F469522

General Info

Members Datasets Scaffolds Average Seq Length
616 317 616 137

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100449118|Ga0070679_1004491182
Length 152
Sequence MSLLSRSHKQDSPAPSGSMRAVARQREKYTHDVKMGNHQLVADEPTEQGGHDEGPNPQELLAASLASCTAVTMEMYAQRKGWDIGGVEVVCEYTPAERGCPTKFDLVLRLSDDLSDEQVERLRVIAAKCPVHRTLDGEVMFDERVERVTLAH

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
166 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
167 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
168 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
169 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
170 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
196 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
197 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
198 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
199 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
200 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
201 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
202 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
203 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
226 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
249 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
250 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
251 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
285 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
298 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
304 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
305 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
306 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
309 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
310 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
311 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
312 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
313 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 3.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0
Rhizoplane 12.34
Rhizosphere 81.49
Stem 0
Stem Tuber 0
Unclassified 5.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1020692 3300000549 Bacteria 765
2 Ga0070683_100001798 3300005329 Bacteria 16709
3 Ga0070683_100373327 3300005329 Bacteria 1359
4 Ga0070690_100344330 3300005330 Bacteria 1080
5 Ga0068869_100051454 3300005334 Bacteria 2989
6 Ga0068869_100757719 3300005334 Bacteria 832
7 Ga0070680_100337163 3300005336 Unclassified 1281
8 Ga0070680_100566338 3300005336 Bacteria 974
9 Ga0070680_100789632 3300005336 Bacteria 818
10 Ga0070682_100009060 3300005337 Bacteria 5626
11 Ga0070682_100041971 3300005337 Bacteria 2822
12 Ga0070682_100715011 3300005337 Bacteria 805
13 Ga0068868_100008651 3300005338 Bacteria 7288
14 Ga0068868_100332540 3300005338 Bacteria 1297
15 Ga0068868_100724343 3300005338 Bacteria 892
16 Ga0070660_100177501 3300005339 Bacteria 1723
17 Ga0070660_100184302 3300005339 Bacteria 1690
18 Ga0070660_100547721 3300005339 Bacteria 965
19 Ga0070660_101331383 3300005339 Bacteria 610
20 Ga0070689_100144614 3300005340 Bacteria 1914
21 Ga0070691_10020996 3300005341 Bacteria 3020
22 Ga0070661_100072394 3300005344 Bacteria 2536
23 Ga0070661_100456057 3300005344 Bacteria 1018
24 Ga0070692_10092109 3300005345 Unclassified 1649
25 Ga0070692_10274015 3300005345 Bacteria 1020
26 Ga0070668_100287799 3300005347 Bacteria 1374
27 Ga0070668_100469898 3300005347 Bacteria 1084
28 Ga0070669_100019081 3300005353 Bacteria 4902
29 Ga0070675_100034760 3300005354 Bacteria 4091
30 Ga0070671_100264832 3300005355 Bacteria 1461
31 Ga0070671_101301640 3300005355 Bacteria 641
32 Ga0070674_100082894 3300005356 Bacteria 2295
33 Ga0070673_100306157 3300005364 Bacteria 1400
34 Ga0070688_100133986 3300005365 Bacteria 1675
35 Ga0070688_100486115 3300005365 Bacteria 929
36 Ga0070659_100000077 3300005366 Bacteria 76934
37 Ga0070659_100110662 3300005366 Bacteria 2217
38 Ga0070667_100594130 3300005367 Bacteria 1019
39 Ga0070709_10291791 3300005434 Bacteria 1189
40 Ga0070709_10827507 3300005434 Bacteria 728
41 Ga0070714_100022302 3300005435 Bacteria 5191
42 Ga0070714_100764360 3300005435 Bacteria 935
43 Ga0070713_101328556 3300005436 Bacteria 697
44 Ga0070713_101704262 3300005436 Unclassified 612
45 Ga0070710_10000008 3300005437 Bacteria 198148
46 Ga0070710_10037752 3300005437 Bacteria 2650
47 Ga0070710_10083974 3300005437 Unclassified 1865
48 Ga0070701_10174389 3300005438 Bacteria 1254
49 Ga0070711_100155062 3300005439 Bacteria 1731
50 Ga0070711_101108582 3300005439 Unclassified 682
51 Ga0070711_101259812 3300005439 Bacteria 641
52 Ga0070705_100000672 3300005440 Bacteria 19566
53 Ga0070700_100003076 3300005441 Bacteria 8556
54 Ga0070708_101433992 3300005445 Bacteria 644
55 Ga0070663_100099987 3300005455 Bacteria 2163
56 Ga0070678_100302542 3300005456 Unclassified 1359
57 Ga0070678_101234579 3300005456 Bacteria 694
58 Ga0070662_100032258 3300005457 Bacteria 3681
59 Ga0070681_10252251 3300005458 Bacteria 1677
60 Ga0070681_10989201 3300005458 Archaea 761
61 Ga0070685_10098642 3300005466 Bacteria 1780
62 Ga0070685_10244541 3300005466 Bacteria 1186
63 Ga0070707_100144558 3300005468 Bacteria 2315
64 Ga0070679_100449118 3300005530 Bacteria 1234
65 Ga0070679_100583151 3300005530 Bacteria 1062
66 Ga0070679_101178600 3300005530 Bacteria 711
67 Ga0070679_101840826 3300005530 Bacteria 554
68 Ga0070684_100163401 3300005535 Bacteria 2021
69 Ga0070684_100574782 3300005535 Bacteria 1047
70 Ga0070684_100765790 3300005535 Bacteria 901
71 Ga0070672_100197559 3300005543 Bacteria 1681
72 Ga0070686_100625536 3300005544 Bacteria 851
73 Ga0070686_100692156 3300005544 Bacteria 812
74 Ga0070665_100091723 3300005548 Bacteria 3043
75 Ga0070704_100435971 3300005549 Bacteria 1125
76 Ga0068855_100558006 3300005563 Bacteria 1239
77 Ga0070664_100536963 3300005564 Bacteria 1080
78 Ga0070664_100572651 3300005564 Bacteria 1046
79 Ga0068857_100075708 3300005577 Bacteria 3001
80 Ga0068857_100267992 3300005577 Bacteria 1569
81 Ga0068854_100144634 3300005578 Bacteria 1828
82 Ga0068856_100020785 3300005614 Bacteria 6380
83 Ga0068856_100563078 3300005614 Bacteria 1161
84 Ga0068856_100680071 3300005614 Bacteria 1050
85 Ga0070702_100021806 3300005615 Bacteria 3377
86 Ga0068852_100087150 3300005616 Bacteria 2785
87 Ga0068852_101458175 3300005616 Bacteria 707
88 Ga0068864_100725836 3300005618 Bacteria 972
89 Ga0068866_10066706 3300005718 Unclassified 1887
90 Ga0068861_100167093 3300005719 Bacteria 1820
91 Ga0068861_100991632 3300005719 Bacteria 801
92 Ga0068851_10060580 3300005834 Bacteria 1938
93 Ga0068851_10187658 3300005834 Bacteria 1148
94 Ga0068870_10428312 3300005840 Bacteria 867
95 Ga0068863_101386097 3300005841 Bacteria 711
96 Ga0068860_100375346 3300005843 Bacteria 1403
97 Ga0081455_10008319 3300005937 Bacteria 10809
98 Ga0081455_10092830 3300005937 Bacteria 2441
99 Ga0081540_1004173 3300005983 Bacteria 11118
100 Ga0081539_10007659 3300005985 Bacteria 9717
101 Ga0081539_10082721 3300005985 Bacteria 1682
102 Ga0070717_10000004 3300006028 Bacteria 365525
103 Ga0070717_10954532 3300006028 Bacteria 781
104 Ga0075432_10059069 3300006058 Bacteria 1363
105 Ga0070715_11031358 3300006163 Bacteria 514
106 Ga0070716_101519850 3300006173 Bacteria 548
107 Ga0070712_100000008 3300006175 Bacteria 149644
108 Ga0070712_100031283 3300006175 Bacteria 3584
109 Ga0070712_100190508 3300006175 Bacteria 1605
110 Ga0070712_101252477 3300006175 Unclassified 646
111 Ga0097621_100588395 3300006237 Bacteria 1016
112 Ga0068871_102124377 3300006358 Bacteria 535
113 Ga0075428_102426713 3300006844 Bacteria 538
114 Ga0075430_100002873 3300006846 Bacteria 14412
115 Ga0075431_100083633 3300006847 Bacteria 3295
116 Ga0075433_10045774 3300006852 Bacteria 3804
117 Ga0075434_100026628 3300006871 Bacteria 5667
118 Ga0075434_100415070 3300006871 Bacteria 1367
119 Ga0075429_100046787 3300006880 Bacteria 3764
120 Ga0068865_100115175 3300006881 Bacteria 1989
121 Ga0075435_101105893 3300007076 Bacteria 693
122 Ga0105240_10007645 3300009093 Bacteria 15655
123 Ga0105240_10112780 3300009093 Bacteria 3286
124 Ga0105240_10598127 3300009093 Bacteria 1215
125 Ga0111539_10105520 3300009094 Bacteria 3305
126 Ga0111539_10367904 3300009094 Bacteria 1673
127 Ga0111539_11326795 3300009094 Bacteria 835
128 Ga0105245_10006591 3300009098 Bacteria 10193
129 Ga0105245_10097986 3300009098 Bacteria 2709
130 Ga0105245_10576849 3300009098 Bacteria 1149
131 Ga0105245_10899125 3300009098 Bacteria 927
132 Ga0105245_11384834 3300009098 Bacteria 753
133 Ga0105247_10569664 3300009101 Bacteria 835
134 Ga0114129_11369610 3300009147 Bacteria 874
135 Ga0105243_10423616 3300009148 Bacteria 1242
136 Ga0105243_10700352 3300009148 Bacteria 987
137 Ga0105241_10128389 3300009174 Bacteria 2050
138 Ga0105242_11080562 3300009176 Bacteria 815
139 Ga0105248_10065118 3300009177 Bacteria 4091
140 Ga0105248_10266355 3300009177 Bacteria 1929
141 Ga0105237_10650610 3300009545 Bacteria 1061
142 Ga0105237_10675430 3300009545 Bacteria 1040
143 Ga0105238_10701518 3300009551 Bacteria 1024
144 Ga0105249_10994646 3300009553 Bacteria 907
145 Ga0105249_11508022 3300009553 Bacteria 745
146 Ga0105239_10042058 3300010375 Bacteria 5007
147 Ga0105239_10227359 3300010375 Bacteria 2093
148 Ga0105239_10377028 3300010375 Unclassified 1604
149 Ga0105239_10585561 3300010375 Bacteria 1272
150 Ga0105239_10767126 3300010375 Bacteria 1104
151 Ga0157322_1007991 3300012490 Bacteria 798
152 Ga0157369_10346602 3300013105 Bacteria 1543
153 Ga0157369_11068067 3300013105 Bacteria 826
154 Ga0157369_11372197 3300013105 Bacteria 720
155 Ga0157374_10039180 3300013296 Bacteria 4361
156 Ga0157374_10671169 3300013296 Bacteria 1049
157 Ga0157378_10170348 3300013297 Bacteria 2042
158 Ga0157378_10537119 3300013297 Bacteria 1173
159 Ga0157378_10737876 3300013297 Bacteria 1007
160 Ga0157378_12814262 3300013297 Bacteria 539
161 Ga0163162_10091804 3300013306 Bacteria 3120
162 Ga0163162_10594298 3300013306 Bacteria 1233
163 Ga0163162_11365603 3300013306 Bacteria 806
164 Ga0157372_10008742 3300013307 Bacteria 10752
165 Ga0157372_10617333 3300013307 Bacteria 1264
166 Ga0157372_10701359 3300013307 Bacteria 1178
167 Ga0157372_10821912 3300013307 Bacteria 1079
168 Ga0157372_11459464 3300013307 Unclassified 788
169 Ga0157375_11026411 3300013308 Bacteria 963
170 Ga0157375_11313413 3300013308 Bacteria 851
171 Ga0163163_10054198 3300014325 Bacteria 3961
172 Ga0163163_10228497 3300014325 Bacteria 1910
173 Ga0163163_10587441 3300014325 Bacteria 1177
174 Ga0163163_11106452 3300014325 Bacteria 855
175 Ga0157380_10403702 3300014326 Bacteria 1297
176 Ga0157380_10590885 3300014326 Bacteria 1097
177 Ga0157380_11069956 3300014326 Bacteria 844
178 Ga0157380_11652968 3300014326 Bacteria 697
179 Ga0182008_10453387 3300014497 Bacteria 698
180 Ga0182008_10833102 3300014497 Bacteria 538
181 Ga0157377_10024201 3300014745 Bacteria 3226
182 Ga0157377_10694981 3300014745 Bacteria 738
183 Ga0157379_10000487 3300014968 Bacteria 32201
184 Ga0157376_10014343 3300014969 Bacteria 5945
185 Ga0157376_10033638 3300014969 Bacteria 4129
186 Ga0157376_11398135 3300014969 Bacteria 731
187 Ga0157376_12760325 3300014969 Bacteria 531
188 Ga0182005_1261758 3300015265 Bacteria 538
189 Ga0163161_10117735 3300017792 Bacteria 1993
190 Ga0206356_10101599 3300020070 Bacteria 1081
191 Ga0206356_10158681 3300020070 Bacteria 555
192 Ga0206352_10927028 3300020078 Bacteria 767
193 Ga0206350_10920932 3300020080 Bacteria 701
194 Ga0206354_10680993 3300020081 Bacteria 529
195 Ga0206354_11048809 3300020081 Bacteria 532
196 Ga0206354_11561584 3300020081 Bacteria 952
197 Ga0206353_11118769 3300020082 Bacteria 750
198 Ga0206353_11364911 3300020082 Bacteria 684
199 Ga0206353_11473877 3300020082 Bacteria 1439
200 Ga0206353_11477553 3300020082 Bacteria 1286
201 Ga0206353_11867908 3300020082 Bacteria 867
202 Ga0213873_10132701 3300021358 Bacteria 739
203 Ga0213874_10002209 3300021377 Bacteria 4139
204 Ga0213874_10169425 3300021377 Unclassified 771
205 Ga0213876_10013700 3300021384 Bacteria 4298
206 Ga0213876_10036084 3300021384 Bacteria 2607
207 Ga0213876_10091881 3300021384 Bacteria 1607
208 Ga0213875_10008882 3300021388 Bacteria 5126
209 Ga0213875_10030530 3300021388 Bacteria 2550
210 Ga0224712_10448657 3300022467 Bacteria 619
211 Ga0224712_10536569 3300022467 Bacteria 568
212 Ga0224712_10544630 3300022467 Bacteria 564
213 Ga0207656_10162647 3300025321 Unclassified 1063
214 Ga0207653_10056992 3300025885 Unclassified 1311
215 Ga0207692_10000034 3300025898 Bacteria 45780
216 Ga0207692_10027926 3300025898 Bacteria 2663
217 Ga0207692_10040626 3300025898 Bacteria 2297
218 Ga0207692_10174716 3300025898 Bacteria 1247
219 Ga0207692_10403355 3300025898 Bacteria 853
220 Ga0207692_10426774 3300025898 Bacteria 831
221 Ga0207688_10001339 3300025901 Bacteria 12802
222 Ga0207685_10149367 3300025905 Unclassified 1056
223 Ga0207699_10099663 3300025906 Bacteria 1841
224 Ga0207643_10353797 3300025908 Bacteria 922
225 Ga0207705_10594399 3300025909 Bacteria 861
226 Ga0207654_10079134 3300025911 Bacteria 1974
227 Ga0207707_10093676 3300025912 Bacteria 2624
228 Ga0207695_10005084 3300025913 Bacteria 17633
229 Ga0207671_10042892 3300025914 Bacteria 3347
230 Ga0207671_10664013 3300025914 Bacteria 830
231 Ga0207693_10000002 3300025915 Bacteria 304011
232 Ga0207693_10011166 3300025915 Bacteria 7273
233 Ga0207693_10064775 3300025915 Bacteria 2862
234 Ga0207693_10822597 3300025915 Bacteria 715
235 Ga0207663_10004901 3300025916 Bacteria 6699
236 Ga0207663_10139485 3300025916 Bacteria 1687
237 Ga0207663_10297611 3300025916 Bacteria 1204
238 Ga0207663_10646045 3300025916 Bacteria 835
239 Ga0207663_11082142 3300025916 Bacteria 644
240 Ga0207657_10005964 3300025919 Bacteria 12677
241 Ga0207657_10152395 3300025919 Bacteria 1882
242 Ga0207657_10370482 3300025919 Bacteria 1128
243 Ga0207657_10622615 3300025919 Bacteria 841
244 Ga0207649_10049977 3300025920 Bacteria 2585
245 Ga0207649_11051495 3300025920 Bacteria 641
246 Ga0207649_11121593 3300025920 Bacteria 621
247 Ga0207652_10750527 3300025921 Bacteria 868
248 Ga0207652_11014785 3300025921 Bacteria 729
249 Ga0207659_10036621 3300025926 Bacteria 3400
250 Ga0207687_10053679 3300025927 Bacteria 2817
251 Ga0207687_10387561 3300025927 Bacteria 1146
252 Ga0207687_11392381 3300025927 Bacteria 603
253 Ga0207687_11673502 3300025927 Bacteria 546
254 Ga0207700_11283702 3300025928 Bacteria 652
255 Ga0207664_10000006 3300025929 Bacteria 408702
256 Ga0207664_10011196 3300025929 Bacteria 6361
257 Ga0207664_10258536 3300025929 Bacteria 1522
258 Ga0207664_11032147 3300025929 Bacteria 736
259 Ga0207664_11210544 3300025929 Bacteria 673
260 Ga0207664_11610765 3300025929 Bacteria 571
261 Ga0207644_10081260 3300025931 Bacteria 2395
262 Ga0207690_10000017 3300025932 Bacteria 243513
263 Ga0207690_10198866 3300025932 Bacteria 1521
264 Ga0207690_11110390 3300025932 Bacteria 659
265 Ga0207706_10071097 3300025933 Bacteria 3060
266 Ga0207706_10273707 3300025933 Bacteria 1473
267 Ga0207686_10921506 3300025934 Bacteria 706
268 Ga0207686_11299563 3300025934 Bacteria 597
269 Ga0207670_10690756 3300025936 Bacteria 844
270 Ga0207669_10054442 3300025937 Bacteria 2417
271 Ga0207704_10018097 3300025938 Bacteria 3670
272 Ga0207665_10211331 3300025939 Bacteria 1417
273 Ga0207691_10337024 3300025940 Bacteria 1291
274 Ga0207691_11130799 3300025940 Bacteria 651
275 Ga0207711_10095876 3300025941 Bacteria 2617
276 Ga0207711_10657735 3300025941 Bacteria 977
277 Ga0207689_10177076 3300025942 Bacteria 1759
278 Ga0207689_10251601 3300025942 Bacteria 1461
279 Ga0207661_10908270 3300025944 Bacteria 811
280 Ga0207679_10454393 3300025945 Bacteria 1137
281 Ga0207679_11177016 3300025945 Bacteria 703
282 Ga0207667_10495225 3300025949 Bacteria 1240
283 Ga0207667_10691583 3300025949 Bacteria 1023
284 Ga0207651_10457279 3300025960 Bacteria 1096
285 Ga0207651_10567056 3300025960 Bacteria 989
286 Ga0207668_10215881 3300025972 Bacteria 1537
287 Ga0207640_10138045 3300025981 Bacteria 1773
288 Ga0207677_10061899 3300026023 Bacteria 2594
289 Ga0207678_10040159 3300026067 Bacteria 4059
290 Ga0207678_10735007 3300026067 Bacteria 870
291 Ga0207708_10001261 3300026075 Bacteria 19065
292 Ga0207702_10050339 3300026078 Bacteria 3517
293 Ga0207702_10129046 3300026078 Bacteria 2273
294 Ga0207702_10132417 3300026078 Bacteria 2245
295 Ga0207641_12082520 3300026088 Bacteria 568
296 Ga0207648_10729879 3300026089 Bacteria 919
297 Ga0207676_10678429 3300026095 Bacteria 996
298 Ga0207674_10072347 3300026116 Bacteria 3464
299 Ga0207674_10176166 3300026116 Bacteria 2091
300 Ga0207675_100074936 3300026118 Bacteria 3167
301 Ga0207683_10176030 3300026121 Bacteria 1939
302 Ga0207698_10071476 3300026142 Bacteria 2754
303 Ga0207428_10257929 3300027907 Bacteria 1299
304 Ga0268266_10098051 3300028379 Bacteria 2579
305 Ga0268266_10503965 3300028379 Bacteria 1156
306 Ga0268264_10135004 3300028381 Bacteria 2192
307 Ga0268264_10244191 3300028381 Bacteria 1665
308 Ga0265337_1012393 3300028556 Bacteria 2900
309 Ga0265337_1083264 3300028556 Bacteria 874
310 Ga0265326_10000310 3300028558 Bacteria 21412
311 Ga0265319_1002084 3300028563 Bacteria 11220
312 Ga0265318_10005827 3300028577 Bacteria 5741
313 Ga0265322_10050448 3300028654 Bacteria 1181
314 Ga0265322_10140501 3300028654 Bacteria 690
315 Ga0265336_10000004 3300028666 Bacteria 418303
316 Ga0265338_10000012 3300028800 Bacteria 418599
317 Ga0265338_10063099 3300028800 Bacteria 3233
318 Ga0265324_10017557 3300029957 Bacteria 2602
319 Ga0265320_10019761 3300031240 Bacteria 3672
320 Ga0265340_10000001 3300031247 Bacteria 1647668
321 Ga0265331_10430770 3300031250 Bacteria 592
322 Ga0265327_10004953 3300031251 Bacteria 11447
323 Ga0265327_10132515 3300031251 Bacteria 1171
324 Ga0265316_10008873 3300031344 Bacteria 9286
325 Ga0265316_10048130 3300031344 Bacteria 3369
326 Ga0307408_100393073 3300031548 Bacteria 1189
327 Ga0265314_10031831 3300031711 Bacteria 3888
328 Ga0265314_10072187 3300031711 Bacteria 2307
329 Ga0307406_10641631 3300031901 Bacteria 880
330 Ga0307409_102573717 3300031995 Bacteria 537
331 Ga0307416_100857104 3300032002 Bacteria 1007
332 Ga0307416_100950772 3300032002 Bacteria 961
333 Ga0307415_100073302 3300032126 Bacteria 2415
334 Ga0307415_100968016 3300032126 Bacteria 789
335 Ga0373962_0106543 3300035242 Bacteria 880
336 Ga0373935_0519707 3300035692 Bacteria 866
337 Ga0265778_045165 3300036457 Bacteria 594
338 Ga0395899_0189246 3300037312 Bacteria 1441
339 Ga0395900_0084021 3300037418 Bacteria 3271
340 Ga0395900_0122633 3300037418 Bacteria 2666
341 Ga0395900_0946404 3300037418 Bacteria 783
342 Ga0395900_0982323 3300037418 Bacteria 765
343 Ga0395900_1078429 3300037418 Bacteria 721
344 Ga0395900_1223319 3300037418 Bacteria 666
345 Ga0395898_0086730 3300037466 Bacteria 3016
346 Ga0395898_0160642 3300037466 Bacteria 2149
347 Ga0395898_0233696 3300037466 Bacteria 1753
348 Ga0395898_0247248 3300037466 Bacteria 1701
349 Ga0395898_0377603 3300037466 Bacteria 1352
350 Ga0395898_0450523 3300037466 Unclassified 1226
351 Ga0395905_0229515 3300037471 Bacteria 1736
352 Ga0395905_0338718 3300037471 Bacteria 1395
353 Ga0436364_0329358 3300037853 Bacteria 14756
354 Ga0436364_0609270 3300037853 Bacteria 12154
355 Ga0436364_0796475 3300037853 Bacteria 1102
356 Ga0436364_1012143 3300037853 Unclassified 668
357 Ga0436364_1218841 3300037853 Bacteria 10852
358 Ga0395901_0004053 3300038443 Bacteria 14750
359 Ga0395901_0085916 3300038443 Bacteria 3289
360 Ga0395901_0100846 3300038443 Bacteria 3029
361 Ga0395901_0357708 3300038443 Bacteria 1506
362 Ga0395901_1040896 3300038443 Unclassified 792
363 Ga0395901_1084100 3300038443 Bacteria 772
364 Ga0395901_1216940 3300038443 Bacteria 718
365 Ga0395901_1385755 3300038443 Bacteria 662
366 Ga0436365_0561077 3300039437 Bacteria 806
367 Ga0436365_0705902 3300039437 Bacteria 13387
368 Ga0436365_0889001 3300039437 Bacteria 2852
369 Ga0436365_0999899 3300039437 Bacteria 2415
370 Ga0436365_1109639 3300039437 Bacteria 1053
371 Ga0436365_1213556 3300039437 Bacteria 2407
372 Ga0436365_1246407 3300039437 Bacteria 1573
373 Ga0436365_1821223 3300039437 Bacteria 2662
374 Ga0436363_0484789 3300039450 Unclassified 1048
375 Ga0436363_0537896 3300039450 Bacteria 1198
376 Ga0436363_0613327 3300039450 Bacteria 907
377 Ga0436363_0712334 3300039450 Bacteria 4665
378 Ga0436363_1475091 3300039450 Bacteria 1785
379 Ga0436363_1627320 3300039450 Bacteria 6919
380 Ga0436362_0104098 3300039453 Bacteria 1940
381 Ga0436362_0226952 3300039453 Bacteria 625
382 Ga0436362_0267224 3300039453 Bacteria 1422
383 Ga0436362_0670333 3300039453 Bacteria 2338
384 Ga0436362_0961579 3300039453 Bacteria 1559
385 Ga0451791_0001963 3300041451 Bacteria 1116
386 Ga0451797_0669698 3300041453 Bacteria 780
387 Ga0451802_1928281 3300041460 Bacteria 595
388 Ga0451833_0906112 3300041491 Bacteria 548
389 Ga0451835_0043310 3300041492 Bacteria 765
390 Ga0451843_0633562 3300041509 Bacteria 648
391 Ga0439463_084049 3300042016 Bacteria 819
392 Ga0439459_0062036 3300042438 Bacteria 847
393 Ga0466972_0213047 3300044658 Bacteria 904
394 Ga0466972_0360437 3300044658 Bacteria 680
395 Ga0466966_0099819 3300044684 Bacteria 1796
396 Ga0466966_0259522 3300044684 Bacteria 1046
397 Ga0466966_0354980 3300044684 Bacteria 881
398 Ga0466961_0087252 3300044693 Bacteria 1972
399 Ga0466961_0159644 3300044693 Bacteria 1405
400 Ga0466963_0060540 3300044694 Bacteria 2529
401 Ga0466963_0101181 3300044694 Bacteria 1973
402 Ga0466963_0275139 3300044694 Bacteria 1183
403 Ga0466963_0282802 3300044694 Bacteria 1166
404 Ga0466964_0289310 3300044706 Bacteria 822
405 Ga0466968_0112550 3300044735 Bacteria 1225
406 Ga0466968_0171883 3300044735 Bacteria 1004
407 Ga0466968_0362065 3300044735 Bacteria 706
408 Ga0466968_0398273 3300044735 Bacteria 675
409 Ga0466970_0138781 3300044765 Bacteria 1338
410 Ga0466957_0055331 3300044842 Bacteria 2425
411 Ga0466957_0069088 3300044842 Bacteria 2182
412 Ga0466957_0142504 3300044842 Bacteria 1545
413 Ga0466957_0259328 3300044842 Bacteria 1158
414 Ga0466957_0942431 3300044842 Bacteria 618
415 Ga0466957_1151146 3300044842 Bacteria 560
416 Ga0466960_0000024 3300044901 Bacteria 53231
417 Ga0466960_0015842 3300044901 Bacteria 3259
418 Ga0466960_0094679 3300044901 Bacteria 1528
419 Ga0466960_0109048 3300044901 Bacteria 1436
420 Ga0466960_0272563 3300044901 Bacteria 946
421 Ga0466959_0138015 3300045049 Bacteria 1725
422 Ga0466959_0366815 3300045049 Bacteria 981
423 Ga0466959_0393138 3300045049 Bacteria 943
424 Ga0466959_0689193 3300045049 Bacteria 685
425 Ga0466958_0049004 3300045836 Bacteria 2555
426 Ga0466958_0072458 3300045836 Bacteria 2110
427 Ga0466958_0150103 3300045836 Bacteria 1470
428 Ga0466958_0182902 3300045836 Bacteria 1330
429 Ga0466958_0205866 3300045836 Bacteria 1253
430 Ga0466958_0396222 3300045836 Bacteria 891
431 Ga0466958_0500207 3300045836 Bacteria 789
432 Ga0466958_0831583 3300045836 Bacteria 602
433 Ga0466967_0224753 3300045976 Bacteria 1785
434 Ga0466967_0242089 3300045976 Bacteria 1721
435 Ga0466967_0359103 3300045976 Bacteria 1411
436 Ga0466967_0420437 3300045976 Bacteria 1303
437 Ga0466967_2383201 3300045976 Bacteria 525
438 Ga0495590_0029636 3300046457 Bacteria 1918
439 Ga0495641_0025560 3300046461 Bacteria 2898
440 Ga0495653_0000499 3300046463 Bacteria 30327
441 Ga0495650_0000035 3300046471 Bacteria 403799
442 Ga0495594_0321849 3300046499 Bacteria 881
443 Ga0495596_0109442 3300046500 Bacteria 1073
444 Ga0495608_0155495 3300046511 Bacteria 1456
445 Ga0495618_0000030 3300046514 Bacteria 108007
446 Ga0495630_0000627 3300046517 Bacteria 25585
447 Ga0495630_0699127 3300046517 Bacteria 776
448 Ga0495631_0128778 3300046518 Bacteria 1088
449 Ga0495644_0065188 3300046523 Bacteria 1369
450 Ga0495663_0405997 3300046525 Bacteria 501
451 Ga0495654_0355016 3300046530 Bacteria 589
452 Ga0495586_0396002 3300046535 Bacteria 795
453 Ga0495609_0209430 3300046538 Bacteria 813
454 Ga0495621_0201042 3300046539 Bacteria 802
455 Ga0495645_0000098 3300046543 Bacteria 59944
456 Ga0495645_0000138 3300046543 Bacteria 49585
457 Ga0495667_0191052 3300046559 Bacteria 1312
458 Ga0495656_0058246 3300046615 Bacteria 1676
459 Ga0495657_0000017 3300046675 Bacteria 174558
460 Ga0495599_0454771 3300046678 Bacteria 758
461 Ga0495623_0092703 3300046679 Bacteria 1851
462 Ga0495646_0078666 3300046680 Bacteria 1927
463 Ga0495646_0179656 3300046680 Unclassified 1162
464 Ga0495647_0073159 3300046681 Bacteria 1376
465 Ga0495658_0182636 3300046683 Bacteria 1302
466 Ga0495670_0160176 3300046691 Bacteria 1182
467 Ga0495589_0400654 3300046794 Bacteria 630
468 Ga0495589_0489772 3300046794 Bacteria 562
469 Ga0495600_0013762 3300046809 Bacteria 5094
470 Ga0495604_0000102 3300047317 Bacteria 71652
471 Ga0495604_0157124 3300047317 Bacteria 1610
472 Ga0495674_1115027 3300047319 Bacteria 600
473 Ga0495672_0003107 3300047320 Bacteria 14497
474 Ga0495680_0563021 3300047322 Bacteria 766
475 Ga0495677_0140583 3300047445 Bacteria 927
476 Ga0495685_266379 3300047447 Bacteria 542
477 Ga0495686_0295382 3300047472 Bacteria 896
478 Ga0495626_0158911 3300048091 Bacteria 949
479 Ga0496100_0033594 3300048903 Bacteria 3211
480 Ga0496100_0157507 3300048903 Bacteria 1625
481 Ga0496100_1009185 3300048903 Bacteria 655
482 Ga0496101_0001652 3300048904 Bacteria 13374
483 Ga0496101_0044196 3300048904 Bacteria 3187
484 Ga0496101_0051818 3300048904 Bacteria 2958
485 Ga0496101_0449672 3300048904 Bacteria 1016
486 Ga0496102_0018229 3300048905 Bacteria 6164
487 Ga0496102_0043979 3300048905 Bacteria 4051
488 Ga0496102_0140336 3300048905 Bacteria 2265
489 Ga0496102_0292648 3300048905 Bacteria 1535
490 Ga0496102_0977957 3300048905 Bacteria 767
491 Ga0496103_0026004 3300048906 Bacteria 3541
492 Ga0496103_0342350 3300048906 Bacteria 962
493 Ga0496103_0399008 3300048906 Bacteria 883
494 Ga0496103_0587724 3300048906 Bacteria 710
495 Ga0496104_0000093 3300048907 Bacteria 87156
496 Ga0496104_0002732 3300048907 Bacteria 15183
497 Ga0496104_0142061 3300048907 Bacteria 2306
498 Ga0496104_0197880 3300048907 Bacteria 1921
499 Ga0496104_0803300 3300048907 Bacteria 847
500 Ga0496104_1183511 3300048907 Bacteria 668
501 Ga0496105_0072630 3300048908 Bacteria 2843
502 Ga0496105_0075266 3300048908 Bacteria 2788
503 Ga0496105_0311233 3300048908 Bacteria 1264
504 Ga0496106_0034464 3300048909 Bacteria 3781
505 Ga0496106_0191672 3300048909 Bacteria 1625
506 Ga0496106_0432212 3300048909 Bacteria 1058
507 Ga0496107_0009709 3300048910 Bacteria 6673
508 Ga0496107_0095496 3300048910 Bacteria 2175
509 Ga0496107_0982375 3300048910 Bacteria 613
510 Ga0496108_0000712 3300048911 Bacteria 25838
511 Ga0496108_0004745 3300048911 Bacteria 10958
512 Ga0496108_0029433 3300048911 Bacteria 4548
513 Ga0496108_0258549 3300048911 Bacteria 1515
514 Ga0496108_0300516 3300048911 Bacteria 1398
515 Ga0496109_0002857 3300048912 Bacteria 14454
516 Ga0496109_0032613 3300048912 Bacteria 4683
517 Ga0496109_0075725 3300048912 Bacteria 3094
518 Ga0496109_0124143 3300048912 Bacteria 2406
519 Ga0496109_0433482 3300048912 Bacteria 1242
520 Ga0496110_0000291 3300048913 Bacteria 32902
521 Ga0496110_0000358 3300048913 Bacteria 30516
522 Ga0496110_0001659 3300048913 Bacteria 16316
523 Ga0496110_0276652 3300048913 Bacteria 1528
524 Ga0496110_0306972 3300048913 Bacteria 1445
525 Ga0496110_0497873 3300048913 Bacteria 1110
526 Ga0496111_0000033 3300048914 Bacteria 55040
527 Ga0496111_0010411 3300048914 Bacteria 6240
528 Ga0496111_0021775 3300048914 Bacteria 4479
529 Ga0496111_0131442 3300048914 Bacteria 1852
530 Ga0496111_0274110 3300048914 Bacteria 1251
531 Ga0496112_0000173 3300048915 Bacteria 41090
532 Ga0496112_0016208 3300048915 Bacteria 6972
533 Ga0496112_0020849 3300048915 Bacteria 6220
534 Ga0496112_0026391 3300048915 Bacteria 5588
535 Ga0496112_0032129 3300048915 Bacteria 5095
536 Ga0496112_0044051 3300048915 Bacteria 4370
537 Ga0496112_0133498 3300048915 Bacteria 2453
538 Ga0496112_0251856 3300048915 Bacteria 1717
539 Ga0496113_0016680 3300048916 Bacteria 5079
540 Ga0496113_0029015 3300048916 Bacteria 3988
541 Ga0496113_0033435 3300048916 Bacteria 3744
542 Ga0496113_0081097 3300048916 Bacteria 2486
543 Ga0496113_0094304 3300048916 Bacteria 2312
544 Ga0496114_0262366 3300048917 Bacteria 1521
545 Ga0496114_0330741 3300048917 Bacteria 1347
546 Ga0496114_0503106 3300048917 Bacteria 1072
547 Ga0496114_0507730 3300048917 Bacteria 1066
548 Ga0496114_0676959 3300048917 Bacteria 906
549 Ga0496115_0006172 3300048918 Bacteria 8764
550 Ga0496115_0062284 3300048918 Bacteria 3009
551 Ga0496115_0405557 3300048918 Bacteria 1106
552 Ga0496119_0260064 3300048922 Bacteria 871
553 Ga0496121_0034885 3300048924 Bacteria 4518
554 Ga0496123_0231911 3300048926 Bacteria 923
555 Ga0496125_0271943 3300048928 Bacteria 1055
556 Ga0501031_0028269 3300049568 Bacteria 3655
557 Ga0501032_0039289 3300049569 Bacteria 3219
558 Ga0501033_0041001 3300049570 Bacteria 3455
559 Ga0501034_0067114 3300049571 Bacteria 3600
560 Ga0501034_0082769 3300049571 Bacteria 3211
561 Ga0501036_0121015 3300049572 Bacteria 2210
562 Ga0501037_0016364 3300049573 Bacteria 5457
563 Ga0501038_0004424 3300049574 Bacteria 13076
564 Ga0501039_0047066 3300049575 Bacteria 3333
565 Ga0501042_0024897 3300049578 Bacteria 4201
566 Ga0501046_0118476 3300049580 Bacteria 2016
567 Ga0501047_0089863 3300049581 Bacteria 2948
568 Ga0501048_0003039 3300049582 Bacteria 12808
569 Ga0501067_0058156 3300049583 Bacteria 2141
570 Ga0501067_0695206 3300049583 Bacteria 571
571 Ga0501068_0007611 3300049584 Bacteria 5994
572 Ga0501068_0864178 3300049584 Bacteria 594
573 Ga0501068_0936441 3300049584 Bacteria 570
574 Ga0501069_0008115 3300049585 Bacteria 5517
575 Ga0501069_0054166 3300049585 Bacteria 2235
576 Ga0501070_0025893 3300049586 Bacteria 4921
577 Ga0501071_1100715 3300049587 Bacteria 614
578 Ga0501073_0016890 3300049589 Bacteria 5285
579 Ga0501074_0096048 3300049590 Bacteria 2122
580 Ga0501074_0213468 3300049590 Bacteria 1374
581 Ga0501076_0168114 3300049592 Bacteria 1787
582 Ga0501080_0028739 3300049742 Bacteria 5176
583 Ga0501080_0029673 3300049742 Bacteria 5090
584 Ga0501083_0096713 3300049744 Bacteria 1948
585 Ga0501035_0021932 3300049822 Bacteria 5867
586 Ga0501044_0158149 3300049823 Bacteria 2244
587 Ga0501044_1104124 3300049823 Unclassified 662
588 Ga0501044_1258683 3300049823 Bacteria 607
589 nmdc:mga05p37_1326535_c1 3300050507 Bacteria 731
590 nmdc:mga09592_25633_c1 3300050508 Bacteria 4882
591 nmdc:mga0qj67_5048_c1 3300050509 Bacteria 9597
592 nmdc:mga06r32_53522_c2 3300050510 Bacteria 2225
593 nmdc:mga08y16_18110_c1 3300050511 Bacteria 7419
594 nmdc:mga08y16_307053_c1 3300050511 Bacteria 1634
595 nmdc:mga0n895_35367_c1 3300050512 Bacteria 4816
596 nmdc:mga0n895_791880_c1 3300050512 Bacteria 939
597 nmdc:mga0rr50_180188_c1 3300050513 Bacteria 1727
598 nmdc:mga0rr50_636955_c1 3300050513 Bacteria 909
599 nmdc:mga08x19_657010_c1 3300050514 Bacteria 744
600 Ga0495601_0003968 3300053077 Bacteria 8518
601 Ga0495612_0000212 3300053078 Bacteria 24569
602 Ga0495655_0194505 3300053083 Bacteria 660
603 Ga0495619_0085415 3300053085 Bacteria 2131
604 Ga0500641_0285532 3300053096 Bacteria 682
605 Ga0500556_0001386 3300053104 Bacteria 10580
606 Ga0500616_0005748 3300053153 Bacteria 8338
607 Ga0500616_0013284 3300053153 Bacteria 4788
608 Ga0500599_007905 3300053736 Bacteria 1374
609 Ga0501084_0117593 3300054114 Bacteria 2235
610 Ga0587083_0117723 3300059505 Bacteria 683
611 Ga0587091_106863 3300059511 Bacteria 663
612 Ga0587102_021631 3300059649 Bacteria 730
613 Ga0501082_0026301 3300060353 Bacteria 5014
614 Ga0501082_1199622 3300060353 Bacteria 663
615 Ga0466962_0147670 3300061719 Bacteria 1140
616 Ga0466962_0213000 3300061719 Bacteria 945

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006237 Ga0097621_100588395 Ga0097621_1005883952 119
2 3300005719 Ga0068861_100991632 Ga0068861_1009916322 129
3 3300009098 Ga0105245_11384834 Ga0105245_113848342 129
4 3300026118 Ga0207675_100074936 Ga0207675_1000749363 129
5 3300044694 Ga0466963_0101181 Ga0466963_0101181_94_510 129
6 3300005543 Ga0070672_100197559 Ga0070672_1001975592 130
7 3300005578 Ga0068854_100144634 Ga0068854_1001446342 130
8 3300013296 Ga0157374_10671169 Ga0157374_106711692 130
9 3300022467 Ga0224712_10536569 Ga0224712_105365691 130
10 3300025932 Ga0207690_10198866 Ga0207690_101988663 130
11 3300025933 Ga0207706_10273707 Ga0207706_102737072 130
12 3300025940 Ga0207691_10337024 Ga0207691_103370242 130
13 3300025960 Ga0207651_10567056 Ga0207651_105670562 130
14 3300041453 Ga0451797_0669698 Ga0451797_0669698_246_638 130
15 3300044693 Ga0466961_0087252 Ga0466961_0087252_1357_1797 130
16 3300044735 Ga0466968_0398273 Ga0466968_0398273_233_625 130
17 3300044842 Ga0466957_0055331 Ga0466957_0055331_880_1320 130
18 3300045049 Ga0466959_0393138 Ga0466959_0393138_486_926 130
19 3300045836 Ga0466958_0831583 Ga0466958_0831583_136_576 130
20 3300045976 Ga0466967_0224753 Ga0466967_0224753_872_1309 130
21 3300045976 Ga0466967_0359103 Ga0466967_0359103_850_1290 130
22 3300046500 Ga0495596_0109442 Ga0495596_0109442_632_1024 130
23 3300048906 Ga0496103_0342350 Ga0496103_0342350_476_925 130
24 3300048907 Ga0496104_1183511 Ga0496104_1183511_231_623 130
25 3300049823 Ga0501044_1104124 Ga0501044_1104124_11_403 130
26 3300061719 Ga0466962_0147670 Ga0466962_0147670_66_506 130
27 3300005336 Ga0070680_100789632 Ga0070680_1007896322 131
28 3300005337 Ga0070682_100041971 Ga0070682_1000419712 131
29 3300005345 Ga0070692_10274015 Ga0070692_102740152 131
30 3300005353 Ga0070669_100019081 Ga0070669_1000190818 131
31 3300005366 Ga0070659_100000077 Ga0070659_10000007744 131
32 3300005435 Ga0070714_100022302 Ga0070714_1000223026 131
33 3300005437 Ga0070710_10000008 Ga0070710_1000000819 131
34 3300005440 Ga0070705_100000672 Ga0070705_10000067214 131
35 3300005458 Ga0070681_10252251 Ga0070681_102522513 131
36 3300006028 Ga0070717_10000004 Ga0070717_10000004169 131
37 3300006175 Ga0070712_100000008 Ga0070712_100000008138 131
38 3300006880 Ga0075429_100046787 Ga0075429_1000467876 131
39 3300009093 Ga0105240_10112780 Ga0105240_101127806 131
40 3300009148 Ga0105243_10423616 Ga0105243_104236162 131
41 3300010375 Ga0105239_10042058 Ga0105239_100420587 131
42 3300013297 Ga0157378_12814262 Ga0157378_128142621 131
43 3300013306 Ga0163162_11365603 Ga0163162_113656031 131
44 3300014969 Ga0157376_10014343 Ga0157376_100143438 131
45 3300020082 Ga0206353_11364911 Ga0206353_113649111 131
46 3300025898 Ga0207692_10000034 Ga0207692_1000003419 131
47 3300025912 Ga0207707_10093676 Ga0207707_100936763 131
48 3300025915 Ga0207693_10000002 Ga0207693_10000002203 131
49 3300025929 Ga0207664_10000006 Ga0207664_10000006229 131
50 3300025929 Ga0207664_10011196 Ga0207664_100111967 131
51 3300025929 Ga0207664_11610765 Ga0207664_116107652 131
52 3300025932 Ga0207690_10000017 Ga0207690_1000001786 131
53 3300044765 Ga0466970_0138781 Ga0466970_0138781_577_984 131
54 3300045049 Ga0466959_0138015 Ga0466959_0138015_711_1118 131
55 3300047320 Ga0495672_0003107 Ga0495672_0003107_13468_13863 131
56 3300048904 Ga0496101_0001652 Ga0496101_0001652_3785_4216 131
57 3300048912 Ga0496109_0032613 Ga0496109_0032613_3815_4219 131
58 3300048913 Ga0496110_0306972 Ga0496110_0306972_415_813 131
59 3300048914 Ga0496111_0274110 Ga0496111_0274110_453_851 131
60 3300048915 Ga0496112_0000173 Ga0496112_0000173_27035_27439 131
61 3300048916 Ga0496113_0033435 Ga0496113_0033435_536_934 131
62 3300048928 Ga0496125_0271943 Ga0496125_0271943_263_670 131
63 3300049592 Ga0501076_0168114 Ga0501076_0168114_101_496 131
64 3300049823 Ga0501044_1258683 Ga0501044_1258683_120_515 131
65 3300050508 nmdc:mga09592_25633_c1 nmdc:mga09592_25633_c1_1589_1987 131
66 3300005437 Ga0070710_10037752 Ga0070710_100377522 132
67 3300005439 Ga0070711_100155062 Ga0070711_1001550622 132
68 3300006175 Ga0070712_100190508 Ga0070712_1001905082 132
69 3300006846 Ga0075430_100002873 Ga0075430_10000287315 132
70 3300025898 Ga0207692_10426774 Ga0207692_104267741 132
71 3300025915 Ga0207693_10064775 Ga0207693_100647752 132
72 3300025929 Ga0207664_11032147 Ga0207664_110321472 132
73 3300039437 Ga0436365_1109639 Ga0436365_1109639_525_941 132
74 3300044735 Ga0466968_0112550 Ga0466968_0112550_448_858 132
75 3300050509 nmdc:mga0qj67_5048_c1 nmdc:mga0qj67_5048_c1_5982_6386 132
76 3300005336 Ga0070680_100566338 Ga0070680_1005663382 133
77 3300005339 Ga0070660_100547721 Ga0070660_1005477212 133
78 3300005435 Ga0070714_100764360 Ga0070714_1007643602 133
79 3300005436 Ga0070713_101328556 Ga0070713_1013285561 133
80 3300005436 Ga0070713_101704262 Ga0070713_1017042622 133
81 3300005458 Ga0070681_10989201 Ga0070681_109892011 133
82 3300005468 Ga0070707_100144558 Ga0070707_1001445582 133
83 3300005530 Ga0070679_101178600 Ga0070679_1011786002 133
84 3300005530 Ga0070679_101840826 Ga0070679_1018408261 133
85 3300006175 Ga0070712_100031283 Ga0070712_1000312833 133
86 3300006175 Ga0070712_101252477 Ga0070712_1012524771 133
87 3300006871 Ga0075434_100415070 Ga0075434_1004150702 133
88 3300009093 Ga0105240_10007645 Ga0105240_100076457 133
89 3300009147 Ga0114129_11369610 Ga0114129_113696102 133
90 3300009174 Ga0105241_10128389 Ga0105241_101283893 133
91 3300013307 Ga0157372_11459464 Ga0157372_114594641 133
92 3300020070 Ga0206356_10101599 Ga0206356_101015992 133
93 3300020070 Ga0206356_10158681 Ga0206356_101586812 133
94 3300020078 Ga0206352_10927028 Ga0206352_109270281 133
95 3300020081 Ga0206354_11561584 Ga0206354_115615842 133
96 3300020082 Ga0206353_11867908 Ga0206353_118679082 133
97 3300025898 Ga0207692_10040626 Ga0207692_100406262 133
98 3300025898 Ga0207692_10403355 Ga0207692_104033552 133
99 3300025905 Ga0207685_10149367 Ga0207685_101493671 133
100 3300025911 Ga0207654_10079134 Ga0207654_100791342 133
101 3300025913 Ga0207695_10005084 Ga0207695_100050849 133
102 3300025915 Ga0207693_10011166 Ga0207693_100111664 133
103 3300025915 Ga0207693_10822597 Ga0207693_108225972 133
104 3300025916 Ga0207663_10004901 Ga0207663_100049013 133
105 3300025916 Ga0207663_10139485 Ga0207663_101394853 133
106 3300025916 Ga0207663_10297611 Ga0207663_102976112 133
107 3300025916 Ga0207663_10646045 Ga0207663_106460452 133
108 3300025928 Ga0207700_11283702 Ga0207700_112837021 133
109 3300025929 Ga0207664_10258536 Ga0207664_102585362 133
110 3300025929 Ga0207664_11210544 Ga0207664_112105442 133
111 3300025939 Ga0207665_10211331 Ga0207665_102113312 133
112 3300026078 Ga0207702_10129046 Ga0207702_101290462 133
113 3300028556 Ga0265337_1012393 Ga0265337_10123933 133
114 3300028556 Ga0265337_1083264 Ga0265337_10832642 133
115 3300028558 Ga0265326_10000310 Ga0265326_100003108 133
116 3300028563 Ga0265319_1002084 Ga0265319_10020849 133
117 3300028654 Ga0265322_10050448 Ga0265322_100504482 133
118 3300028654 Ga0265322_10140501 Ga0265322_101405011 133
119 3300028666 Ga0265336_10000004 Ga0265336_10000004264 133
120 3300028800 Ga0265338_10000012 Ga0265338_10000012163 133
121 3300029957 Ga0265324_10017557 Ga0265324_100175572 133
122 3300031247 Ga0265340_10000001 Ga0265340_100000011465 133
123 3300031251 Ga0265327_10004953 Ga0265327_100049536 133
124 3300031251 Ga0265327_10132515 Ga0265327_101325151 133
125 3300031344 Ga0265316_10008873 Ga0265316_1000887310 133
126 3300031711 Ga0265314_10072187 Ga0265314_100721874 133
127 3300036457 Ga0265778_045165 Ga0265778_045165_90_497 133
128 3300039450 Ga0436363_0613327 Ga0436363_0613327_418_828 133
129 3300039453 Ga0436362_0267224 Ga0436362_0267224_794_1204 133
130 3300044684 Ga0466966_0099819 Ga0466966_0099819_1306_1719 133
131 3300044693 Ga0466961_0159644 Ga0466961_0159644_764_1165 133
132 3300046463 Ga0495653_0000499 Ga0495653_0000499_18416_18844 133
133 3300046511 Ga0495608_0155495 Ga0495608_0155495_385_792 133
134 3300046514 Ga0495618_0000030 Ga0495618_0000030_105804_106211 133
135 3300046517 Ga0495630_0000627 Ga0495630_0000627_16326_16733 133
136 3300046523 Ga0495644_0065188 Ga0495644_0065188_42_449 133
137 3300046543 Ga0495645_0000098 Ga0495645_0000098_43297_43704 133
138 3300046543 Ga0495645_0000138 Ga0495645_0000138_17007_17444 133
139 3300046675 Ga0495657_0000017 Ga0495657_0000017_9157_9564 133
140 3300046679 Ga0495623_0092703 Ga0495623_0092703_1112_1555 133
141 3300046680 Ga0495646_0078666 Ga0495646_0078666_463_870 133
142 3300046680 Ga0495646_0179656 Ga0495646_0179656_473_880 133
143 3300046681 Ga0495647_0073159 Ga0495647_0073159_344_751 133
144 3300046809 Ga0495600_0013762 Ga0495600_0013762_3171_3578 133
145 3300047317 Ga0495604_0000102 Ga0495604_0000102_56729_57136 133
146 3300047319 Ga0495674_1115027 Ga0495674_1115027_177_584 133
147 3300047447 Ga0495685_266379 Ga0495685_266379_33_434 133
148 3300048903 Ga0496100_1009185 Ga0496100_1009185_115_522 133
149 3300048907 Ga0496104_0000093 Ga0496104_0000093_64501_64908 133
150 3300048913 Ga0496110_0000291 Ga0496110_0000291_9391_9798 133
151 3300048914 Ga0496111_0000033 Ga0496111_0000033_16843_17250 133
152 3300050507 nmdc:mga05p37_1326535_c1 nmdc:mga05p37_1326535_c1_93_500 133
153 3300050512 nmdc:mga0n895_791880_c1 nmdc:mga0n895_791880_c1_22_429 133
154 3300053077 Ga0495601_0003968 Ga0495601_0003968_2101_2508 133
155 3300053078 Ga0495612_0000212 Ga0495612_0000212_8702_9109 133
156 3300053083 Ga0495655_0194505 Ga0495655_0194505_23_463 133
157 3300053085 Ga0495619_0085415 Ga0495619_0085415_1130_1537 133
158 3300059505 Ga0587083_0117723 Ga0587083_0117723_160_597 133
159 3300059511 Ga0587091_106863 Ga0587091_106863_154_591 133
160 3300059649 Ga0587102_021631 Ga0587102_021631_228_665 133
161 3300000549 LJQas_1020692 LJQas_10206922 134
162 3300005329 Ga0070683_100001798 Ga0070683_10000179817 134
163 3300005329 Ga0070683_100373327 Ga0070683_1003733272 134
164 3300005330 Ga0070690_100344330 Ga0070690_1003443302 134
165 3300005334 Ga0068869_100051454 Ga0068869_1000514542 134
166 3300005334 Ga0068869_100757719 Ga0068869_1007577192 134
167 3300005336 Ga0070680_100337163 Ga0070680_1003371632 134
168 3300005337 Ga0070682_100009060 Ga0070682_1000090607 134
169 3300005337 Ga0070682_100715011 Ga0070682_1007150112 134
170 3300005338 Ga0068868_100008651 Ga0068868_1000086517 134
171 3300005338 Ga0068868_100332540 Ga0068868_1003325402 134
172 3300005338 Ga0068868_100724343 Ga0068868_1007243432 134
173 3300005339 Ga0070660_100177501 Ga0070660_1001775012 134
174 3300005339 Ga0070660_100184302 Ga0070660_1001843023 134
175 3300005339 Ga0070660_101331383 Ga0070660_1013313832 134
176 3300005340 Ga0070689_100144614 Ga0070689_1001446142 134
177 3300005341 Ga0070691_10020996 Ga0070691_100209963 134
178 3300005344 Ga0070661_100072394 Ga0070661_1000723942 134
179 3300005344 Ga0070661_100456057 Ga0070661_1004560571 134
180 3300005345 Ga0070692_10092109 Ga0070692_100921092 134
181 3300005347 Ga0070668_100287799 Ga0070668_1002877992 134
182 3300005347 Ga0070668_100469898 Ga0070668_1004698981 134
183 3300005354 Ga0070675_100034760 Ga0070675_1000347604 134
184 3300005355 Ga0070671_100264832 Ga0070671_1002648321 134
185 3300005355 Ga0070671_101301640 Ga0070671_1013016402 134
186 3300005356 Ga0070674_100082894 Ga0070674_1000828943 134
187 3300005364 Ga0070673_100306157 Ga0070673_1003061572 134
188 3300005365 Ga0070688_100133986 Ga0070688_1001339862 134
189 3300005365 Ga0070688_100486115 Ga0070688_1004861152 134
190 3300005366 Ga0070659_100110662 Ga0070659_1001106622 134
191 3300005367 Ga0070667_100594130 Ga0070667_1005941302 134
192 3300005434 Ga0070709_10291791 Ga0070709_102917912 134
193 3300005434 Ga0070709_10827507 Ga0070709_108275072 134
194 3300005437 Ga0070710_10083974 Ga0070710_100839742 134
195 3300005438 Ga0070701_10174389 Ga0070701_101743892 134
196 3300005439 Ga0070711_101108582 Ga0070711_1011085821 134
197 3300005439 Ga0070711_101259812 Ga0070711_1012598121 134
198 3300005441 Ga0070700_100003076 Ga0070700_1000030769 134
199 3300005445 Ga0070708_101433992 Ga0070708_1014339922 134
200 3300005455 Ga0070663_100099987 Ga0070663_1000999872 134
201 3300005456 Ga0070678_100302542 Ga0070678_1003025422 134
202 3300005456 Ga0070678_101234579 Ga0070678_1012345791 134
203 3300005457 Ga0070662_100032258 Ga0070662_1000322582 134
204 3300005466 Ga0070685_10098642 Ga0070685_100986422 134
205 3300005466 Ga0070685_10244541 Ga0070685_102445411 134
206 3300005530 Ga0070679_100449118 Ga0070679_1004491182 134
207 3300005530 Ga0070679_100583151 Ga0070679_1005831512 134
208 3300005535 Ga0070684_100163401 Ga0070684_1001634012 134
209 3300005535 Ga0070684_100574782 Ga0070684_1005747822 134
210 3300005535 Ga0070684_100765790 Ga0070684_1007657902 134
211 3300005544 Ga0070686_100625536 Ga0070686_1006255362 134
212 3300005544 Ga0070686_100692156 Ga0070686_1006921561 134
213 3300005548 Ga0070665_100091723 Ga0070665_1000917232 134
214 3300005549 Ga0070704_100435971 Ga0070704_1004359712 134
215 3300005563 Ga0068855_100558006 Ga0068855_1005580062 134
216 3300005564 Ga0070664_100536963 Ga0070664_1005369631 134
217 3300005564 Ga0070664_100572651 Ga0070664_1005726512 134
218 3300005577 Ga0068857_100075708 Ga0068857_1000757083 134
219 3300005577 Ga0068857_100267992 Ga0068857_1002679922 134
220 3300005614 Ga0068856_100020785 Ga0068856_1000207854 134
221 3300005614 Ga0068856_100563078 Ga0068856_1005630782 134
222 3300005614 Ga0068856_100680071 Ga0068856_1006800712 134
223 3300005615 Ga0070702_100021806 Ga0070702_1000218063 134
224 3300005616 Ga0068852_100087150 Ga0068852_1000871503 134
225 3300005616 Ga0068852_101458175 Ga0068852_1014581752 134
226 3300005618 Ga0068864_100725836 Ga0068864_1007258362 134
227 3300005718 Ga0068866_10066706 Ga0068866_100667062 134
228 3300005719 Ga0068861_100167093 Ga0068861_1001670933 134
229 3300005834 Ga0068851_10060580 Ga0068851_100605802 134
230 3300005834 Ga0068851_10187658 Ga0068851_101876582 134
231 3300005840 Ga0068870_10428312 Ga0068870_104283122 134
232 3300005841 Ga0068863_101386097 Ga0068863_1013860972 134
233 3300005843 Ga0068860_100375346 Ga0068860_1003753462 134
234 3300005937 Ga0081455_10008319 Ga0081455_100083198 134
235 3300005937 Ga0081455_10092830 Ga0081455_100928304 134
236 3300005983 Ga0081540_1004173 Ga0081540_10041734 134
237 3300005985 Ga0081539_10007659 Ga0081539_100076598 134
238 3300005985 Ga0081539_10082721 Ga0081539_100827212 134
239 3300006028 Ga0070717_10954532 Ga0070717_109545321 134
240 3300006058 Ga0075432_10059069 Ga0075432_100590692 134
241 3300006163 Ga0070715_11031358 Ga0070715_110313581 134
242 3300006173 Ga0070716_101519850 Ga0070716_1015198502 134
243 3300006358 Ga0068871_102124377 Ga0068871_1021243771 134
244 3300006844 Ga0075428_102426713 Ga0075428_1024267131 134
245 3300006847 Ga0075431_100083633 Ga0075431_1000836332 134
246 3300006852 Ga0075433_10045774 Ga0075433_100457745 134
247 3300006871 Ga0075434_100026628 Ga0075434_1000266287 134
248 3300006881 Ga0068865_100115175 Ga0068865_1001151752 134
249 3300007076 Ga0075435_101105893 Ga0075435_1011058931 134
250 3300009093 Ga0105240_10598127 Ga0105240_105981272 134
251 3300009094 Ga0111539_10105520 Ga0111539_101055203 134
252 3300009094 Ga0111539_10367904 Ga0111539_103679042 134
253 3300009094 Ga0111539_11326795 Ga0111539_113267952 134
254 3300009098 Ga0105245_10006591 Ga0105245_100065913 134
255 3300009098 Ga0105245_10097986 Ga0105245_100979862 134
256 3300009098 Ga0105245_10576849 Ga0105245_105768492 134
257 3300009098 Ga0105245_10899125 Ga0105245_108991252 134
258 3300009101 Ga0105247_10569664 Ga0105247_105696642 134
259 3300009148 Ga0105243_10700352 Ga0105243_107003522 134
260 3300009176 Ga0105242_11080562 Ga0105242_110805622 134
261 3300009177 Ga0105248_10065118 Ga0105248_100651184 134
262 3300009177 Ga0105248_10266355 Ga0105248_102663552 134
263 3300009545 Ga0105237_10650610 Ga0105237_106506102 134
264 3300009545 Ga0105237_10675430 Ga0105237_106754302 134
265 3300009551 Ga0105238_10701518 Ga0105238_107015182 134
266 3300009553 Ga0105249_10994646 Ga0105249_109946462 134
267 3300009553 Ga0105249_11508022 Ga0105249_115080222 134
268 3300010375 Ga0105239_10227359 Ga0105239_102273593 134
269 3300010375 Ga0105239_10377028 Ga0105239_103770282 134
270 3300010375 Ga0105239_10585561 Ga0105239_105855612 134
271 3300010375 Ga0105239_10767126 Ga0105239_107671262 134
272 3300012490 Ga0157322_1007991 Ga0157322_10079912 134
273 3300013105 Ga0157369_10346602 Ga0157369_103466022 134
274 3300013105 Ga0157369_11068067 Ga0157369_110680672 134
275 3300013105 Ga0157369_11372197 Ga0157369_113721971 134
276 3300013296 Ga0157374_10039180 Ga0157374_100391803 134
277 3300013297 Ga0157378_10170348 Ga0157378_101703482 134
278 3300013297 Ga0157378_10537119 Ga0157378_105371192 134
279 3300013297 Ga0157378_10737876 Ga0157378_107378762 134
280 3300013306 Ga0163162_10091804 Ga0163162_100918042 134
281 3300013306 Ga0163162_10594298 Ga0163162_105942982 134
282 3300013307 Ga0157372_10008742 Ga0157372_100087427 134
283 3300013307 Ga0157372_10617333 Ga0157372_106173332 134
284 3300013307 Ga0157372_10701359 Ga0157372_107013592 134
285 3300013307 Ga0157372_10821912 Ga0157372_108219122 134
286 3300013308 Ga0157375_11026411 Ga0157375_110264112 134
287 3300013308 Ga0157375_11313413 Ga0157375_113134132 134
288 3300014325 Ga0163163_10054198 Ga0163163_100541984 134
289 3300014325 Ga0163163_10228497 Ga0163163_102284972 134
290 3300014325 Ga0163163_10587441 Ga0163163_105874412 134
291 3300014325 Ga0163163_11106452 Ga0163163_111064522 134
292 3300014326 Ga0157380_10403702 Ga0157380_104037022 134
293 3300014326 Ga0157380_10590885 Ga0157380_105908852 134
294 3300014326 Ga0157380_11069956 Ga0157380_110699562 134
295 3300014326 Ga0157380_11652968 Ga0157380_116529681 134
296 3300014497 Ga0182008_10453387 Ga0182008_104533872 134
297 3300014497 Ga0182008_10833102 Ga0182008_108331021 134
298 3300014745 Ga0157377_10024201 Ga0157377_100242013 134
299 3300014745 Ga0157377_10694981 Ga0157377_106949811 134
300 3300014968 Ga0157379_10000487 Ga0157379_1000048715 134
301 3300014969 Ga0157376_10033638 Ga0157376_100336384 134
302 3300014969 Ga0157376_11398135 Ga0157376_113981351 134
303 3300014969 Ga0157376_12760325 Ga0157376_127603251 134
304 3300015265 Ga0182005_1261758 Ga0182005_12617581 134
305 3300017792 Ga0163161_10117735 Ga0163161_101177352 134
306 3300020080 Ga0206350_10920932 Ga0206350_109209322 134
307 3300020081 Ga0206354_10680993 Ga0206354_106809931 134
308 3300020081 Ga0206354_11048809 Ga0206354_110488092 134
309 3300020082 Ga0206353_11118769 Ga0206353_111187692 134
310 3300020082 Ga0206353_11473877 Ga0206353_114738772 134
311 3300020082 Ga0206353_11477553 Ga0206353_114775532 134
312 3300021358 Ga0213873_10132701 Ga0213873_101327012 134
313 3300021377 Ga0213874_10002209 Ga0213874_100022094 134
314 3300021377 Ga0213874_10169425 Ga0213874_101694251 134
315 3300021384 Ga0213876_10013700 Ga0213876_100137002 134
316 3300021384 Ga0213876_10036084 Ga0213876_100360841 134
317 3300021384 Ga0213876_10091881 Ga0213876_100918811 134
318 3300021388 Ga0213875_10008882 Ga0213875_100088825 134
319 3300021388 Ga0213875_10030530 Ga0213875_100305302 134
320 3300022467 Ga0224712_10448657 Ga0224712_104486572 134
321 3300022467 Ga0224712_10544630 Ga0224712_105446301 134
322 3300025321 Ga0207656_10162647 Ga0207656_101626472 134
323 3300025885 Ga0207653_10056992 Ga0207653_100569922 134
324 3300025898 Ga0207692_10027926 Ga0207692_100279262 134
325 3300025898 Ga0207692_10174716 Ga0207692_101747162 134
326 3300025901 Ga0207688_10001339 Ga0207688_100013398 134
327 3300025906 Ga0207699_10099663 Ga0207699_100996632 134
328 3300025908 Ga0207643_10353797 Ga0207643_103537972 134
329 3300025909 Ga0207705_10594399 Ga0207705_105943991 134
330 3300025914 Ga0207671_10042892 Ga0207671_100428925 134
331 3300025914 Ga0207671_10664013 Ga0207671_106640131 134
332 3300025916 Ga0207663_11082142 Ga0207663_110821422 134
333 3300025919 Ga0207657_10005964 Ga0207657_100059647 134
334 3300025919 Ga0207657_10152395 Ga0207657_101523952 134
335 3300025919 Ga0207657_10370482 Ga0207657_103704821 134
336 3300025919 Ga0207657_10622615 Ga0207657_106226152 134
337 3300025920 Ga0207649_10049977 Ga0207649_100499772 134
338 3300025920 Ga0207649_11051495 Ga0207649_110514951 134
339 3300025920 Ga0207649_11121593 Ga0207649_111215932 134
340 3300025921 Ga0207652_10750527 Ga0207652_107505272 134
341 3300025921 Ga0207652_11014785 Ga0207652_110147851 134
342 3300025926 Ga0207659_10036621 Ga0207659_100366213 134
343 3300025927 Ga0207687_10053679 Ga0207687_100536792 134
344 3300025927 Ga0207687_10387561 Ga0207687_103875612 134
345 3300025927 Ga0207687_11392381 Ga0207687_113923811 134
346 3300025927 Ga0207687_11673502 Ga0207687_116735021 134
347 3300025931 Ga0207644_10081260 Ga0207644_100812601 134
348 3300025932 Ga0207690_11110390 Ga0207690_111103902 134
349 3300025933 Ga0207706_10071097 Ga0207706_100710973 134
350 3300025934 Ga0207686_10921506 Ga0207686_109215062 134
351 3300025934 Ga0207686_11299563 Ga0207686_112995632 134
352 3300025936 Ga0207670_10690756 Ga0207670_106907562 134
353 3300025937 Ga0207669_10054442 Ga0207669_100544422 134
354 3300025938 Ga0207704_10018097 Ga0207704_100180973 134
355 3300025940 Ga0207691_11130799 Ga0207691_111307992 134
356 3300025941 Ga0207711_10095876 Ga0207711_100958763 134
357 3300025941 Ga0207711_10657735 Ga0207711_106577352 134
358 3300025942 Ga0207689_10177076 Ga0207689_101770762 134
359 3300025942 Ga0207689_10251601 Ga0207689_102516012 134
360 3300025944 Ga0207661_10908270 Ga0207661_109082702 134
361 3300025945 Ga0207679_10454393 Ga0207679_104543932 134
362 3300025945 Ga0207679_11177016 Ga0207679_111770162 134
363 3300025949 Ga0207667_10495225 Ga0207667_104952252 134
364 3300025949 Ga0207667_10691583 Ga0207667_106915832 134
365 3300025960 Ga0207651_10457279 Ga0207651_104572792 134
366 3300025972 Ga0207668_10215881 Ga0207668_102158812 134
367 3300025981 Ga0207640_10138045 Ga0207640_101380452 134
368 3300026023 Ga0207677_10061899 Ga0207677_100618992 134
369 3300026067 Ga0207678_10040159 Ga0207678_100401593 134
370 3300026067 Ga0207678_10735007 Ga0207678_107350072 134
371 3300026075 Ga0207708_10001261 Ga0207708_100012616 134
372 3300026078 Ga0207702_10050339 Ga0207702_100503391 134
373 3300026078 Ga0207702_10132417 Ga0207702_101324172 134
374 3300026088 Ga0207641_12082520 Ga0207641_120825202 134
375 3300026089 Ga0207648_10729879 Ga0207648_107298792 134
376 3300026095 Ga0207676_10678429 Ga0207676_106784292 134
377 3300026116 Ga0207674_10072347 Ga0207674_100723473 134
378 3300026116 Ga0207674_10176166 Ga0207674_101761662 134
379 3300026121 Ga0207683_10176030 Ga0207683_101760302 134
380 3300026142 Ga0207698_10071476 Ga0207698_100714762 134
381 3300027907 Ga0207428_10257929 Ga0207428_102579292 134
382 3300028379 Ga0268266_10098051 Ga0268266_100980512 134
383 3300028379 Ga0268266_10503965 Ga0268266_105039652 134
384 3300028381 Ga0268264_10135004 Ga0268264_101350042 134
385 3300028381 Ga0268264_10244191 Ga0268264_102441912 134
386 3300028577 Ga0265318_10005827 Ga0265318_100058272 134
387 3300028800 Ga0265338_10063099 Ga0265338_100630992 134
388 3300031240 Ga0265320_10019761 Ga0265320_100197615 134
389 3300031250 Ga0265331_10430770 Ga0265331_104307701 134
390 3300031344 Ga0265316_10048130 Ga0265316_100481304 134
391 3300031548 Ga0307408_100393073 Ga0307408_1003930732 134
392 3300031711 Ga0265314_10031831 Ga0265314_100318315 134
393 3300031901 Ga0307406_10641631 Ga0307406_106416312 134
394 3300031995 Ga0307409_102573717 Ga0307409_1025737171 134
395 3300032002 Ga0307416_100857104 Ga0307416_1008571041 134
396 3300032002 Ga0307416_100950772 Ga0307416_1009507722 134
397 3300032126 Ga0307415_100073302 Ga0307415_1000733022 134
398 3300032126 Ga0307415_100968016 Ga0307415_1009680162 134
399 3300035242 Ga0373962_0106543 Ga0373962_0106543_368_772 134
400 3300035692 Ga0373935_0519707 Ga0373935_0519707_261_665 134
401 3300037312 Ga0395899_0189246 Ga0395899_0189246_84_491 134
402 3300037418 Ga0395900_0084021 Ga0395900_0084021_670_1080 134
403 3300037418 Ga0395900_0122633 Ga0395900_0122633_949_1356 134
404 3300037418 Ga0395900_0946404 Ga0395900_0946404_177_581 134
405 3300037418 Ga0395900_0982323 Ga0395900_0982323_54_458 134
406 3300037418 Ga0395900_1078429 Ga0395900_1078429_56_472 134
407 3300037418 Ga0395900_1223319 Ga0395900_1223319_26_433 134
408 3300037466 Ga0395898_0086730 Ga0395898_0086730_324_734 134
409 3300037466 Ga0395898_0160642 Ga0395898_0160642_1702_2109 134
410 3300037466 Ga0395898_0233696 Ga0395898_0233696_1207_1611 134
411 3300037466 Ga0395898_0247248 Ga0395898_0247248_879_1286 134
412 3300037466 Ga0395898_0377603 Ga0395898_0377603_374_778 134
413 3300037466 Ga0395898_0450523 Ga0395898_0450523_549_965 134
414 3300037471 Ga0395905_0229515 Ga0395905_0229515_1289_1699 134
415 3300037471 Ga0395905_0338718 Ga0395905_0338718_698_1105 134
416 3300037853 Ga0436364_0329358 Ga0436364_0329358_1764_2177 134
417 3300037853 Ga0436364_0609270 Ga0436364_0609270_4371_4784 134
418 3300037853 Ga0436364_0796475 Ga0436364_0796475_287_700 134
419 3300037853 Ga0436364_1012143 Ga0436364_1012143_124_540 134
420 3300037853 Ga0436364_1218841 Ga0436364_1218841_3989_4405 134
421 3300038443 Ga0395901_0004053 Ga0395901_0004053_13254_13661 134
422 3300038443 Ga0395901_0085916 Ga0395901_0085916_1135_1545 134
423 3300038443 Ga0395901_0100846 Ga0395901_0100846_1139_1543 134
424 3300038443 Ga0395901_0357708 Ga0395901_0357708_974_1378 134
425 3300038443 Ga0395901_1040896 Ga0395901_1040896_123_539 134
426 3300038443 Ga0395901_1084100 Ga0395901_1084100_37_444 134
427 3300038443 Ga0395901_1216940 Ga0395901_1216940_203_607 134
428 3300038443 Ga0395901_1385755 Ga0395901_1385755_62_466 134
429 3300039437 Ga0436365_0561077 Ga0436365_0561077_36_443 134
430 3300039437 Ga0436365_0705902 Ga0436365_0705902_72_485 134
431 3300039437 Ga0436365_0889001 Ga0436365_0889001_1331_1744 134
432 3300039437 Ga0436365_0999899 Ga0436365_0999899_654_1070 134
433 3300039437 Ga0436365_1213556 Ga0436365_1213556_1893_2306 134
434 3300039437 Ga0436365_1246407 Ga0436365_1246407_971_1387 134
435 3300039437 Ga0436365_1821223 Ga0436365_1821223_1657_2079 134
436 3300039450 Ga0436363_0484789 Ga0436363_0484789_379_792 134
437 3300039450 Ga0436363_0537896 Ga0436363_0537896_184_597 134
438 3300039450 Ga0436363_0712334 Ga0436363_0712334_4104_4517 134
439 3300039450 Ga0436363_1475091 Ga0436363_1475091_609_1022 134
440 3300039450 Ga0436363_1627320 Ga0436363_1627320_3712_4125 134
441 3300039453 Ga0436362_0104098 Ga0436362_0104098_128_541 134
442 3300039453 Ga0436362_0226952 Ga0436362_0226952_178_594 134
443 3300039453 Ga0436362_0670333 Ga0436362_0670333_292_705 134
444 3300039453 Ga0436362_0961579 Ga0436362_0961579_256_678 134
445 3300041451 Ga0451791_0001963 Ga0451791_0001963_366_770 134
446 3300041460 Ga0451802_1928281 Ga0451802_1928281_66_470 134
447 3300041491 Ga0451833_0906112 Ga0451833_0906112_61_465 134
448 3300041492 Ga0451835_0043310 Ga0451835_0043310_320_724 134
449 3300041509 Ga0451843_0633562 Ga0451843_0633562_70_474 134
450 3300042016 Ga0439463_084049 Ga0439463_084049_202_606 134
451 3300042438 Ga0439459_0062036 Ga0439459_0062036_353_757 134
452 3300044658 Ga0466972_0213047 Ga0466972_0213047_362_766 134
453 3300044658 Ga0466972_0360437 Ga0466972_0360437_211_615 134
454 3300044684 Ga0466966_0259522 Ga0466966_0259522_118_522 134
455 3300044684 Ga0466966_0354980 Ga0466966_0354980_14_433 134
456 3300044694 Ga0466963_0060540 Ga0466963_0060540_1313_1735 134
457 3300044694 Ga0466963_0275139 Ga0466963_0275139_509_916 134
458 3300044694 Ga0466963_0282802 Ga0466963_0282802_542_946 134
459 3300044706 Ga0466964_0289310 Ga0466964_0289310_359_763 134
460 3300044735 Ga0466968_0171883 Ga0466968_0171883_244_648 134
461 3300044735 Ga0466968_0362065 Ga0466968_0362065_60_467 134
462 3300044842 Ga0466957_0069088 Ga0466957_0069088_1181_1606 134
463 3300044842 Ga0466957_0142504 Ga0466957_0142504_595_1014 134
464 3300044842 Ga0466957_0259328 Ga0466957_0259328_61_465 134
465 3300044842 Ga0466957_0942431 Ga0466957_0942431_168_584 134
466 3300044842 Ga0466957_1151146 Ga0466957_1151146_46_459 134
467 3300044901 Ga0466960_0000024 Ga0466960_0000024_30984_31388 134
468 3300044901 Ga0466960_0015842 Ga0466960_0015842_1113_1517 134
469 3300044901 Ga0466960_0094679 Ga0466960_0094679_326_730 134
470 3300044901 Ga0466960_0109048 Ga0466960_0109048_748_1152 134
471 3300044901 Ga0466960_0272563 Ga0466960_0272563_222_626 134
472 3300045049 Ga0466959_0366815 Ga0466959_0366815_315_725 134
473 3300045049 Ga0466959_0689193 Ga0466959_0689193_65_481 134
474 3300045836 Ga0466958_0049004 Ga0466958_0049004_1592_2002 134
475 3300045836 Ga0466958_0072458 Ga0466958_0072458_1015_1425 134
476 3300045836 Ga0466958_0150103 Ga0466958_0150103_394_816 134
477 3300045836 Ga0466958_0182902 Ga0466958_0182902_760_1179 134
478 3300045836 Ga0466958_0205866 Ga0466958_0205866_264_677 134
479 3300045836 Ga0466958_0396222 Ga0466958_0396222_295_720 134
480 3300045836 Ga0466958_0500207 Ga0466958_0500207_182_586 134
481 3300045976 Ga0466967_0242089 Ga0466967_0242089_456_863 134
482 3300045976 Ga0466967_0420437 Ga0466967_0420437_641_1045 134
483 3300045976 Ga0466967_2383201 Ga0466967_2383201_70_492 134
484 3300046457 Ga0495590_0029636 Ga0495590_0029636_698_1102 134
485 3300046461 Ga0495641_0025560 Ga0495641_0025560_71_475 134
486 3300046471 Ga0495650_0000035 Ga0495650_0000035_242151_242555 134
487 3300046499 Ga0495594_0321849 Ga0495594_0321849_250_654 134
488 3300046517 Ga0495630_0699127 Ga0495630_0699127_253_663 134
489 3300046518 Ga0495631_0128778 Ga0495631_0128778_497_904 134
490 3300046525 Ga0495663_0405997 Ga0495663_0405997_87_491 134
491 3300046530 Ga0495654_0355016 Ga0495654_0355016_154_558 134
492 3300046535 Ga0495586_0396002 Ga0495586_0396002_347_751 134
493 3300046538 Ga0495609_0209430 Ga0495609_0209430_210_617 134
494 3300046539 Ga0495621_0201042 Ga0495621_0201042_211_615 134
495 3300046559 Ga0495667_0191052 Ga0495667_0191052_99_509 134
496 3300046615 Ga0495656_0058246 Ga0495656_0058246_624_1028 134
497 3300046678 Ga0495599_0454771 Ga0495599_0454771_14_427 134
498 3300046683 Ga0495658_0182636 Ga0495658_0182636_857_1261 134
499 3300046691 Ga0495670_0160176 Ga0495670_0160176_112_516 134
500 3300046794 Ga0495589_0400654 Ga0495589_0400654_24_449 134
501 3300046794 Ga0495589_0489772 Ga0495589_0489772_135_539 134
502 3300047317 Ga0495604_0157124 Ga0495604_0157124_46_456 134
503 3300047322 Ga0495680_0563021 Ga0495680_0563021_298_708 134
504 3300047445 Ga0495677_0140583 Ga0495677_0140583_219_623 134
505 3300047472 Ga0495686_0295382 Ga0495686_0295382_55_462 134
506 3300048091 Ga0495626_0158911 Ga0495626_0158911_43_447 134
507 3300048903 Ga0496100_0033594 Ga0496100_0033594_1539_1964 134
508 3300048903 Ga0496100_0157507 Ga0496100_0157507_146_550 134
509 3300048904 Ga0496101_0044196 Ga0496101_0044196_56_460 134
510 3300048904 Ga0496101_0051818 Ga0496101_0051818_1230_1655 134
511 3300048904 Ga0496101_0449672 Ga0496101_0449672_293_700 134
512 3300048905 Ga0496102_0018229 Ga0496102_0018229_4385_4789 134
513 3300048905 Ga0496102_0043979 Ga0496102_0043979_1431_1835 134
514 3300048905 Ga0496102_0140336 Ga0496102_0140336_1705_2130 134
515 3300048905 Ga0496102_0292648 Ga0496102_0292648_826_1230 134
516 3300048905 Ga0496102_0977957 Ga0496102_0977957_83_490 134
517 3300048906 Ga0496103_0026004 Ga0496103_0026004_169_594 134
518 3300048906 Ga0496103_0399008 Ga0496103_0399008_187_591 134
519 3300048906 Ga0496103_0587724 Ga0496103_0587724_83_490 134
520 3300048907 Ga0496104_0002732 Ga0496104_0002732_13139_13546 134
521 3300048907 Ga0496104_0142061 Ga0496104_0142061_1661_2065 134
522 3300048907 Ga0496104_0197880 Ga0496104_0197880_542_967 134
523 3300048907 Ga0496104_0803300 Ga0496104_0803300_330_737 134
524 3300048908 Ga0496105_0072630 Ga0496105_0072630_1155_1571 134
525 3300048908 Ga0496105_0075266 Ga0496105_0075266_1781_2188 134
526 3300048908 Ga0496105_0311233 Ga0496105_0311233_642_1049 134
527 3300048909 Ga0496106_0034464 Ga0496106_0034464_3300_3704 134
528 3300048909 Ga0496106_0191672 Ga0496106_0191672_585_1010 134
529 3300048909 Ga0496106_0432212 Ga0496106_0432212_609_1013 134
530 3300048910 Ga0496107_0009709 Ga0496107_0009709_635_1039 134
531 3300048910 Ga0496107_0095496 Ga0496107_0095496_1001_1426 134
532 3300048910 Ga0496107_0982375 Ga0496107_0982375_172_585 134
533 3300048911 Ga0496108_0000712 Ga0496108_0000712_19064_19468 134
534 3300048911 Ga0496108_0004745 Ga0496108_0004745_9644_10069 134
535 3300048911 Ga0496108_0029433 Ga0496108_0029433_3603_4007 134
536 3300048911 Ga0496108_0258549 Ga0496108_0258549_248_655 134
537 3300048911 Ga0496108_0300516 Ga0496108_0300516_739_1146 134
538 3300048912 Ga0496109_0002857 Ga0496109_0002857_655_1080 134
539 3300048912 Ga0496109_0075725 Ga0496109_0075725_902_1309 134
540 3300048912 Ga0496109_0124143 Ga0496109_0124143_1287_1691 134
541 3300048912 Ga0496109_0433482 Ga0496109_0433482_729_1136 134
542 3300048913 Ga0496110_0000358 Ga0496110_0000358_26067_26471 134
543 3300048913 Ga0496110_0001659 Ga0496110_0001659_3912_4337 134
544 3300048913 Ga0496110_0276652 Ga0496110_0276652_329_733 134
545 3300048913 Ga0496110_0497873 Ga0496110_0497873_180_587 134
546 3300048914 Ga0496111_0010411 Ga0496111_0010411_1338_1763 134
547 3300048914 Ga0496111_0021775 Ga0496111_0021775_326_730 134
548 3300048914 Ga0496111_0131442 Ga0496111_0131442_644_1051 134
549 3300048915 Ga0496112_0016208 Ga0496112_0016208_3847_4254 134
550 3300048915 Ga0496112_0020849 Ga0496112_0020849_4189_4593 134
551 3300048915 Ga0496112_0026391 Ga0496112_0026391_1195_1602 134
552 3300048915 Ga0496112_0032129 Ga0496112_0032129_192_617 134
553 3300048915 Ga0496112_0044051 Ga0496112_0044051_311_715 134
554 3300048915 Ga0496112_0133498 Ga0496112_0133498_34_441 134
555 3300048915 Ga0496112_0251856 Ga0496112_0251856_623_1027 134
556 3300048916 Ga0496113_0016680 Ga0496113_0016680_203_610 134
557 3300048916 Ga0496113_0029015 Ga0496113_0029015_3036_3461 134
558 3300048916 Ga0496113_0081097 Ga0496113_0081097_1837_2241 134
559 3300048916 Ga0496113_0094304 Ga0496113_0094304_1169_1573 134
560 3300048917 Ga0496114_0262366 Ga0496114_0262366_454_861 134
561 3300048917 Ga0496114_0330741 Ga0496114_0330741_384_788 134
562 3300048917 Ga0496114_0503106 Ga0496114_0503106_82_489 134
563 3300048917 Ga0496114_0507730 Ga0496114_0507730_339_764 134
564 3300048917 Ga0496114_0676959 Ga0496114_0676959_283_687 134
565 3300048918 Ga0496115_0006172 Ga0496115_0006172_4659_5063 134
566 3300048918 Ga0496115_0062284 Ga0496115_0062284_1330_1746 134
567 3300048918 Ga0496115_0405557 Ga0496115_0405557_261_668 134
568 3300048922 Ga0496119_0260064 Ga0496119_0260064_372_776 134
569 3300048924 Ga0496121_0034885 Ga0496121_0034885_2757_3161 134
570 3300048926 Ga0496123_0231911 Ga0496123_0231911_163_576 134
571 3300049568 Ga0501031_0028269 Ga0501031_0028269_1316_1720 134
572 3300049569 Ga0501032_0039289 Ga0501032_0039289_1214_1618 134
573 3300049570 Ga0501033_0041001 Ga0501033_0041001_2558_2962 134
574 3300049571 Ga0501034_0067114 Ga0501034_0067114_2703_3107 134
575 3300049571 Ga0501034_0082769 Ga0501034_0082769_679_1083 134
576 3300049572 Ga0501036_0121015 Ga0501036_0121015_72_476 134
577 3300049573 Ga0501037_0016364 Ga0501037_0016364_2208_2612 134
578 3300049574 Ga0501038_0004424 Ga0501038_0004424_4066_4470 134
579 3300049575 Ga0501039_0047066 Ga0501039_0047066_1862_2266 134
580 3300049578 Ga0501042_0024897 Ga0501042_0024897_1652_2056 134
581 3300049580 Ga0501046_0118476 Ga0501046_0118476_834_1238 134
582 3300049581 Ga0501047_0089863 Ga0501047_0089863_217_621 134
583 3300049582 Ga0501048_0003039 Ga0501048_0003039_11649_12053 134
584 3300049583 Ga0501067_0058156 Ga0501067_0058156_1655_2059 134
585 3300049583 Ga0501067_0695206 Ga0501067_0695206_132_536 134
586 3300049584 Ga0501068_0007611 Ga0501068_0007611_3813_4217 134
587 3300049584 Ga0501068_0864178 Ga0501068_0864178_110_514 134
588 3300049584 Ga0501068_0936441 Ga0501068_0936441_98_502 134
589 3300049585 Ga0501069_0008115 Ga0501069_0008115_2703_3107 134
590 3300049585 Ga0501069_0054166 Ga0501069_0054166_45_449 134
591 3300049586 Ga0501070_0025893 Ga0501070_0025893_1572_1976 134
592 3300049587 Ga0501071_1100715 Ga0501071_1100715_101_505 134
593 3300049589 Ga0501073_0016890 Ga0501073_0016890_1444_1848 134
594 3300049590 Ga0501074_0096048 Ga0501074_0096048_11_415 134
595 3300049590 Ga0501074_0213468 Ga0501074_0213468_698_1102 134
596 3300049742 Ga0501080_0028739 Ga0501080_0028739_2178_2582 134
597 3300049742 Ga0501080_0029673 Ga0501080_0029673_2030_2434 134
598 3300049744 Ga0501083_0096713 Ga0501083_0096713_639_1043 134
599 3300049822 Ga0501035_0021932 Ga0501035_0021932_3137_3541 134
600 3300049823 Ga0501044_0158149 Ga0501044_0158149_1444_1848 134
601 3300050510 nmdc:mga06r32_53522_c2 nmdc:mga06r32_53522_c2_99_515 134
602 3300050511 nmdc:mga08y16_18110_c1 nmdc:mga08y16_18110_c1_445_861 134
603 3300050511 nmdc:mga08y16_307053_c1 nmdc:mga08y16_307053_c1_335_760 134
604 3300050512 nmdc:mga0n895_35367_c1 nmdc:mga0n895_35367_c1_541_957 134
605 3300050513 nmdc:mga0rr50_180188_c1 nmdc:mga0rr50_180188_c1_1293_1709 134
606 3300050513 nmdc:mga0rr50_636955_c1 nmdc:mga0rr50_636955_c1_29_445 134
607 3300050514 nmdc:mga08x19_657010_c1 nmdc:mga08x19_657010_c1_38_454 134
608 3300053096 Ga0500641_0285532 Ga0500641_0285532_247_651 134
609 3300053104 Ga0500556_0001386 Ga0500556_0001386_4167_4580 134
610 3300053153 Ga0500616_0005748 Ga0500616_0005748_4302_4706 134
611 3300053153 Ga0500616_0013284 Ga0500616_0013284_3757_4170 134
612 3300053736 Ga0500599_007905 Ga0500599_007905_273_686 134
613 3300054114 Ga0501084_0117593 Ga0501084_0117593_1529_1933 134
614 3300060353 Ga0501082_0026301 Ga0501082_0026301_4513_4917 134
615 3300060353 Ga0501082_1199622 Ga0501082_1199622_87_494 134
616 3300061719 Ga0466962_0213000 Ga0466962_0213000_58_468 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

50

144

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pn2-assembly1.cif.gz_A-2 crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution 0.8887 3 128
2opl-assembly1.cif.gz_A crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution 0.8543 2 121
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8458 2 130
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.8434 2 130
2pn2-assembly1.cif.gz_A-2 crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution 0.833 3 128
ID Description Score Start End Superfamily
2pn2A00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8699 3 128 3.30.300.20
2oplB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8533 2 117 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8371 38 130 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8288 4 130 3.30.300.20
2pn2A00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8215 3 128 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A2W6BPW2-F1-model_v4 Osmotically inducible protein OsmC 0.9709 50 134
AF-A0A2W6C421-F1-model_v4 OsmC family peroxiredoxin 0.9654 33 132
AF-A0A2W6BPW2-F1-model_v4 Osmotically inducible protein OsmC 0.9384 50 134
AF-A0A640Y902-F1-model_v4 OsmC family peroxiredoxin 0.9377 1 121
AF-A0A317E521-F1-model_v4 Osmotically inducible protein C 0.9362 2 128

Feature Viewer

pLDDT pTM Quality
93.95 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map