 3300044901 | Bacteria | 3259 |
| 418 | Ga0466960_0094679 | 3300044901 | Bacteria | 1528 |
| 419 | Ga0466960_0109048 | 3300044901 | Bacteria | 1436 |
| 420 | Ga0466960_0272563 | 3300044901 | Bacteria | 946 |
| 421 | Ga0466959_0138015 | 3300045049 | Bacteria | 1725 |
| 422 | Ga0466959_0366815 | 3300045049 | Bacteria | 981 |
| 423 | Ga0466959_0393138 | 3300045049 | Bacteria | 943 |
| 424 | Ga0466959_0689193 | 3300045049 | Bacteria | 685 |
| 425 | Ga0466958_0049004 | 3300045836 | Bacteria | 2555 |
| 426 | Ga0466958_0072458 | 3300045836 | Bacteria | 2110 |
| 427 | Ga0466958_0150103 | 3300045836 | Bacteria | 1470 |
| 428 | Ga0466958_0182902 | 3300045836 | Bacteria | 1330 |
| 429 | Ga0466958_0205866 | 3300045836 | Bacteria | 1253 |
| 430 | Ga0466958_0396222 | 3300045836 | Bacteria | 891 |
| 431 | Ga0466958_0500207 | 3300045836 | Bacteria | 789 |
| 432 | Ga0466958_0831583 | 3300045836 | Bacteria | 602 |
| 433 | Ga0466967_0224753 | 3300045976 | Bacteria | 1785 |
| 434 | Ga0466967_0242089 | 3300045976 | Bacteria | 1721 |
| 435 | Ga0466967_0359103 | 3300045976 | Bacteria | 1411 |
| 436 | Ga0466967_0420437 | 3300045976 | Bacteria | 1303 |
| 437 | Ga0466967_2383201 | 3300045976 | Bacteria | 525 |
| 438 | Ga0495590_0029636 | 3300046457 | Bacteria | 1918 |
| 439 | Ga0495641_0025560 | 3300046461 | Bacteria | 2898 |
| 440 | Ga0495653_0000499 | 3300046463 | Bacteria | 30327 |
| 441 | Ga0495650_0000035 | 3300046471 | Bacteria | 403799 |
| 442 | Ga0495594_0321849 | 3300046499 | Bacteria | 881 |
| 443 | Ga0495596_0109442 | 3300046500 | Bacteria | 1073 |
| 444 | Ga0495608_0155495 | 3300046511 | Bacteria | 1456 |
| 445 | Ga0495618_0000030 | 3300046514 | Bacteria | 108007 |
| 446 | Ga0495630_0000627 | 3300046517 | Bacteria | 25585 |
| 447 | Ga0495630_0699127 | 3300046517 | Bacteria | 776 |
| 448 | Ga0495631_0128778 | 3300046518 | Bacteria | 1088 |
| 449 | Ga0495644_0065188 | 3300046523 | Bacteria | 1369 |
| 450 | Ga0495663_0405997 | 3300046525 | Bacteria | 501 |
| 451 | Ga0495654_0355016 | 3300046530 | Bacteria | 589 |
| 452 | Ga0495586_0396002 | 3300046535 | Bacteria | 795 |
| 453 | Ga0495609_0209430 | 3300046538 | Bacteria | 813 |
| 454 | Ga0495621_0201042 | 3300046539 | Bacteria | 802 |
| 455 | Ga0495645_0000098 | 3300046543 | Bacteria | 59944 |
| 456 | Ga0495645_0000138 | 3300046543 | Bacteria | 49585 |
| 457 | Ga0495667_0191052 | 3300046559 | Bacteria | 1312 |
| 458 | Ga0495656_0058246 | 3300046615 | Bacteria | 1676 |
| 459 | Ga0495657_0000017 | 3300046675 | Bacteria | 174558 |
| 460 | Ga0495599_0454771 | 3300046678 | Bacteria | 758 |
| 461 | Ga0495623_0092703 | 3300046679 | Bacteria | 1851 |
| 462 | Ga0495646_0078666 | 3300046680 | Bacteria | 1927 |
| 463 | Ga0495646_0179656 | 3300046680 | Unclassified | 1162 |
| 464 | Ga0495647_0073159 | 3300046681 | Bacteria | 1376 |
| 465 | Ga0495658_0182636 | 3300046683 | Bacteria | 1302 |
| 466 | Ga0495670_0160176 | 3300046691 | Bacteria | 1182 |
| 467 | Ga0495589_0400654 | 3300046794 | Bacteria | 630 |
| 468 | Ga0495589_0489772 | 3300046794 | Bacteria | 562 |
| 469 | Ga0495600_0013762 | 3300046809 | Bacteria | 5094 |
| 470 | Ga0495604_0000102 | 3300047317 | Bacteria | 71652 |
| 471 | Ga0495604_0157124 | 3300047317 | Bacteria | 1610 |
| 472 | Ga0495674_1115027 | 3300047319 | Bacteria | 600 |
| 473 | Ga0495672_0003107 | 3300047320 | Bacteria | 14497 |
| 474 | Ga0495680_0563021 | 3300047322 | Bacteria | 766 |
| 475 | Ga0495677_0140583 | 3300047445 | Bacteria | 927 |
| 476 | Ga0495685_266379 | 3300047447 | Bacteria | 542 |
| 477 | Ga0495686_0295382 | 3300047472 | Bacteria | 896 |
| 478 | Ga0495626_0158911 | 3300048091 | Bacteria | 949 |
| 479 | Ga0496100_0033594 | 3300048903 | Bacteria | 3211 |
| 480 | Ga0496100_0157507 | 3300048903 | Bacteria | 1625 |
| 481 | Ga0496100_1009185 | 3300048903 | Bacteria | 655 |
| 482 | Ga0496101_0001652 | 3300048904 | Bacteria | 13374 |
| 483 | Ga0496101_0044196 | 3300048904 | Bacteria | 3187 |
| 484 | Ga0496101_0051818 | 3300048904 | Bacteria | 2958 |
| 485 | Ga0496101_0449672 | 3300048904 | Bacteria | 1016 |
| 486 | Ga0496102_0018229 | 3300048905 | Bacteria | 6164 |
| 487 | Ga0496102_0043979 | 3300048905 | Bacteria | 4051 |
| 488 | Ga0496102_0140336 | 3300048905 | Bacteria | 2265 |
| 489 | Ga0496102_0292648 | 3300048905 | Bacteria | 1535 |
| 490 | Ga0496102_0977957 | 3300048905 | Bacteria | 767 |
| 491 | Ga0496103_0026004 | 3300048906 | Bacteria | 3541 |
| 492 | Ga0496103_0342350 | 3300048906 | Bacteria | 962 |
| 493 | Ga0496103_0399008 | 3300048906 | Bacteria | 883 |
| 494 | Ga0496103_0587724 | 3300048906 | Bacteria | 710 |
| 495 | Ga0496104_0000093 | 3300048907 | Bacteria | 87156 |
| 496 | Ga0496104_0002732 | 3300048907 | Bacteria | 15183 |
| 497 | Ga0496104_0142061 | 3300048907 | Bacteria | 2306 |
| 498 | Ga0496104_0197880 | 3300048907 | Bacteria | 1921 |
| 499 | Ga0496104_0803300 | 3300048907 | Bacteria | 847 |
| 500 | Ga0496104_1183511 | 3300048907 | Bacteria | 668 |
| 501 | Ga0496105_0072630 | 3300048908 | Bacteria | 2843 |
| 502 | Ga0496105_0075266 | 3300048908 | Bacteria | 2788 |
| 503 | Ga0496105_0311233 | 3300048908 | Bacteria | 1264 |
| 504 | Ga0496106_0034464 | 3300048909 | Bacteria | 3781 |
| 505 | Ga0496106_0191672 | 3300048909 | Bacteria | 1625 |
| 506 | Ga0496106_0432212 | 3300048909 | Bacteria | 1058 |
| 507 | Ga0496107_0009709 | 3300048910 | Bacteria | 6673 |
| 508 | Ga0496107_0095496 | 3300048910 | Bacteria | 2175 |
| 509 | Ga0496107_0982375 | 3300048910 | Bacteria | 613 |
| 510 | Ga0496108_0000712 | 3300048911 | Bacteria | 25838 |
| 511 | Ga0496108_0004745 | 3300048911 | Bacteria | 10958 |
| 512 | Ga0496108_0029433 | 3300048911 | Bacteria | 4548 |
| 513 | Ga0496108_0258549 | 3300048911 | Bacteria | 1515 |
| 514 | Ga0496108_0300516 | 3300048911 | Bacteria | 1398 |
| 515 | Ga0496109_0002857 | 3300048912 | Bacteria | 14454 |
| 516 | Ga0496109_0032613 | 3300048912 | Bacteria | 4683 |
| 517 | Ga0496109_0075725 | 3300048912 | Bacteria | 3094 |
| 518 | Ga0496109_0124143 | 3300048912 | Bacteria | 2406 |
| 519 | Ga0496109_0433482 | 3300048912 | Bacteria | 1242 |
| 520 | Ga0496110_0000291 | 3300048913 | Bacteria | 32902 |
| 521 | Ga0496110_0000358 | 3300048913 | Bacteria | 30516 |
| 522 | Ga0496110_0001659 | 3300048913 | Bacteria | 16316 |
| 523 | Ga0496110_0276652 | 3300048913 | Bacteria | 1528 |
| 524 | Ga0496110_0306972 | 3300048913 | Bacteria | 1445 |
| 525 | Ga0496110_0497873 | 3300048913 | Bacteria | 1110 |
| 526 | Ga0496111_0000033 | 3300048914 | Bacteria | 55040 |
| 527 | Ga0496111_0010411 | 3300048914 | Bacteria | 6240 |
| 528 | Ga0496111_0021775 | 3300048914 | Bacteria | 4479 |
| 529 | Ga0496111_0131442 | 3300048914 | Bacteria | 1852 |
| 530 | Ga0496111_0274110 | 3300048914 | Bacteria | 1251 |
| 531 | Ga0496112_0000173 | 3300048915 | Bacteria | 41090 |
| 532 | Ga0496112_0016208 | 3300048915 | Bacteria | 6972 |
| 533 | Ga0496112_0020849 | 3300048915 | Bacteria | 6220 |
| 534 | Ga0496112_0026391 | 3300048915 | Bacteria | 5588 |
| 535 | Ga0496112_0032129 | 3300048915 | Bacteria | 5095 |
| 536 | Ga0496112_0044051 | 3300048915 | Bacteria | 4370 |
| 537 | Ga0496112_0133498 | 3300048915 | Bacteria | 2453 |
| 538 | Ga0496112_0251856 | 3300048915 | Bacteria | 1717 |
| 539 | Ga0496113_0016680 | 3300048916 | Bacteria | 5079 |
| 540 | Ga0496113_0029015 | 3300048916 | Bacteria | 3988 |
| 541 | Ga0496113_0033435 | 3300048916 | Bacteria | 3744 |
| 542 | Ga0496113_0081097 | 3300048916 | Bacteria | 2486 |
| 543 | Ga0496113_0094304 | 3300048916 | Bacteria | 2312 |
| 544 | Ga0496114_0262366 | 3300048917 | Bacteria | 1521 |
| 545 | Ga0496114_0330741 | 3300048917 | Bacteria | 1347 |
| 546 | Ga0496114_0503106 | 3300048917 | Bacteria | 1072 |
| 547 | Ga0496114_0507730 | 3300048917 | Bacteria | 1066 |
| 548 | Ga0496114_0676959 | 3300048917 | Bacteria | 906 |
| 549 | Ga0496115_0006172 | 3300048918 | Bacteria | 8764 |
| 550 | Ga0496115_0062284 | 3300048918 | Bacteria | 3009 |
| 551 | Ga0496115_0405557 | 3300048918 | Bacteria | 1106 |
| 552 | Ga0496119_0260064 | 3300048922 | Bacteria | 871 |
| 553 | Ga0496121_0034885 | 3300048924 | Bacteria | 4518 |
| 554 | Ga0496123_0231911 | 3300048926 | Bacteria | 923 |
| 555 | Ga0496125_0271943 | 3300048928 | Bacteria | 1055 |
| 556 | Ga0501031_0028269 | 3300049568 | Bacteria | 3655 |
| 557 | Ga0501032_0039289 | 3300049569 | Bacteria | 3219 |
| 558 | Ga0501033_0041001 | 3300049570 | Bacteria | 3455 |
| 559 | Ga0501034_0067114 | 3300049571 | Bacteria | 3600 |
| 560 | Ga0501034_0082769 | 3300049571 | Bacteria | 3211 |
| 561 | Ga0501036_0121015 | 3300049572 | Bacteria | 2210 |
| 562 | Ga0501037_0016364 | 3300049573 | Bacteria | 5457 |
| 563 | Ga0501038_0004424 | 3300049574 | Bacteria | 13076 |
| 564 | Ga0501039_0047066 | 3300049575 | Bacteria | 3333 |
| 565 | Ga0501042_0024897 | 3300049578 | Bacteria | 4201 |
| 566 | Ga0501046_0118476 | 3300049580 | Bacteria | 2016 |
| 567 | Ga0501047_0089863 | 3300049581 | Bacteria | 2948 |
| 568 | Ga0501048_0003039 | 3300049582 | Bacteria | 12808 |
| 569 | Ga0501067_0058156 | 3300049583 | Bacteria | 2141 |
| 570 | Ga0501067_0695206 | 3300049583 | Bacteria | 571 |
| 571 | Ga0501068_0007611 | 3300049584 | Bacteria | 5994 |
| 572 | Ga0501068_0864178 | 3300049584 | Bacteria | 594 |
| 573 | Ga0501068_0936441 | 3300049584 | Bacteria | 570 |
| 574 | Ga0501069_0008115 | 3300049585 | Bacteria | 5517 |
| 575 | Ga0501069_0054166 | 3300049585 | Bacteria | 2235 |
| 576 | Ga0501070_0025893 | 3300049586 | Bacteria | 4921 |
| 577 | Ga0501071_1100715 | 3300049587 | Bacteria | 614 |
| 578 | Ga0501073_0016890 | 3300049589 | Bacteria | 5285 |
| 579 | Ga0501074_0096048 | 3300049590 | Bacteria | 2122 |
| 580 | Ga0501074_0213468 | 3300049590 | Bacteria | 1374 |
| 581 | Ga0501076_0168114 | 3300049592 | Bacteria | 1787 |
| 582 | Ga0501080_0028739 | 3300049742 | Bacteria | 5176 |
| 583 | Ga0501080_0029673 | 3300049742 | Bacteria | 5090 |
| 584 | Ga0501083_0096713 | 3300049744 | Bacteria | 1948 |
| 585 | Ga0501035_0021932 | 3300049822 | Bacteria | 5867 |
| 586 | Ga0501044_0158149 | 3300049823 | Bacteria | 2244 |
| 587 | Ga0501044_1104124 | 3300049823 | Unclassified | 662 |
| 588 | Ga0501044_1258683 | 3300049823 | Bacteria | 607 |
| 589 | nmdc:mga05p37_1326535_c1 | 3300050507 | Bacteria | 731 |
| 590 | nmdc:mga09592_25633_c1 | 3300050508 | Bacteria | 4882 |
| 591 | nmdc:mga0qj67_5048_c1 | 3300050509 | Bacteria | 9597 |
| 592 | nmdc:mga06r32_53522_c2 | 3300050510 | Bacteria | 2225 |
| 593 | nmdc:mga08y16_18110_c1 | 3300050511 | Bacteria | 7419 |
| 594 | nmdc:mga08y16_307053_c1 | 3300050511 | Bacteria | 1634 |
| 595 | nmdc:mga0n895_35367_c1 | 3300050512 | Bacteria | 4816 |
| 596 | nmdc:mga0n895_791880_c1 | 3300050512 | Bacteria | 939 |
| 597 | nmdc:mga0rr50_180188_c1 | 3300050513 | Bacteria | 1727 |
| 598 | nmdc:mga0rr50_636955_c1 | 3300050513 | Bacteria | 909 |
| 599 | nmdc:mga08x19_657010_c1 | 3300050514 | Bacteria | 744 |
| 600 | Ga0495601_0003968 | 3300053077 | Bacteria | 8518 |
| 601 | Ga0495612_0000212 | 3300053078 | Bacteria | 24569 |
| 602 | Ga0495655_0194505 | 3300053083 | Bacteria | 660 |
| 603 | Ga0495619_0085415 | 3300053085 | Bacteria | 2131 |
| 604 | Ga0500641_0285532 | 3300053096 | Bacteria | 682 |
| 605 | Ga0500556_0001386 | 3300053104 | Bacteria | 10580 |
| 606 | Ga0500616_0005748 | 3300053153 | Bacteria | 8338 |
| 607 | Ga0500616_0013284 | 3300053153 | Bacteria | 4788 |
| 608 | Ga0500599_007905 | 3300053736 | Bacteria | 1374 |
| 609 | Ga0501084_0117593 | 3300054114 | Bacteria | 2235 |
| 610 | Ga0587083_0117723 | 3300059505 | Bacteria | 683 |
| 611 | Ga0587091_106863 | 3300059511 | Bacteria | 663 |
| 612 | Ga0587102_021631 | 3300059649 | Bacteria | 730 |
| 613 | Ga0501082_0026301 | 3300060353 | Bacteria | 5014 |
| 614 | Ga0501082_1199622 | 3300060353 | Bacteria | 663 |
| 615 | Ga0466962_0147670 | 3300061719 | Bacteria | 1140 |
| 616 | Ga0466962_0213000 | 3300061719 | Bacteria | 945 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006237 | Ga0097621_100588395 | Ga0097621_1005883952 | 119 |
| 2 | 3300005719 | Ga0068861_100991632 | Ga0068861_1009916322 | 129 |
| 3 | 3300009098 | Ga0105245_11384834 | Ga0105245_113848342 | 129 |
| 4 | 3300026118 | Ga0207675_100074936 | Ga0207675_1000749363 | 129 |
| 5 | 3300044694 | Ga0466963_0101181 | Ga0466963_0101181_94_510 | 129 |
| 6 | 3300005543 | Ga0070672_100197559 | Ga0070672_1001975592 | 130 |
| 7 | 3300005578 | Ga0068854_100144634 | Ga0068854_1001446342 | 130 |
| 8 | 3300013296 | Ga0157374_10671169 | Ga0157374_106711692 | 130 |
| 9 | 3300022467 | Ga0224712_10536569 | Ga0224712_105365691 | 130 |
| 10 | 3300025932 | Ga0207690_10198866 | Ga0207690_101988663 | 130 |
| 11 | 3300025933 | Ga0207706_10273707 | Ga0207706_102737072 | 130 |
| 12 | 3300025940 | Ga0207691_10337024 | Ga0207691_103370242 | 130 |
| 13 | 3300025960 | Ga0207651_10567056 | Ga0207651_105670562 | 130 |
| 14 | 3300041453 | Ga0451797_0669698 | Ga0451797_0669698_246_638 | 130 |
| 15 | 3300044693 | Ga0466961_0087252 | Ga0466961_0087252_1357_1797 | 130 |
| 16 | 3300044735 | Ga0466968_0398273 | Ga0466968_0398273_233_625 | 130 |
| 17 | 3300044842 | Ga0466957_0055331 | Ga0466957_0055331_880_1320 | 130 |
| 18 | 3300045049 | Ga0466959_0393138 | Ga0466959_0393138_486_926 | 130 |
| 19 | 3300045836 | Ga0466958_0831583 | Ga0466958_0831583_136_576 | 130 |
| 20 | 3300045976 | Ga0466967_0224753 | Ga0466967_0224753_872_1309 | 130 |
| 21 | 3300045976 | Ga0466967_0359103 | Ga0466967_0359103_850_1290 | 130 |
| 22 | 3300046500 | Ga0495596_0109442 | Ga0495596_0109442_632_1024 | 130 |
| 23 | 3300048906 | Ga0496103_0342350 | Ga0496103_0342350_476_925 | 130 |
| 24 | 3300048907 | Ga0496104_1183511 | Ga0496104_1183511_231_623 | 130 |
| 25 | 3300049823 | Ga0501044_1104124 | Ga0501044_1104124_11_403 | 130 |
| 26 | 3300061719 | Ga0466962_0147670 | Ga0466962_0147670_66_506 | 130 |
| 27 | 3300005336 | Ga0070680_100789632 | Ga0070680_1007896322 | 131 |
| 28 | 3300005337 | Ga0070682_100041971 | Ga0070682_1000419712 | 131 |
| 29 | 3300005345 | Ga0070692_10274015 | Ga0070692_102740152 | 131 |
| 30 | 3300005353 | Ga0070669_100019081 | Ga0070669_1000190818 | 131 |
| 31 | 3300005366 | Ga0070659_100000077 | Ga0070659_10000007744 | 131 |
| 32 | 3300005435 | Ga0070714_100022302 | Ga0070714_1000223026 | 131 |
| 33 | 3300005437 | Ga0070710_10000008 | Ga0070710_1000000819 | 131 |
| 34 | 3300005440 | Ga0070705_100000672 | Ga0070705_10000067214 | 131 |
| 35 | 3300005458 | Ga0070681_10252251 | Ga0070681_102522513 | 131 |
| 36 | 3300006028 | Ga0070717_10000004 | Ga0070717_10000004169 | 131 |
| 37 | 3300006175 | Ga0070712_100000008 | Ga0070712_100000008138 | 131 |
| 38 | 3300006880 | Ga0075429_100046787 | Ga0075429_1000467876 | 131 |
| 39 | 3300009093 | Ga0105240_10112780 | Ga0105240_101127806 | 131 |
| 40 | 3300009148 | Ga0105243_10423616 | Ga0105243_104236162 | 131 |
| 41 | 3300010375 | Ga0105239_10042058 | Ga0105239_100420587 | 131 |
| 42 | 3300013297 | Ga0157378_12814262 | Ga0157378_128142621 | 131 |
| 43 | 3300013306 | Ga0163162_11365603 | Ga0163162_113656031 | 131 |
| 44 | 3300014969 | Ga0157376_10014343 | Ga0157376_100143438 | 131 |
| 45 | 3300020082 | Ga0206353_11364911 | Ga0206353_113649111 | 131 |
| 46 | 3300025898 | Ga0207692_10000034 | Ga0207692_1000003419 | 131 |
| 47 | 3300025912 | Ga0207707_10093676 | Ga0207707_100936763 | 131 |
| 48 | 3300025915 | Ga0207693_10000002 | Ga0207693_10000002203 | 131 |
| 49 | 3300025929 | Ga0207664_10000006 | Ga0207664_10000006229 | 131 |
| 50 | 3300025929 | Ga0207664_10011196 | Ga0207664_100111967 | 131 |
| 51 | 3300025929 | Ga0207664_11610765 | Ga0207664_116107652 | 131 |
| 52 | 3300025932 | Ga0207690_10000017 | Ga0207690_1000001786 | 131 |
| 53 | 3300044765 | Ga0466970_0138781 | Ga0466970_0138781_577_984 | 131 |
| 54 | 3300045049 | Ga0466959_0138015 | Ga0466959_0138015_711_1118 | 131 |
| 55 | 3300047320 | Ga0495672_0003107 | Ga0495672_0003107_13468_13863 | 131 |
| 56 | 3300048904 | Ga0496101_0001652 | Ga0496101_0001652_3785_4216 | 131 |
| 57 | 3300048912 | Ga0496109_0032613 | Ga0496109_0032613_3815_4219 | 131 |
| 58 | 3300048913 | Ga0496110_0306972 | Ga0496110_0306972_415_813 | 131 |
| 59 | 3300048914 | Ga0496111_0274110 | Ga0496111_0274110_453_851 | 131 |
| 60 | 3300048915 | Ga0496112_0000173 | Ga0496112_0000173_27035_27439 | 131 |
| 61 | 3300048916 | Ga0496113_0033435 | Ga0496113_0033435_536_934 | 131 |
| 62 | 3300048928 | Ga0496125_0271943 | Ga0496125_0271943_263_670 | 131 |
| 63 | 3300049592 | Ga0501076_0168114 | Ga0501076_0168114_101_496 | 131 |
| 64 | 3300049823 | Ga0501044_1258683 | Ga0501044_1258683_120_515 | 131 |
| 65 | 3300050508 | nmdc:mga09592_25633_c1 | nmdc:mga09592_25633_c1_1589_1987 | 131 |
| 66 | 3300005437 | Ga0070710_10037752 | Ga0070710_100377522 | 132 |
| 67 | 3300005439 | Ga0070711_100155062 | Ga0070711_1001550622 | 132 |
| 68 | 3300006175 | Ga0070712_100190508 | Ga0070712_1001905082 | 132 |
| 69 | 3300006846 | Ga0075430_100002873 | Ga0075430_10000287315 | 132 |
| 70 | 3300025898 | Ga0207692_10426774 | Ga0207692_104267741 | 132 |
| 71 | 3300025915 | Ga0207693_10064775 | Ga0207693_100647752 | 132 |
| 72 | 3300025929 | Ga0207664_11032147 | Ga0207664_110321472 | 132 |
| 73 | 3300039437 | Ga0436365_1109639 | Ga0436365_1109639_525_941 | 132 |
| 74 | 3300044735 | Ga0466968_0112550 | Ga0466968_0112550_448_858 | 132 |
| 75 | 3300050509 | nmdc:mga0qj67_5048_c1 | nmdc:mga0qj67_5048_c1_5982_6386 | 132 |
| 76 | 3300005336 | Ga0070680_100566338 | Ga0070680_1005663382 | 133 |
| 77 | 3300005339 | Ga0070660_100547721 | Ga0070660_1005477212 | 133 |
| 78 | 3300005435 | Ga0070714_100764360 | Ga0070714_1007643602 | 133 |
| 79 | 3300005436 | Ga0070713_101328556 | Ga0070713_1013285561 | 133 |
| 80 | 3300005436 | Ga0070713_101704262 | Ga0070713_1017042622 | 133 |
| 81 | 3300005458 | Ga0070681_10989201 | Ga0070681_109892011 | 133 |
| 82 | 3300005468 | Ga0070707_100144558 | Ga0070707_1001445582 | 133 |
| 83 | 3300005530 | Ga0070679_101178600 | Ga0070679_1011786002 | 133 |
| 84 | 3300005530 | Ga0070679_101840826 | Ga0070679_1018408261 | 133 |
| 85 | 3300006175 | Ga0070712_100031283 | Ga0070712_1000312833 | 133 |
| 86 | 3300006175 | Ga0070712_101252477 | Ga0070712_1012524771 | 133 |
| 87 | 3300006871 | Ga0075434_100415070 | Ga0075434_1004150702 | 133 |
| 88 | 3300009093 | Ga0105240_10007645 | Ga0105240_100076457 | 133 |
| 89 | 3300009147 | Ga0114129_11369610 | Ga0114129_113696102 | 133 |
| 90 | 3300009174 | Ga0105241_10128389 | Ga0105241_101283893 | 133 |
| 91 | 3300013307 | Ga0157372_11459464 | Ga0157372_114594641 | 133 |
| 92 | 3300020070 | Ga0206356_10101599 | Ga0206356_101015992 | 133 |
| 93 | 3300020070 | Ga0206356_10158681 | Ga0206356_101586812 | 133 |
| 94 | 3300020078 | Ga0206352_10927028 | Ga0206352_109270281 | 133 |
| 95 | 3300020081 | Ga0206354_11561584 | Ga0206354_115615842 | 133 |
| 96 | 3300020082 | Ga0206353_11867908 | Ga0206353_118679082 | 133 |
| 97 | 3300025898 | Ga0207692_10040626 | Ga0207692_100406262 | 133 |
| 98 | 3300025898 | Ga0207692_10403355 | Ga0207692_104033552 | 133 |
| 99 | 3300025905 | Ga0207685_10149367 | Ga0207685_101493671 | 133 |
| 100 | 3300025911 | Ga0207654_10079134 | Ga0207654_100791342 | 133 |
| 101 | 3300025913 | Ga0207695_10005084 | Ga0207695_100050849 | 133 |
| 102 | 3300025915 | Ga0207693_10011166 | Ga0207693_100111664 | 133 |
| 103 | 3300025915 | Ga0207693_10822597 | Ga0207693_108225972 | 133 |
| 104 | 3300025916 | Ga0207663_10004901 | Ga0207663_100049013 | 133 |
| 105 | 3300025916 | Ga0207663_10139485 | Ga0207663_101394853 | 133 |
| 106 | 3300025916 | Ga0207663_10297611 | Ga0207663_102976112 | 133 |
| 107 | 3300025916 | Ga0207663_10646045 | Ga0207663_106460452 | 133 |
| 108 | 3300025928 | Ga0207700_11283702 | Ga0207700_112837021 | 133 |
| 109 | 3300025929 | Ga0207664_10258536 | Ga0207664_102585362 | 133 |
| 110 | 3300025929 | Ga0207664_11210544 | Ga0207664_112105442 | 133 |
| 111 | 3300025939 | Ga0207665_10211331 | Ga0207665_102113312 | 133 |
| 112 | 3300026078 | Ga0207702_10129046 | Ga0207702_101290462 | 133 |
| 113 | 3300028556 | Ga0265337_1012393 | Ga0265337_10123933 | 133 |
| 114 | 3300028556 | Ga0265337_1083264 | Ga0265337_10832642 | 133 |
| 115 | 3300028558 | Ga0265326_10000310 | Ga0265326_100003108 | 133 |
| 116 | 3300028563 | Ga0265319_1002084 | Ga0265319_10020849 | 133 |
| 117 | 3300028654 | Ga0265322_10050448 | Ga0265322_100504482 | 133 |
| 118 | 3300028654 | Ga0265322_10140501 | Ga0265322_101405011 | 133 |
| 119 | 3300028666 | Ga0265336_10000004 | Ga0265336_10000004264 | 133 |
| 120 | 3300028800 | Ga0265338_10000012 | Ga0265338_10000012163 | 133 |
| 121 | 3300029957 | Ga0265324_10017557 | Ga0265324_100175572 | 133 |
| 122 | 3300031247 | Ga0265340_10000001 | Ga0265340_100000011465 | 133 |
| 123 | 3300031251 | Ga0265327_10004953 | Ga0265327_100049536 | 133 |
| 124 | 3300031251 | Ga0265327_10132515 | Ga0265327_101325151 | 133 |
| 125 | 3300031344 | Ga0265316_10008873 | Ga0265316_1000887310 | 133 |
| 126 | 3300031711 | Ga0265314_10072187 | Ga0265314_100721874 | 133 |
| 127 | 3300036457 | Ga0265778_045165 | Ga0265778_045165_90_497 | 133 |
| 128 | 3300039450 | Ga0436363_0613327 | Ga0436363_0613327_418_828 | 133 |
| 129 | 3300039453 | Ga0436362_0267224 | Ga0436362_0267224_794_1204 | 133 |
| 130 | 3300044684 | Ga0466966_0099819 | Ga0466966_0099819_1306_1719 | 133 |
| 131 | 3300044693 | Ga0466961_0159644 | Ga0466961_0159644_764_1165 | 133 |
| 132 | 3300046463 | Ga0495653_0000499 | Ga0495653_0000499_18416_18844 | 133 |
| 133 | 3300046511 | Ga0495608_0155495 | Ga0495608_0155495_385_792 | 133 |
| 134 | 3300046514 | Ga0495618_0000030 | Ga0495618_0000030_105804_106211 | 133 |
| 135 | 3300046517 | Ga0495630_0000627 | Ga0495630_0000627_16326_16733 | 133 |
| 136 | 3300046523 | Ga0495644_0065188 | Ga0495644_0065188_42_449 | 133 |
| 137 | 3300046543 | Ga0495645_0000098 | Ga0495645_0000098_43297_43704 | 133 |
| 138 | 3300046543 | Ga0495645_0000138 | Ga0495645_0000138_17007_17444 | 133 |
| 139 | 3300046675 | Ga0495657_0000017 | Ga0495657_0000017_9157_9564 | 133 |
| 140 | 3300046679 | Ga0495623_0092703 | Ga0495623_0092703_1112_1555 | 133 |
| 141 | 3300046680 | Ga0495646_0078666 | Ga0495646_0078666_463_870 | 133 |
| 142 | 3300046680 | Ga0495646_0179656 | Ga0495646_0179656_473_880 | 133 |
| 143 | 3300046681 | Ga0495647_0073159 | Ga0495647_0073159_344_751 | 133 |
| 144 | 3300046809 | Ga0495600_0013762 | Ga0495600_0013762_3171_3578 | 133 |
| 145 | 3300047317 | Ga0495604_0000102 | Ga0495604_0000102_56729_57136 | 133 |
| 146 | 3300047319 | Ga0495674_1115027 | Ga0495674_1115027_177_584 | 133 |
| 147 | 3300047447 | Ga0495685_266379 | Ga0495685_266379_33_434 | 133 |
| 148 | 3300048903 | Ga0496100_1009185 | Ga0496100_1009185_115_522 | 133 |
| 149 | 3300048907 | Ga0496104_0000093 | Ga0496104_0000093_64501_64908 | 133 |
| 150 | 3300048913 | Ga0496110_0000291 | Ga0496110_0000291_9391_9798 | 133 |
| 151 | 3300048914 | Ga0496111_0000033 | Ga0496111_0000033_16843_17250 | 133 |
| 152 | 3300050507 | nmdc:mga05p37_1326535_c1 | nmdc:mga05p37_1326535_c1_93_500 | 133 |
| 153 | 3300050512 | nmdc:mga0n895_791880_c1 | nmdc:mga0n895_791880_c1_22_429 | 133 |
| 154 | 3300053077 | Ga0495601_0003968 | Ga0495601_0003968_2101_2508 | 133 |
| 155 | 3300053078 | Ga0495612_0000212 | Ga0495612_0000212_8702_9109 | 133 |
| 156 | 3300053083 | Ga0495655_0194505 | Ga0495655_0194505_23_463 | 133 |
| 157 | 3300053085 | Ga0495619_0085415 | Ga0495619_0085415_1130_1537 | 133 |
| 158 | 3300059505 | Ga0587083_0117723 | Ga0587083_0117723_160_597 | 133 |
| 159 | 3300059511 | Ga0587091_106863 | Ga0587091_106863_154_591 | 133 |
| 160 | 3300059649 | Ga0587102_021631 | Ga0587102_021631_228_665 | 133 |
| 161 | 3300000549 | LJQas_1020692 | LJQas_10206922 | 134 |
| 162 | 3300005329 | Ga0070683_100001798 | Ga0070683_10000179817 | 134 |
| 163 | 3300005329 | Ga0070683_100373327 | Ga0070683_1003733272 | 134 |
| 164 | 3300005330 | Ga0070690_100344330 | Ga0070690_1003443302 | 134 |
| 165 | 3300005334 | Ga0068869_100051454 | Ga0068869_1000514542 | 134 |
| 166 | 3300005334 | Ga0068869_100757719 | Ga0068869_1007577192 | 134 |
| 167 | 3300005336 | Ga0070680_100337163 | Ga0070680_1003371632 | 134 |
| 168 | 3300005337 | Ga0070682_100009060 | Ga0070682_1000090607 | 134 |
| 169 | 3300005337 | Ga0070682_100715011 | Ga0070682_1007150112 | 134 |
| 170 | 3300005338 | Ga0068868_100008651 | Ga0068868_1000086517 | 134 |
| 171 | 3300005338 | Ga0068868_100332540 | Ga0068868_1003325402 | 134 |
| 172 | 3300005338 | Ga0068868_100724343 | Ga0068868_1007243432 | 134 |
| 173 | 3300005339 | Ga0070660_100177501 | Ga0070660_1001775012 | 134 |
| 174 | 3300005339 | Ga0070660_100184302 | Ga0070660_1001843023 | 134 |
| 175 | 3300005339 | Ga0070660_101331383 | Ga0070660_1013313832 | 134 |
| 176 | 3300005340 | Ga0070689_100144614 | Ga0070689_1001446142 | 134 |
| 177 | 3300005341 | Ga0070691_10020996 | Ga0070691_100209963 | 134 |
| 178 | 3300005344 | Ga0070661_100072394 | Ga0070661_1000723942 | 134 |
| 179 | 3300005344 | Ga0070661_100456057 | Ga0070661_1004560571 | 134 |
| 180 | 3300005345 | Ga0070692_10092109 | Ga0070692_100921092 | 134 |
| 181 | 3300005347 | Ga0070668_100287799 | Ga0070668_1002877992 | 134 |
| 182 | 3300005347 | Ga0070668_100469898 | Ga0070668_1004698981 | 134 |
| 183 | 3300005354 | Ga0070675_100034760 | Ga0070675_1000347604 | 134 |
| 184 | 3300005355 | Ga0070671_100264832 | Ga0070671_1002648321 | 134 |
| 185 | 3300005355 | Ga0070671_101301640 | Ga0070671_1013016402 | 134 |
| 186 | 3300005356 | Ga0070674_100082894 | Ga0070674_1000828943 | 134 |
| 187 | 3300005364 | Ga0070673_100306157 | Ga0070673_1003061572 | 134 |
| 188 | 3300005365 | Ga0070688_100133986 | Ga0070688_1001339862 | 134 |
| 189 | 3300005365 | Ga0070688_100486115 | Ga0070688_1004861152 | 134 |
| 190 | 3300005366 | Ga0070659_100110662 | Ga0070659_1001106622 | 134 |
| 191 | 3300005367 | Ga0070667_100594130 | Ga0070667_1005941302 | 134 |
| 192 | 3300005434 | Ga0070709_10291791 | Ga0070709_102917912 | 134 |
| 193 | 3300005434 | Ga0070709_10827507 | Ga0070709_108275072 | 134 |
| 194 | 3300005437 | Ga0070710_10083974 | Ga0070710_100839742 | 134 |
| 195 | 3300005438 | Ga0070701_10174389 | Ga0070701_101743892 | 134 |
| 196 | 3300005439 | Ga0070711_101108582 | Ga0070711_1011085821 | 134 |
| 197 | 3300005439 | Ga0070711_101259812 | Ga0070711_1012598121 | 134 |
| 198 | 3300005441 | Ga0070700_100003076 | Ga0070700_1000030769 | 134 |
| 199 | 3300005445 | Ga0070708_101433992 | Ga0070708_1014339922 | 134 |
| 200 | 3300005455 | Ga0070663_100099987 | Ga0070663_1000999872 | 134 |
| 201 | 3300005456 | Ga0070678_100302542 | Ga0070678_1003025422 | 134 |
| 202 | 3300005456 | Ga0070678_101234579 | Ga0070678_1012345791 | 134 |
| 203 | 3300005457 | Ga0070662_100032258 | Ga0070662_1000322582 | 134 |
| 204 | 3300005466 | Ga0070685_10098642 | Ga0070685_100986422 | 134 |
| 205 | 3300005466 | Ga0070685_10244541 | Ga0070685_102445411 | 134 |
| 206 | 3300005530 | Ga0070679_100449118 | Ga0070679_1004491182 | 134 |
| 207 | 3300005530 | Ga0070679_100583151 | Ga0070679_1005831512 | 134 |
| 208 | 3300005535 | Ga0070684_100163401 | Ga0070684_1001634012 | 134 |
| 209 | 3300005535 | Ga0070684_100574782 | Ga0070684_1005747822 | 134 |
| 210 | 3300005535 | Ga0070684_100765790 | Ga0070684_1007657902 | 134 |
| 211 | 3300005544 | Ga0070686_100625536 | Ga0070686_1006255362 | 134 |
| 212 | 3300005544 | Ga0070686_100692156 | Ga0070686_1006921561 | 134 |
| 213 | 3300005548 | Ga0070665_100091723 | Ga0070665_1000917232 | 134 |
| 214 | 3300005549 | Ga0070704_100435971 | Ga0070704_1004359712 | 134 |
| 215 | 3300005563 | Ga0068855_100558006 | Ga0068855_1005580062 | 134 |
| 216 | 3300005564 | Ga0070664_100536963 | Ga0070664_1005369631 | 134 |
| 217 | 3300005564 | Ga0070664_100572651 | Ga0070664_1005726512 | 134 |
| 218 | 3300005577 | Ga0068857_100075708 | Ga0068857_1000757083 | 134 |
| 219 | 3300005577 | Ga0068857_100267992 | Ga0068857_1002679922 | 134 |
| 220 | 3300005614 | Ga0068856_100020785 | Ga0068856_1000207854 | 134 |
| 221 | 3300005614 | Ga0068856_100563078 | Ga0068856_1005630782 | 134 |
| 222 | 3300005614 | Ga0068856_100680071 | Ga0068856_1006800712 | 134 |
| 223 | 3300005615 | Ga0070702_100021806 | Ga0070702_1000218063 | 134 |
| 224 | 3300005616 | Ga0068852_100087150 | Ga0068852_1000871503 | 134 |
| 225 | 3300005616 | Ga0068852_101458175 | Ga0068852_1014581752 | 134 |
| 226 | 3300005618 | Ga0068864_100725836 | Ga0068864_1007258362 | 134 |
| 227 | 3300005718 | Ga0068866_10066706 | Ga0068866_100667062 | 134 |
| 228 | 3300005719 | Ga0068861_100167093 | Ga0068861_1001670933 | 134 |
| 229 | 3300005834 | Ga0068851_10060580 | Ga0068851_100605802 | 134 |
| 230 | 3300005834 | Ga0068851_10187658 | Ga0068851_101876582 | 134 |
| 231 | 3300005840 | Ga0068870_10428312 | Ga0068870_104283122 | 134 |
| 232 | 3300005841 | Ga0068863_101386097 | Ga0068863_1013860972 | 134 |
| 233 | 3300005843 | Ga0068860_100375346 | Ga0068860_1003753462 | 134 |
| 234 | 3300005937 | Ga0081455_10008319 | Ga0081455_100083198 | 134 |
| 235 | 3300005937 | Ga0081455_10092830 | Ga0081455_100928304 | 134 |
| 236 | 3300005983 | Ga0081540_1004173 | Ga0081540_10041734 | 134 |
| 237 | 3300005985 | Ga0081539_10007659 | Ga0081539_100076598 | 134 |
| 238 | 3300005985 | Ga0081539_10082721 | Ga0081539_100827212 | 134 |
| 239 | 3300006028 | Ga0070717_10954532 | Ga0070717_109545321 | 134 |
| 240 | 3300006058 | Ga0075432_10059069 | Ga0075432_100590692 | 134 |
| 241 | 3300006163 | Ga0070715_11031358 | Ga0070715_110313581 | 134 |
| 242 | 3300006173 | Ga0070716_101519850 | Ga0070716_1015198502 | 134 |
| 243 | 3300006358 | Ga0068871_102124377 | Ga0068871_1021243771 | 134 |
| 244 | 3300006844 | Ga0075428_102426713 | Ga0075428_1024267131 | 134 |
| 245 | 3300006847 | Ga0075431_100083633 | Ga0075431_1000836332 | 134 |
| 246 | 3300006852 | Ga0075433_10045774 | Ga0075433_100457745 | 134 |
| 247 | 3300006871 | Ga0075434_100026628 | Ga0075434_1000266287 | 134 |
| 248 | 3300006881 | Ga0068865_100115175 | Ga0068865_1001151752 | 134 |
| 249 | 3300007076 | Ga0075435_101105893 | Ga0075435_1011058931 | 134 |
| 250 | 3300009093 | Ga0105240_10598127 | Ga0105240_105981272 | 134 |
| 251 | 3300009094 | Ga0111539_10105520 | Ga0111539_101055203 | 134 |
| 252 | 3300009094 | Ga0111539_10367904 | Ga0111539_103679042 | 134 |
| 253 | 3300009094 | Ga0111539_11326795 | Ga0111539_113267952 | 134 |
| 254 | 3300009098 | Ga0105245_10006591 | Ga0105245_100065913 | 134 |
| 255 | 3300009098 | Ga0105245_10097986 | Ga0105245_100979862 | 134 |
| 256 | 3300009098 | Ga0105245_10576849 | Ga0105245_105768492 | 134 |
| 257 | 3300009098 | Ga0105245_10899125 | Ga0105245_108991252 | 134 |
| 258 | 3300009101 | Ga0105247_10569664 | Ga0105247_105696642 | 134 |
| 259 | 3300009148 | Ga0105243_10700352 | Ga0105243_107003522 | 134 |
| 260 | 3300009176 | Ga0105242_11080562 | Ga0105242_110805622 | 134 |
| 261 | 3300009177 | Ga0105248_10065118 | Ga0105248_100651184 | 134 |
| 262 | 3300009177 | Ga0105248_10266355 | Ga0105248_102663552 | 134 |
| 263 | 3300009545 | Ga0105237_10650610 | Ga0105237_106506102 | 134 |
| 264 | 3300009545 | Ga0105237_10675430 | Ga0105237_106754302 | 134 |
| 265 | 3300009551 | Ga0105238_10701518 | Ga0105238_107015182 | 134 |
| 266 | 3300009553 | Ga0105249_10994646 | Ga0105249_109946462 | 134 |
| 267 | 3300009553 | Ga0105249_11508022 | Ga0105249_115080222 | 134 |
| 268 | 3300010375 | Ga0105239_10227359 | Ga0105239_102273593 | 134 |
| 269 | 3300010375 | Ga0105239_10377028 | Ga0105239_103770282 | 134 |
| 270 | 3300010375 | Ga0105239_10585561 | Ga0105239_105855612 | 134 |
| 271 | 3300010375 | Ga0105239_10767126 | Ga0105239_107671262 | 134 |
| 272 | 3300012490 | Ga0157322_1007991 | Ga0157322_10079912 | 134 |
| 273 | 3300013105 | Ga0157369_10346602 | Ga0157369_103466022 | 134 |
| 274 | 3300013105 | Ga0157369_11068067 | Ga0157369_110680672 | 134 |
| 275 | 3300013105 | Ga0157369_11372197 | Ga0157369_113721971 | 134 |
| 276 | 3300013296 | Ga0157374_10039180 | Ga0157374_100391803 | 134 |
| 277 | 3300013297 | Ga0157378_10170348 | Ga0157378_101703482 | 134 |
| 278 | 3300013297 | Ga0157378_10537119 | Ga0157378_105371192 | 134 |
| 279 | 3300013297 | Ga0157378_10737876 | Ga0157378_107378762 | 134 |
| 280 | 3300013306 | Ga0163162_10091804 | Ga0163162_100918042 | 134 |
| 281 | 3300013306 | Ga0163162_10594298 | Ga0163162_105942982 | 134 |
| 282 | 3300013307 | Ga0157372_10008742 | Ga0157372_100087427 | 134 |
| 283 | 3300013307 | Ga0157372_10617333 | Ga0157372_106173332 | 134 |
| 284 | 3300013307 | Ga0157372_10701359 | Ga0157372_107013592 | 134 |
| 285 | 3300013307 | Ga0157372_10821912 | Ga0157372_108219122 | 134 |
| 286 | 3300013308 | Ga0157375_11026411 | Ga0157375_110264112 | 134 |
| 287 | 3300013308 | Ga0157375_11313413 | Ga0157375_113134132 | 134 |
| 288 | 3300014325 | Ga0163163_10054198 | Ga0163163_100541984 | 134 |
| 289 | 3300014325 | Ga0163163_10228497 | Ga0163163_102284972 | 134 |
| 290 | 3300014325 | Ga0163163_10587441 | Ga0163163_105874412 | 134 |
| 291 | 3300014325 | Ga0163163_11106452 | Ga0163163_111064522 | 134 |
| 292 | 3300014326 | Ga0157380_10403702 | Ga0157380_104037022 | 134 |
| 293 | 3300014326 | Ga0157380_10590885 | Ga0157380_105908852 | 134 |
| 294 | 3300014326 | Ga0157380_11069956 | Ga0157380_110699562 | 134 |
| 295 | 3300014326 | Ga0157380_11652968 | Ga0157380_116529681 | 134 |
| 296 | 3300014497 | Ga0182008_10453387 | Ga0182008_104533872 | 134 |
| 297 | 3300014497 | Ga0182008_10833102 | Ga0182008_108331021 | 134 |
| 298 | 3300014745 | Ga0157377_10024201 | Ga0157377_100242013 | 134 |
| 299 | 3300014745 | Ga0157377_10694981 | Ga0157377_106949811 | 134 |
| 300 | 3300014968 | Ga0157379_10000487 | Ga0157379_1000048715 | 134 |
| 301 | 3300014969 | Ga0157376_10033638 | Ga0157376_100336384 | 134 |
| 302 | 3300014969 | Ga0157376_11398135 | Ga0157376_113981351 | 134 |
| 303 | 3300014969 | Ga0157376_12760325 | Ga0157376_127603251 | 134 |
| 304 | 3300015265 | Ga0182005_1261758 | Ga0182005_12617581 | 134 |
| 305 | 3300017792 | Ga0163161_10117735 | Ga0163161_101177352 | 134 |
| 306 | 3300020080 | Ga0206350_10920932 | Ga0206350_109209322 | 134 |
| 307 | 3300020081 | Ga0206354_10680993 | Ga0206354_106809931 | 134 |
| 308 | 3300020081 | Ga0206354_11048809 | Ga0206354_110488092 | 134 |
| 309 | 3300020082 | Ga0206353_11118769 | Ga0206353_111187692 | 134 |
| 310 | 3300020082 | Ga0206353_11473877 | Ga0206353_114738772 | 134 |
| 311 | 3300020082 | Ga0206353_11477553 | Ga0206353_114775532 | 134 |
| 312 | 3300021358 | Ga0213873_10132701 | Ga0213873_101327012 | 134 |
| 313 | 3300021377 | Ga0213874_10002209 | Ga0213874_100022094 | 134 |
| 314 | 3300021377 | Ga0213874_10169425 | Ga0213874_101694251 | 134 |
| 315 | 3300021384 | Ga0213876_10013700 | Ga0213876_100137002 | 134 |
| 316 | 3300021384 | Ga0213876_10036084 | Ga0213876_100360841 | 134 |
| 317 | 3300021384 | Ga0213876_10091881 | Ga0213876_100918811 | 134 |
| 318 | 3300021388 | Ga0213875_10008882 | Ga0213875_100088825 | 134 |
| 319 | 3300021388 | Ga0213875_10030530 | Ga0213875_100305302 | 134 |
| 320 | 3300022467 | Ga0224712_10448657 | Ga0224712_104486572 | 134 |
| 321 | 3300022467 | Ga0224712_10544630 | Ga0224712_105446301 | 134 |
| 322 | 3300025321 | Ga0207656_10162647 | Ga0207656_101626472 | 134 |
| 323 | 3300025885 | Ga0207653_10056992 | Ga0207653_100569922 | 134 |
| 324 | 3300025898 | Ga0207692_10027926 | Ga0207692_100279262 | 134 |
| 325 | 3300025898 | Ga0207692_10174716 | Ga0207692_101747162 | 134 |
| 326 | 3300025901 | Ga0207688_10001339 | Ga0207688_100013398 | 134 |
| 327 | 3300025906 | Ga0207699_10099663 | Ga0207699_100996632 | 134 |
| 328 | 3300025908 | Ga0207643_10353797 | Ga0207643_103537972 | 134 |
| 329 | 3300025909 | Ga0207705_10594399 | Ga0207705_105943991 | 134 |
| 330 | 3300025914 | Ga0207671_10042892 | Ga0207671_100428925 | 134 |
| 331 | 3300025914 | Ga0207671_10664013 | Ga0207671_106640131 | 134 |
| 332 | 3300025916 | Ga0207663_11082142 | Ga0207663_110821422 | 134 |
| 333 | 3300025919 | Ga0207657_10005964 | Ga0207657_100059647 | 134 |
| 334 | 3300025919 | Ga0207657_10152395 | Ga0207657_101523952 | 134 |
| 335 | 3300025919 | Ga0207657_10370482 | Ga0207657_103704821 | 134 |
| 336 | 3300025919 | Ga0207657_10622615 | Ga0207657_106226152 | 134 |
| 337 | 3300025920 | Ga0207649_10049977 | Ga0207649_100499772 | 134 |
| 338 | 3300025920 | Ga0207649_11051495 | Ga0207649_110514951 | 134 |
| 339 | 3300025920 | Ga0207649_11121593 | Ga0207649_111215932 | 134 |
| 340 | 3300025921 | Ga0207652_10750527 | Ga0207652_107505272 | 134 |
| 341 | 3300025921 | Ga0207652_11014785 | Ga0207652_110147851 | 134 |
| 342 | 3300025926 | Ga0207659_10036621 | Ga0207659_100366213 | 134 |
| 343 | 3300025927 | Ga0207687_10053679 | Ga0207687_100536792 | 134 |
| 344 | 3300025927 | Ga0207687_10387561 | Ga0207687_103875612 | 134 |
| 345 | 3300025927 | Ga0207687_11392381 | Ga0207687_113923811 | 134 |
| 346 | 3300025927 | Ga0207687_11673502 | Ga0207687_116735021 | 134 |
| 347 | 3300025931 | Ga0207644_10081260 | Ga0207644_100812601 | 134 |
| 348 | 3300025932 | Ga0207690_11110390 | Ga0207690_111103902 | 134 |
| 349 | 3300025933 | Ga0207706_10071097 | Ga0207706_100710973 | 134 |
| 350 | 3300025934 | Ga0207686_10921506 | Ga0207686_109215062 | 134 |
| 351 | 3300025934 | Ga0207686_11299563 | Ga0207686_112995632 | 134 |
| 352 | 3300025936 | Ga0207670_10690756 | Ga0207670_106907562 | 134 |
| 353 | 3300025937 | Ga0207669_10054442 | Ga0207669_100544422 | 134 |
| 354 | 3300025938 | Ga0207704_10018097 | Ga0207704_100180973 | 134 |
| 355 | 3300025940 | Ga0207691_11130799 | Ga0207691_111307992 | 134 |
| 356 | 3300025941 | Ga0207711_10095876 | Ga0207711_100958763 | 134 |
| 357 | 3300025941 | Ga0207711_10657735 | Ga0207711_106577352 | 134 |
| 358 | 3300025942 | Ga0207689_10177076 | Ga0207689_101770762 | 134 |
| 359 | 3300025942 | Ga0207689_10251601 | Ga0207689_102516012 | 134 |
| 360 | 3300025944 | Ga0207661_10908270 | Ga0207661_109082702 | 134 |
| 361 | 3300025945 | Ga0207679_10454393 | Ga0207679_104543932 | 134 |
| 362 | 3300025945 | Ga0207679_11177016 | Ga0207679_111770162 | 134 |
| 363 | 3300025949 | Ga0207667_10495225 | Ga0207667_104952252 | 134 |
| 364 | 3300025949 | Ga0207667_10691583 | Ga0207667_106915832 | 134 |
| 365 | 3300025960 | Ga0207651_10457279 | Ga0207651_104572792 | 134 |
| 366 | 3300025972 | Ga0207668_10215881 | Ga0207668_102158812 | 134 |
| 367 | 3300025981 | Ga0207640_10138045 | Ga0207640_101380452 | 134 |
| 368 | 3300026023 | Ga0207677_10061899 | Ga0207677_100618992 | 134 |
| 369 | 3300026067 | Ga0207678_10040159 | Ga0207678_100401593 | 134 |
| 370 | 3300026067 | Ga0207678_10735007 | Ga0207678_107350072 | 134 |
| 371 | 3300026075 | Ga0207708_10001261 | Ga0207708_100012616 | 134 |
| 372 | 3300026078 | Ga0207702_10050339 | Ga0207702_100503391 | 134 |
| 373 | 3300026078 | Ga0207702_10132417 | Ga0207702_101324172 | 134 |
| 374 | 3300026088 | Ga0207641_12082520 | Ga0207641_120825202 | 134 |
| 375 | 3300026089 | Ga0207648_10729879 | Ga0207648_107298792 | 134 |
| 376 | 3300026095 | Ga0207676_10678429 | Ga0207676_106784292 | 134 |
| 377 | 3300026116 | Ga0207674_10072347 | Ga0207674_100723473 | 134 |
| 378 | 3300026116 | Ga0207674_10176166 | Ga0207674_101761662 | 134 |
| 379 | 3300026121 | Ga0207683_10176030 | Ga0207683_101760302 | 134 |
| 380 | 3300026142 | Ga0207698_10071476 | Ga0207698_100714762 | 134 |
| 381 | 3300027907 | Ga0207428_10257929 | Ga0207428_102579292 | 134 |
| 382 | 3300028379 | Ga0268266_10098051 | Ga0268266_100980512 | 134 |
| 383 | 3300028379 | Ga0268266_10503965 | Ga0268266_105039652 | 134 |
| 384 | 3300028381 | Ga0268264_10135004 | Ga0268264_101350042 | 134 |
| 385 | 3300028381 | Ga0268264_10244191 | Ga0268264_102441912 | 134 |
| 386 | 3300028577 | Ga0265318_10005827 | Ga0265318_100058272 | 134 |
| 387 | 3300028800 | Ga0265338_10063099 | Ga0265338_100630992 | 134 |
| 388 | 3300031240 | Ga0265320_10019761 | Ga0265320_100197615 | 134 |
| 389 | 3300031250 | Ga0265331_10430770 | Ga0265331_104307701 | 134 |
| 390 | 3300031344 | Ga0265316_10048130 | Ga0265316_100481304 | 134 |
| 391 | 3300031548 | Ga0307408_100393073 | Ga0307408_1003930732 | 134 |
| 392 | 3300031711 | Ga0265314_10031831 | Ga0265314_100318315 | 134 |
| 393 | 3300031901 | Ga0307406_10641631 | Ga0307406_106416312 | 134 |
| 394 | 3300031995 | Ga0307409_102573717 | Ga0307409_1025737171 | 134 |
| 395 | 3300032002 | Ga0307416_100857104 | Ga0307416_1008571041 | 134 |
| 396 | 3300032002 | Ga0307416_100950772 | Ga0307416_1009507722 | 134 |
| 397 | 3300032126 | Ga0307415_100073302 | Ga0307415_1000733022 | 134 |
| 398 | 3300032126 | Ga0307415_100968016 | Ga0307415_1009680162 | 134 |
| 399 | 3300035242 | Ga0373962_0106543 | Ga0373962_0106543_368_772 | 134 |
| 400 | 3300035692 | Ga0373935_0519707 | Ga0373935_0519707_261_665 | 134 |
| 401 | 3300037312 | Ga0395899_0189246 | Ga0395899_0189246_84_491 | 134 |
| 402 | 3300037418 | Ga0395900_0084021 | Ga0395900_0084021_670_1080 | 134 |
| 403 | 3300037418 | Ga0395900_0122633 | Ga0395900_0122633_949_1356 | 134 |
| 404 | 3300037418 | Ga0395900_0946404 | Ga0395900_0946404_177_581 | 134 |
| 405 | 3300037418 | Ga0395900_0982323 | Ga0395900_0982323_54_458 | 134 |
| 406 | 3300037418 | Ga0395900_1078429 | Ga0395900_1078429_56_472 | 134 |
| 407 | 3300037418 | Ga0395900_1223319 | Ga0395900_1223319_26_433 | 134 |
| 408 | 3300037466 | Ga0395898_0086730 | Ga0395898_0086730_324_734 | 134 |
| 409 | 3300037466 | Ga0395898_0160642 | Ga0395898_0160642_1702_2109 | 134 |
| 410 | 3300037466 | Ga0395898_0233696 | Ga0395898_0233696_1207_1611 | 134 |
| 411 | 3300037466 | Ga0395898_0247248 | Ga0395898_0247248_879_1286 | 134 |
| 412 | 3300037466 | Ga0395898_0377603 | Ga0395898_0377603_374_778 | 134 |
| 413 | 3300037466 | Ga0395898_0450523 | Ga0395898_0450523_549_965 | 134 |
| 414 | 3300037471 | Ga0395905_0229515 | Ga0395905_0229515_1289_1699 | 134 |
| 415 | 3300037471 | Ga0395905_0338718 | Ga0395905_0338718_698_1105 | 134 |
| 416 | 3300037853 | Ga0436364_0329358 | Ga0436364_0329358_1764_2177 | 134 |
| 417 | 3300037853 | Ga0436364_0609270 | Ga0436364_0609270_4371_4784 | 134 |
| 418 | 3300037853 | Ga0436364_0796475 | Ga0436364_0796475_287_700 | 134 |
| 419 | 3300037853 | Ga0436364_1012143 | Ga0436364_1012143_124_540 | 134 |
| 420 | 3300037853 | Ga0436364_1218841 | Ga0436364_1218841_3989_4405 | 134 |
| 421 | 3300038443 | Ga0395901_0004053 | Ga0395901_0004053_13254_13661 | 134 |
| 422 | 3300038443 | Ga0395901_0085916 | Ga0395901_0085916_1135_1545 | 134 |
| 423 | 3300038443 | Ga0395901_0100846 | Ga0395901_0100846_1139_1543 | 134 |
| 424 | 3300038443 | Ga0395901_0357708 | Ga0395901_0357708_974_1378 | 134 |
| 425 | 3300038443 | Ga0395901_1040896 | Ga0395901_1040896_123_539 | 134 |
| 426 | 3300038443 | Ga0395901_1084100 | Ga0395901_1084100_37_444 | 134 |
| 427 | 3300038443 | Ga0395901_1216940 | Ga0395901_1216940_203_607 | 134 |
| 428 | 3300038443 | Ga0395901_1385755 | Ga0395901_1385755_62_466 | 134 |
| 429 | 3300039437 | Ga0436365_0561077 | Ga0436365_0561077_36_443 | 134 |
| 430 | 3300039437 | Ga0436365_0705902 | Ga0436365_0705902_72_485 | 134 |
| 431 | 3300039437 | Ga0436365_0889001 | Ga0436365_0889001_1331_1744 | 134 |
| 432 | 3300039437 | Ga0436365_0999899 | Ga0436365_0999899_654_1070 | 134 |
| 433 | 3300039437 | Ga0436365_1213556 | Ga0436365_1213556_1893_2306 | 134 |
| 434 | 3300039437 | Ga0436365_1246407 | Ga0436365_1246407_971_1387 | 134 |
| 435 | 3300039437 | Ga0436365_1821223 | Ga0436365_1821223_1657_2079 | 134 |
| 436 | 3300039450 | Ga0436363_0484789 | Ga0436363_0484789_379_792 | 134 |
| 437 | 3300039450 | Ga0436363_0537896 | Ga0436363_0537896_184_597 | 134 |
| 438 | 3300039450 | Ga0436363_0712334 | Ga0436363_0712334_4104_4517 | 134 |
| 439 | 3300039450 | Ga0436363_1475091 | Ga0436363_1475091_609_1022 | 134 |
| 440 | 3300039450 | Ga0436363_1627320 | Ga0436363_1627320_3712_4125 | 134 |
| 441 | 3300039453 | Ga0436362_0104098 | Ga0436362_0104098_128_541 | 134 |
| 442 | 3300039453 | Ga0436362_0226952 | Ga0436362_0226952_178_594 | 134 |
| 443 | 3300039453 | Ga0436362_0670333 | Ga0436362_0670333_292_705 | 134 |
| 444 | 3300039453 | Ga0436362_0961579 | Ga0436362_0961579_256_678 | 134 |
| 445 | 3300041451 | Ga0451791_0001963 | Ga0451791_0001963_366_770 | 134 |
| 446 | 3300041460 | Ga0451802_1928281 | Ga0451802_1928281_66_470 | 134 |
| 447 | 3300041491 | Ga0451833_0906112 | Ga0451833_0906112_61_465 | 134 |
| 448 | 3300041492 | Ga0451835_0043310 | Ga0451835_0043310_320_724 | 134 |
| 449 | 3300041509 | Ga0451843_0633562 | Ga0451843_0633562_70_474 | 134 |
| 450 | 3300042016 | Ga0439463_084049 | Ga0439463_084049_202_606 | 134 |
| 451 | 3300042438 | Ga0439459_0062036 | Ga0439459_0062036_353_757 | 134 |
| 452 | 3300044658 | Ga0466972_0213047 | Ga0466972_0213047_362_766 | 134 |
| 453 | 3300044658 | Ga0466972_0360437 | Ga0466972_0360437_211_615 | 134 |
| 454 | 3300044684 | Ga0466966_0259522 | Ga0466966_0259522_118_522 | 134 |
| 455 | 3300044684 | Ga0466966_0354980 | Ga0466966_0354980_14_433 | 134 |
| 456 | 3300044694 | Ga0466963_0060540 | Ga0466963_0060540_1313_1735 | 134 |
| 457 | 3300044694 | Ga0466963_0275139 | Ga0466963_0275139_509_916 | 134 |
| 458 | 3300044694 | Ga0466963_0282802 | Ga0466963_0282802_542_946 | 134 |
| 459 | 3300044706 | Ga0466964_0289310 | Ga0466964_0289310_359_763 | 134 |
| 460 | 3300044735 | Ga0466968_0171883 | Ga0466968_0171883_244_648 | 134 |
| 461 | 3300044735 | Ga0466968_0362065 | Ga0466968_0362065_60_467 | 134 |
| 462 | 3300044842 | Ga0466957_0069088 | Ga0466957_0069088_1181_1606 | 134 |
| 463 | 3300044842 | Ga0466957_0142504 | Ga0466957_0142504_595_1014 | 134 |
| 464 | 3300044842 | Ga0466957_0259328 | Ga0466957_0259328_61_465 | 134 |
| 465 | 3300044842 | Ga0466957_0942431 | Ga0466957_0942431_168_584 | 134 |
| 466 | 3300044842 | Ga0466957_1151146 | Ga0466957_1151146_46_459 | 134 |
| 467 | 3300044901 | Ga0466960_0000024 | Ga0466960_0000024_30984_31388 | 134 |
| 468 | 3300044901 | Ga0466960_0015842 | Ga0466960_0015842_1113_1517 | 134 |
| 469 | 3300044901 | Ga0466960_0094679 | Ga0466960_0094679_326_730 | 134 |
| 470 | 3300044901 | Ga0466960_0109048 | Ga0466960_0109048_748_1152 | 134 |
| 471 | 3300044901 | Ga0466960_0272563 | Ga0466960_0272563_222_626 | 134 |
| 472 | 3300045049 | Ga0466959_0366815 | Ga0466959_0366815_315_725 | 134 |
| 473 | 3300045049 | Ga0466959_0689193 | Ga0466959_0689193_65_481 | 134 |
| 474 | 3300045836 | Ga0466958_0049004 | Ga0466958_0049004_1592_2002 | 134 |
| 475 | 3300045836 | Ga0466958_0072458 | Ga0466958_0072458_1015_1425 | 134 |
| 476 | 3300045836 | Ga0466958_0150103 | Ga0466958_0150103_394_816 | 134 |
| 477 | 3300045836 | Ga0466958_0182902 | Ga0466958_0182902_760_1179 | 134 |
| 478 | 3300045836 | Ga0466958_0205866 | Ga0466958_0205866_264_677 | 134 |
| 479 | 3300045836 | Ga0466958_0396222 | Ga0466958_0396222_295_720 | 134 |
| 480 | 3300045836 | Ga0466958_0500207 | Ga0466958_0500207_182_586 | 134 |
| 481 | 3300045976 | Ga0466967_0242089 | Ga0466967_0242089_456_863 | 134 |
| 482 | 3300045976 | Ga0466967_0420437 | Ga0466967_0420437_641_1045 | 134 |
| 483 | 3300045976 | Ga0466967_2383201 | Ga0466967_2383201_70_492 | 134 |
| 484 | 3300046457 | Ga0495590_0029636 | Ga0495590_0029636_698_1102 | 134 |
| 485 | 3300046461 | Ga0495641_0025560 | Ga0495641_0025560_71_475 | 134 |
| 486 | 3300046471 | Ga0495650_0000035 | Ga0495650_0000035_242151_242555 | 134 |
| 487 | 3300046499 | Ga0495594_0321849 | Ga0495594_0321849_250_654 | 134 |
| 488 | 3300046517 | Ga0495630_0699127 | Ga0495630_0699127_253_663 | 134 |
| 489 | 3300046518 | Ga0495631_0128778 | Ga0495631_0128778_497_904 | 134 |
| 490 | 3300046525 | Ga0495663_0405997 | Ga0495663_0405997_87_491 | 134 |
| 491 | 3300046530 | Ga0495654_0355016 | Ga0495654_0355016_154_558 | 134 |
| 492 | 3300046535 | Ga0495586_0396002 | Ga0495586_0396002_347_751 | 134 |
| 493 | 3300046538 | Ga0495609_0209430 | Ga0495609_0209430_210_617 | 134 |
| 494 | 3300046539 | Ga0495621_0201042 | Ga0495621_0201042_211_615 | 134 |
| 495 | 3300046559 | Ga0495667_0191052 | Ga0495667_0191052_99_509 | 134 |
| 496 | 3300046615 | Ga0495656_0058246 | Ga0495656_0058246_624_1028 | 134 |
| 497 | 3300046678 | Ga0495599_0454771 | Ga0495599_0454771_14_427 | 134 |
| 498 | 3300046683 | Ga0495658_0182636 | Ga0495658_0182636_857_1261 | 134 |
| 499 | 3300046691 | Ga0495670_0160176 | Ga0495670_0160176_112_516 | 134 |
| 500 | 3300046794 | Ga0495589_0400654 | Ga0495589_0400654_24_449 | 134 |
| 501 | 3300046794 | Ga0495589_0489772 | Ga0495589_0489772_135_539 | 134 |
| 502 | 3300047317 | Ga0495604_0157124 | Ga0495604_0157124_46_456 | 134 |
| 503 | 3300047322 | Ga0495680_0563021 | Ga0495680_0563021_298_708 | 134 |
| 504 | 3300047445 | Ga0495677_0140583 | Ga0495677_0140583_219_623 | 134 |
| 505 | 3300047472 | Ga0495686_0295382 | Ga0495686_0295382_55_462 | 134 |
| 506 | 3300048091 | Ga0495626_0158911 | Ga0495626_0158911_43_447 | 134 |
| 507 | 3300048903 | Ga0496100_0033594 | Ga0496100_0033594_1539_1964 | 134 |
| 508 | 3300048903 | Ga0496100_0157507 | Ga0496100_0157507_146_550 | 134 |
| 509 | 3300048904 | Ga0496101_0044196 | Ga0496101_0044196_56_460 | 134 |
| 510 | 3300048904 | Ga0496101_0051818 | Ga0496101_0051818_1230_1655 | 134 |
| 511 | 3300048904 | Ga0496101_0449672 | Ga0496101_0449672_293_700 | 134 |
| 512 | 3300048905 | Ga0496102_0018229 | Ga0496102_0018229_4385_4789 | 134 |
| 513 | 3300048905 | Ga0496102_0043979 | Ga0496102_0043979_1431_1835 | 134 |
| 514 | 3300048905 | Ga0496102_0140336 | Ga0496102_0140336_1705_2130 | 134 |
| 515 | 3300048905 | Ga0496102_0292648 | Ga0496102_0292648_826_1230 | 134 |
| 516 | 3300048905 | Ga0496102_0977957 | Ga0496102_0977957_83_490 | 134 |
| 517 | 3300048906 | Ga0496103_0026004 | Ga0496103_0026004_169_594 | 134 |
| 518 | 3300048906 | Ga0496103_0399008 | Ga0496103_0399008_187_591 | 134 |
| 519 | 3300048906 | Ga0496103_0587724 | Ga0496103_0587724_83_490 | 134 |
| 520 | 3300048907 | Ga0496104_0002732 | Ga0496104_0002732_13139_13546 | 134 |
| 521 | 3300048907 | Ga0496104_0142061 | Ga0496104_0142061_1661_2065 | 134 |
| 522 | 3300048907 | Ga0496104_0197880 | Ga0496104_0197880_542_967 | 134 |
| 523 | 3300048907 | Ga0496104_0803300 | Ga0496104_0803300_330_737 | 134 |
| 524 | 3300048908 | Ga0496105_0072630 | Ga0496105_0072630_1155_1571 | 134 |
| 525 | 3300048908 | Ga0496105_0075266 | Ga0496105_0075266_1781_2188 | 134 |
| 526 | 3300048908 | Ga0496105_0311233 | Ga0496105_0311233_642_1049 | 134 |
| 527 | 3300048909 | Ga0496106_0034464 | Ga0496106_0034464_3300_3704 | 134 |
| 528 | 3300048909 | Ga0496106_0191672 | Ga0496106_0191672_585_1010 | 134 |
| 529 | 3300048909 | Ga0496106_0432212 | Ga0496106_0432212_609_1013 | 134 |
| 530 | 3300048910 | Ga0496107_0009709 | Ga0496107_0009709_635_1039 | 134 |
| 531 | 3300048910 | Ga0496107_0095496 | Ga0496107_0095496_1001_1426 | 134 |
| 532 | 3300048910 | Ga0496107_0982375 | Ga0496107_0982375_172_585 | 134 |
| 533 | 3300048911 | Ga0496108_0000712 | Ga0496108_0000712_19064_19468 | 134 |
| 534 | 3300048911 | Ga0496108_0004745 | Ga0496108_0004745_9644_10069 | 134 |
| 535 | 3300048911 | Ga0496108_0029433 | Ga0496108_0029433_3603_4007 | 134 |
| 536 | 3300048911 | Ga0496108_0258549 | Ga0496108_0258549_248_655 | 134 |
| 537 | 3300048911 | Ga0496108_0300516 | Ga0496108_0300516_739_1146 | 134 |
| 538 | 3300048912 | Ga0496109_0002857 | Ga0496109_0002857_655_1080 | 134 |
| 539 | 3300048912 | Ga0496109_0075725 | Ga0496109_0075725_902_1309 | 134 |
| 540 | 3300048912 | Ga0496109_0124143 | Ga0496109_0124143_1287_1691 | 134 |
| 541 | 3300048912 | Ga0496109_0433482 | Ga0496109_0433482_729_1136 | 134 |
| 542 | 3300048913 | Ga0496110_0000358 | Ga0496110_0000358_26067_26471 | 134 |
| 543 | 3300048913 | Ga0496110_0001659 | Ga0496110_0001659_3912_4337 | 134 |
| 544 | 3300048913 | Ga0496110_0276652 | Ga0496110_0276652_329_733 | 134 |
| 545 | 3300048913 | Ga0496110_0497873 | Ga0496110_0497873_180_587 | 134 |
| 546 | 3300048914 | Ga0496111_0010411 | Ga0496111_0010411_1338_1763 | 134 |
| 547 | 3300048914 | Ga0496111_0021775 | Ga0496111_0021775_326_730 | 134 |
| 548 | 3300048914 | Ga0496111_0131442 | Ga0496111_0131442_644_1051 | 134 |
| 549 | 3300048915 | Ga0496112_0016208 | Ga0496112_0016208_3847_4254 | 134 |
| 550 | 3300048915 | Ga0496112_0020849 | Ga0496112_0020849_4189_4593 | 134 |
| 551 | 3300048915 | Ga0496112_0026391 | Ga0496112_0026391_1195_1602 | 134 |
| 552 | 3300048915 | Ga0496112_0032129 | Ga0496112_0032129_192_617 | 134 |
| 553 | 3300048915 | Ga0496112_0044051 | Ga0496112_0044051_311_715 | 134 |
| 554 | 3300048915 | Ga0496112_0133498 | Ga0496112_0133498_34_441 | 134 |
| 555 | 3300048915 | Ga0496112_0251856 | Ga0496112_0251856_623_1027 | 134 |
| 556 | 3300048916 | Ga0496113_0016680 | Ga0496113_0016680_203_610 | 134 |
| 557 | 3300048916 | Ga0496113_0029015 | Ga0496113_0029015_3036_3461 | 134 |
| 558 | 3300048916 | Ga0496113_0081097 | Ga0496113_0081097_1837_2241 | 134 |
| 559 | 3300048916 | Ga0496113_0094304 | Ga0496113_0094304_1169_1573 | 134 |
| 560 | 3300048917 | Ga0496114_0262366 | Ga0496114_0262366_454_861 | 134 |
| 561 | 3300048917 | Ga0496114_0330741 | Ga0496114_0330741_384_788 | 134 |
| 562 | 3300048917 | Ga0496114_0503106 | Ga0496114_0503106_82_489 | 134 |
| 563 | 3300048917 | Ga0496114_0507730 | Ga0496114_0507730_339_764 | 134 |
| 564 | 3300048917 | Ga0496114_0676959 | Ga0496114_0676959_283_687 | 134 |
| 565 | 3300048918 | Ga0496115_0006172 | Ga0496115_0006172_4659_5063 | 134 |
| 566 | 3300048918 | Ga0496115_0062284 | Ga0496115_0062284_1330_1746 | 134 |
| 567 | 3300048918 | Ga0496115_0405557 | Ga0496115_0405557_261_668 | 134 |
| 568 | 3300048922 | Ga0496119_0260064 | Ga0496119_0260064_372_776 | 134 |
| 569 | 3300048924 | Ga0496121_0034885 | Ga0496121_0034885_2757_3161 | 134 |
| 570 | 3300048926 | Ga0496123_0231911 | Ga0496123_0231911_163_576 | 134 |
| 571 | 3300049568 | Ga0501031_0028269 | Ga0501031_0028269_1316_1720 | 134 |
| 572 | 3300049569 | Ga0501032_0039289 | Ga0501032_0039289_1214_1618 | 134 |
| 573 | 3300049570 | Ga0501033_0041001 | Ga0501033_0041001_2558_2962 | 134 |
| 574 | 3300049571 | Ga0501034_0067114 | Ga0501034_0067114_2703_3107 | 134 |
| 575 | 3300049571 | Ga0501034_0082769 | Ga0501034_0082769_679_1083 | 134 |
| 576 | 3300049572 | Ga0501036_0121015 | Ga0501036_0121015_72_476 | 134 |
| 577 | 3300049573 | Ga0501037_0016364 | Ga0501037_0016364_2208_2612 | 134 |
| 578 | 3300049574 | Ga0501038_0004424 | Ga0501038_0004424_4066_4470 | 134 |
| 579 | 3300049575 | Ga0501039_0047066 | Ga0501039_0047066_1862_2266 | 134 |
| 580 | 3300049578 | Ga0501042_0024897 | Ga0501042_0024897_1652_2056 | 134 |
| 581 | 3300049580 | Ga0501046_0118476 | Ga0501046_0118476_834_1238 | 134 |
| 582 | 3300049581 | Ga0501047_0089863 | Ga0501047_0089863_217_621 | 134 |
| 583 | 3300049582 | Ga0501048_0003039 | Ga0501048_0003039_11649_12053 | 134 |
| 584 | 3300049583 | Ga0501067_0058156 | Ga0501067_0058156_1655_2059 | 134 |
| 585 | 3300049583 | Ga0501067_0695206 | Ga0501067_0695206_132_536 | 134 |
| 586 | 3300049584 | Ga0501068_0007611 | Ga0501068_0007611_3813_4217 | 134 |
| 587 | 3300049584 | Ga0501068_0864178 | Ga0501068_0864178_110_514 | 134 |
| 588 | 3300049584 | Ga0501068_0936441 | Ga0501068_0936441_98_502 | 134 |
| 589 | 3300049585 | Ga0501069_0008115 | Ga0501069_0008115_2703_3107 | 134 |
| 590 | 3300049585 | Ga0501069_0054166 | Ga0501069_0054166_45_449 | 134 |
| 591 | 3300049586 | Ga0501070_0025893 | Ga0501070_0025893_1572_1976 | 134 |
| 592 | 3300049587 | Ga0501071_1100715 | Ga0501071_1100715_101_505 | 134 |
| 593 | 3300049589 | Ga0501073_0016890 | Ga0501073_0016890_1444_1848 | 134 |
| 594 | 3300049590 | Ga0501074_0096048 | Ga0501074_0096048_11_415 | 134 |
| 595 | 3300049590 | Ga0501074_0213468 | Ga0501074_0213468_698_1102 | 134 |
| 596 | 3300049742 | Ga0501080_0028739 | Ga0501080_0028739_2178_2582 | 134 |
| 597 | 3300049742 | Ga0501080_0029673 | Ga0501080_0029673_2030_2434 | 134 |
| 598 | 3300049744 | Ga0501083_0096713 | Ga0501083_0096713_639_1043 | 134 |
| 599 | 3300049822 | Ga0501035_0021932 | Ga0501035_0021932_3137_3541 | 134 |
| 600 | 3300049823 | Ga0501044_0158149 | Ga0501044_0158149_1444_1848 | 134 |
| 601 | 3300050510 | nmdc:mga06r32_53522_c2 | nmdc:mga06r32_53522_c2_99_515 | 134 |
| 602 | 3300050511 | nmdc:mga08y16_18110_c1 | nmdc:mga08y16_18110_c1_445_861 | 134 |
| 603 | 3300050511 | nmdc:mga08y16_307053_c1 | nmdc:mga08y16_307053_c1_335_760 | 134 |
| 604 | 3300050512 | nmdc:mga0n895_35367_c1 | nmdc:mga0n895_35367_c1_541_957 | 134 |
| 605 | 3300050513 | nmdc:mga0rr50_180188_c1 | nmdc:mga0rr50_180188_c1_1293_1709 | 134 |
| 606 | 3300050513 | nmdc:mga0rr50_636955_c1 | nmdc:mga0rr50_636955_c1_29_445 | 134 |
| 607 | 3300050514 | nmdc:mga08x19_657010_c1 | nmdc:mga08x19_657010_c1_38_454 | 134 |
| 608 | 3300053096 | Ga0500641_0285532 | Ga0500641_0285532_247_651 | 134 |
| 609 | 3300053104 | Ga0500556_0001386 | Ga0500556_0001386_4167_4580 | 134 |
| 610 | 3300053153 | Ga0500616_0005748 | Ga0500616_0005748_4302_4706 | 134 |
| 611 | 3300053153 | Ga0500616_0013284 | Ga0500616_0013284_3757_4170 | 134 |
| 612 | 3300053736 | Ga0500599_007905 | Ga0500599_007905_273_686 | 134 |
| 613 | 3300054114 | Ga0501084_0117593 | Ga0501084_0117593_1529_1933 | 134 |
| 614 | 3300060353 | Ga0501082_0026301 | Ga0501082_0026301_4513_4917 | 134 |
| 615 | 3300060353 | Ga0501082_1199622 | Ga0501082_1199622_87_494 | 134 |
| 616 | 3300061719 | Ga0466962_0213000 | Ga0466962_0213000_58_468 | 134 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pn2-assembly1.cif.gz_A-2 | crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution | 0.8887 | 3 | 128 |
| 2opl-assembly1.cif.gz_A | crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution | 0.8543 | 2 | 121 |
| 2onf-assembly1.cif.gz_B | crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution | 0.8458 | 2 | 130 |
| 1lql-assembly4.cif.gz_G | crystal structure of osmc like protein from mycoplasma pneumoniae | 0.8434 | 2 | 130 |
| 2pn2-assembly1.cif.gz_A-2 | crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution | 0.833 | 3 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2pn2A00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8699 | 3 | 128 | 3.30.300.20 |
| 2oplB01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8533 | 2 | 117 | 3.30.300.20 |
| 1lqlE02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8371 | 38 | 130 | 3.30.300.20 |
| 2onfB01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8288 | 4 | 130 | 3.30.300.20 |
| 2pn2A00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8215 | 3 | 128 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W6BPW2-F1-model_v4 | Osmotically inducible protein OsmC | 0.9709 | 50 | 134 |
|
| AF-A0A2W6C421-F1-model_v4 | OsmC family peroxiredoxin | 0.9654 | 33 | 132 |
|
| AF-A0A2W6BPW2-F1-model_v4 | Osmotically inducible protein OsmC | 0.9384 | 50 | 134 |
|
| AF-A0A640Y902-F1-model_v4 | OsmC family peroxiredoxin | 0.9377 | 1 | 121 |
|
| AF-A0A317E521-F1-model_v4 | Osmotically inducible protein C | 0.9362 | 2 | 128 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar