F469518

General Info

Members Datasets Scaffolds Average Seq Length
616 231 616 244

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100043437|Ga0070694_1000434373
Length 262
Sequence MAARPTAEGDIGMSRTANLLFAILAYAIFFATFLYLIVFVGDFAFAGRTVDVGPAAPLAAAVVIDVALIALFGVQHSVMARQGFKRWWTRVIPAPAERSVYVLMASAALIILMSLWRPIDSIVWNVSTPALASLIWVLFWIGWFTVLLSTFLINHFELFGLQQAWFHWRGRQAEPPKFRTPLFYKWIRHPLYLGFFLAFWATPEMTAGHLLLAAGVSVYMLIAIRYEERDLIDLFGKDYEDYREQAGMLTPRIRRRNRSPAA

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
129 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
162 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
163 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
164 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
175 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
218 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
221 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
222 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
223 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
224 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 4.55
Rhizosphere 93.99
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000837 3300001990 Bacteria 10956
2 JGI24735J21928_10003578 3300002067 Bacteria 5278
3 JGI24742J22300_10039564 3300002244 Unclassified 838
4 rootL2_10227603 3300003322 Unclassified 1336
5 Ga0065715_10091270 3300005293 Bacteria 5926
6 Ga0070658_10014827 3300005327 Bacteria 6246
7 Ga0070658_10067826 3300005327 Bacteria 2915
8 Ga0070658_10273656 3300005327 Bacteria 1436
9 Ga0070658_10463130 3300005327 Bacteria 1093
10 Ga0070658_10594960 3300005327 Bacteria 958
11 Ga0070676_10036889 3300005328 Bacteria 2817
12 Ga0070670_100001186 3300005331 Bacteria 20646
13 Ga0070670_100016571 3300005331 Bacteria 6325
14 Ga0070670_100054799 3300005331 Bacteria 3423
15 Ga0070670_100058060 3300005331 Bacteria 3322
16 Ga0070677_10013309 3300005333 Bacteria 2875
17 Ga0070677_10064672 3300005333 Bacteria 1520
18 Ga0070677_10086012 3300005333 Bacteria 1357
19 Ga0070677_10126703 3300005333 Bacteria 1160
20 Ga0070666_10147928 3300005335 Bacteria 1638
21 Ga0070666_10271933 3300005335 Bacteria 1203
22 Ga0070680_100121271 3300005336 Bacteria 2183
23 Ga0070660_100034999 3300005339 Bacteria 3799
24 Ga0070660_100109272 3300005339 Bacteria 2199
25 Ga0070660_100549275 3300005339 Bacteria 964
26 Ga0070689_100120587 3300005340 Bacteria 2094
27 Ga0070689_100326175 3300005340 Unclassified 1283
28 Ga0070661_100014342 3300005344 Bacteria 5583
29 Ga0070661_100190311 3300005344 Bacteria 1565
30 Ga0070661_100287209 3300005344 Bacteria 1277
31 Ga0070661_100571582 3300005344 Bacteria 911
32 Ga0070668_100035488 3300005347 Bacteria 3802
33 Ga0070668_100272100 3300005347 Bacteria 1412
34 Ga0070668_100371657 3300005347 Bacteria 1215
35 Ga0070668_100426448 3300005347 Bacteria 1136
36 Ga0070668_100615816 3300005347 Unclassified 951
37 Ga0070669_100012623 3300005353 Bacteria 5996
38 Ga0070669_100016538 3300005353 Bacteria 5265
39 Ga0070669_100034942 3300005353 Bacteria 3640
40 Ga0070669_100091705 3300005353 Bacteria 2279
41 Ga0070669_100099311 3300005353 Bacteria 2194
42 Ga0070675_100009019 3300005354 Bacteria 7746
43 Ga0070675_100223641 3300005354 Bacteria 1640
44 Ga0070675_100247536 3300005354 Bacteria 1559
45 Ga0070671_100000051 3300005355 Bacteria 79207
46 Ga0070671_100023390 3300005355 Bacteria 5058
47 Ga0070671_100036881 3300005355 Bacteria 4053
48 Ga0070671_100042452 3300005355 Bacteria 3780
49 Ga0070671_100066228 3300005355 Bacteria 3010
50 Ga0070671_100131362 3300005355 Bacteria 2109
51 Ga0070671_100241992 3300005355 Bacteria 1532
52 Ga0070674_100070580 3300005356 Bacteria 2468
53 Ga0070673_100078110 3300005364 Bacteria 2677
54 Ga0070673_100096424 3300005364 Bacteria 2427
55 Ga0070673_100108272 3300005364 Bacteria 2300
56 Ga0070673_100367821 3300005364 Bacteria 1279
57 Ga0070659_100008617 3300005366 Bacteria 7459
58 Ga0070659_100027917 3300005366 Bacteria 4352
59 Ga0070659_100138163 3300005366 Bacteria 1983
60 Ga0070659_100420584 3300005366 Bacteria 1130
61 Ga0070667_100018227 3300005367 Bacteria 5821
62 Ga0070667_100022426 3300005367 Bacteria 5236
63 Ga0070667_100023656 3300005367 Bacteria 5099
64 Ga0070667_100089870 3300005367 Bacteria 2639
65 Ga0070713_100009408 3300005436 Bacteria 6994
66 Ga0070694_100043437 3300005444 Bacteria 3005
67 Ga0070663_100017308 3300005455 Bacteria 4702
68 Ga0070663_100051507 3300005455 Bacteria 2933
69 Ga0070663_100179938 3300005455 Bacteria 1639
70 Ga0070678_100010816 3300005456 Bacteria 5594
71 Ga0070678_100025742 3300005456 Bacteria 3965
72 Ga0070678_100106737 3300005456 Bacteria 2183
73 Ga0070678_100436067 3300005456 Bacteria 1145
74 Ga0070662_100001195 3300005457 Bacteria 15948
75 Ga0070662_100002559 3300005457 Bacteria 11198
76 Ga0070662_100005921 3300005457 Bacteria 7842
77 Ga0070662_100049117 3300005457 Bacteria 3042
78 Ga0070662_100078627 3300005457 Bacteria 2451
79 Ga0070662_100366533 3300005457 Bacteria 1183
80 Ga0068867_100081831 3300005459 Bacteria 2435
81 Ga0068867_100133078 3300005459 Bacteria 1935
82 Ga0068867_100152249 3300005459 Bacteria 1818
83 Ga0070679_100014712 3300005530 Bacteria 7521
84 Ga0070679_100070254 3300005530 Bacteria 3494
85 Ga0068853_100029613 3300005539 Bacteria 4618
86 Ga0068853_100046035 3300005539 Bacteria 3739
87 Ga0068853_100285248 3300005539 Bacteria 1523
88 Ga0068853_100297151 3300005539 Bacteria 1492
89 Ga0070672_100000170 3300005543 Bacteria 36164
90 Ga0070672_100028979 3300005543 Bacteria 4146
91 Ga0070672_100034628 3300005543 Bacteria 3834
92 Ga0070672_100040819 3300005543 Bacteria 3563
93 Ga0070672_100085930 3300005543 Bacteria 2529
94 Ga0070672_100362227 3300005543 Bacteria 1238
95 Ga0070695_100066652 3300005545 Bacteria 2347
96 Ga0070696_100014446 3300005546 Bacteria 5296
97 Ga0070696_100098641 3300005546 Bacteria 2090
98 Ga0070693_100028510 3300005547 Bacteria 3036
99 Ga0070665_100003837 3300005548 Bacteria 15903
100 Ga0070665_100382596 3300005548 Bacteria 1415
101 Ga0068855_100592673 3300005563 Bacteria 1196
102 Ga0070664_100004436 3300005564 Bacteria 11270
103 Ga0070664_100027929 3300005564 Bacteria 4693
104 Ga0070664_100033148 3300005564 Bacteria 4324
105 Ga0070664_100205983 3300005564 Bacteria 1756
106 Ga0070664_100289239 3300005564 Bacteria 1479
107 Ga0070664_100521030 3300005564 Bacteria 1097
108 Ga0068857_100012932 3300005577 Bacteria 7271
109 Ga0068857_100028505 3300005577 Bacteria 4927
110 Ga0068857_100034684 3300005577 Bacteria 4463
111 Ga0068857_100198097 3300005577 Bacteria 1830
112 Ga0068857_100332636 3300005577 Bacteria 1404
113 Ga0068854_100011508 3300005578 Bacteria 5764
114 Ga0068854_100127428 3300005578 Bacteria 1940
115 Ga0068854_100154952 3300005578 Bacteria 1769
116 Ga0068856_100277447 3300005614 Bacteria 1693
117 Ga0068852_100145130 3300005616 Bacteria 2200
118 Ga0068852_100188765 3300005616 Bacteria 1943
119 Ga0068852_100235123 3300005616 Bacteria 1749
120 Ga0068852_100389629 3300005616 Bacteria 1368
121 Ga0068852_100468928 3300005616 Bacteria 1249
122 Ga0068852_100788403 3300005616 Bacteria 964
123 Ga0068859_100000685 3300005617 Bacteria 34047
124 Ga0068859_100009717 3300005617 Bacteria 9713
125 Ga0068859_100017516 3300005617 Bacteria 7201
126 Ga0068859_100083607 3300005617 Bacteria 3235
127 Ga0068859_100187836 3300005617 Bacteria 2150
128 Ga0068864_100000847 3300005618 Bacteria 25807
129 Ga0068864_100001619 3300005618 Bacteria 18541
130 Ga0068864_100039809 3300005618 Bacteria 4017
131 Ga0068864_100077259 3300005618 Bacteria 2911
132 Ga0068864_100296904 3300005618 Bacteria 1512
133 Ga0068861_100091426 3300005719 Bacteria 2403
134 Ga0068861_100173987 3300005719 Bacteria 1787
135 Ga0068861_100367393 3300005719 Bacteria 1267
136 Ga0068863_100007730 3300005841 Bacteria 10513
137 Ga0068863_100009665 3300005841 Bacteria 9410
138 Ga0068863_100029749 3300005841 Bacteria 5215
139 Ga0068863_100048789 3300005841 Bacteria 4014
140 Ga0068863_100058908 3300005841 Bacteria 3634
141 Ga0068863_100149896 3300005841 Bacteria 2231
142 Ga0068863_100299722 3300005841 Bacteria 1559
143 Ga0068863_100303291 3300005841 Bacteria 1549
144 Ga0068858_100000655 3300005842 Bacteria 36151
145 Ga0068858_100022867 3300005842 Bacteria 5831
146 Ga0068858_100147228 3300005842 Bacteria 2212
147 Ga0068860_100066251 3300005843 Bacteria 3431
148 Ga0068860_100112868 3300005843 Bacteria 2598
149 Ga0068860_100167202 3300005843 Bacteria 2123
150 Ga0068860_100483966 3300005843 Bacteria 1234
151 Ga0068860_101039472 3300005843 Bacteria 838
152 Ga0068862_100009116 3300005844 Bacteria 8214
153 Ga0068862_100042308 3300005844 Bacteria 3881
154 Ga0068862_100052345 3300005844 Bacteria 3493
155 Ga0068862_100103999 3300005844 Bacteria 2487
156 Ga0068862_100207919 3300005844 Bacteria 1767
157 Ga0081539_10043435 3300005985 Bacteria 2605
158 Ga0081539_10069093 3300005985 Bacteria 1903
159 Ga0070717_10006369 3300006028 Bacteria 8676
160 Ga0075364_10162691 3300006051 Bacteria 1507
161 Ga0070712_100101670 3300006175 Bacteria 2127
162 Ga0075362_10032939 3300006177 Bacteria 2252
163 Ga0097621_100097142 3300006237 Bacteria 2473
164 Ga0097621_100242515 3300006237 Bacteria 1576
165 Ga0068871_100011802 3300006358 Bacteria 6421
166 Ga0075431_100072938 3300006847 Bacteria 3542
167 Ga0097620_100000685 3300006931 Bacteria 34047
168 Ga0097620_100009717 3300006931 Bacteria 9713
169 Ga0097620_100017516 3300006931 Bacteria 7201
170 Ga0097620_100083605 3300006931 Bacteria 3235
171 Ga0097620_100187838 3300006931 Bacteria 2150
172 Ga0105250_10008687 3300009092 Bacteria 4303
173 Ga0111539_10054965 3300009094 Bacteria 4734
174 Ga0111539_10376648 3300009094 Bacteria 1652
175 Ga0105247_10170555 3300009101 Bacteria 1446
176 Ga0105243_10486280 3300009148 Bacteria 1166
177 Ga0105241_10205167 3300009174 Bacteria 1649
178 Ga0105242_10115602 3300009176 Bacteria 2294
179 Ga0105248_10002158 3300009177 Bacteria 21772
180 Ga0105248_10002811 3300009177 Bacteria 19328
181 Ga0105248_10010002 3300009177 Bacteria 10441
182 Ga0105248_10010251 3300009177 Bacteria 10317
183 Ga0105248_10015484 3300009177 Bacteria 8407
184 Ga0105248_10036474 3300009177 Bacteria 5499
185 Ga0105248_10310692 3300009177 Bacteria 1775
186 Ga0105248_10472196 3300009177 Bacteria 1414
187 Ga0105248_10500643 3300009177 Bacteria 1370
188 Ga0105248_10526080 3300009177 Bacteria 1334
189 Ga0105248_10616811 3300009177 Bacteria 1224
190 Ga0105249_10040279 3300009553 Bacteria 4243
191 Ga0105249_10089432 3300009553 Bacteria 2878
192 Ga0105246_10063503 3300011119 Bacteria 2576
193 Ga0105246_10092278 3300011119 Bacteria 2185
194 Ga0157327_1004374 3300012512 Bacteria 1091
195 Ga0157373_10018646 3300013100 Bacteria 5050
196 Ga0157373_10038318 3300013100 Bacteria 3436
197 Ga0157373_10194631 3300013100 Bacteria 1429
198 Ga0157373_10241617 3300013100 Bacteria 1277
199 Ga0157369_10002493 3300013105 Bacteria 22063
200 Ga0157369_10242075 3300013105 Bacteria 1884
201 Ga0157374_10406098 3300013296 Bacteria 1359
202 Ga0157378_10153110 3300013297 Bacteria 2149
203 Ga0163162_10009361 3300013306 Bacteria 9525
204 Ga0163162_10090527 3300013306 Bacteria 3141
205 Ga0163162_10320695 3300013306 Bacteria 1682
206 Ga0157375_10112122 3300013308 Bacteria 2827
207 Ga0157375_10458525 3300013308 Bacteria 1440
208 Ga0163163_10000307 3300014325 Bacteria 48168
209 Ga0163163_10092057 3300014325 Unclassified 3047
210 Ga0157380_10009741 3300014326 Bacteria 6895
211 Ga0157380_10033760 3300014326 Bacteria 3942
212 Ga0157380_10814384 3300014326 Bacteria 952
213 Ga0182008_10155310 3300014497 Bacteria 1149
214 Ga0157379_10011314 3300014968 Bacteria 7778
215 Ga0157379_10363070 3300014968 Bacteria 1327
216 Ga0163161_10030812 3300017792 Bacteria 3819
217 Ga0163161_10068025 3300017792 Bacteria 2602
218 Ga0213875_10001046 3300021388 Bacteria 19467
219 Ga0207697_10012170 3300025315 Bacteria 3617
220 Ga0207696_1020379 3300025711 Bacteria 2141
221 Ga0207682_10001448 3300025893 Bacteria 10955
222 Ga0207682_10029502 3300025893 Bacteria 2193
223 Ga0207682_10049135 3300025893 Bacteria 1741
224 Ga0207710_10058608 3300025900 Bacteria 1741
225 Ga0207688_10029423 3300025901 Bacteria 3024
226 Ga0207688_10149983 3300025901 Bacteria 1377
227 Ga0207688_10182670 3300025901 Bacteria 1251
228 Ga0207680_10120023 3300025903 Bacteria 1718
229 Ga0207680_10428055 3300025903 Bacteria 938
230 Ga0207647_10015414 3300025904 Bacteria 5240
231 Ga0207647_10016791 3300025904 Bacteria 4988
232 Ga0207645_10028161 3300025907 Bacteria 3628
233 Ga0207705_10011438 3300025909 Bacteria 6422
234 Ga0207705_10042434 3300025909 Bacteria 3265
235 Ga0207705_10204444 3300025909 Bacteria 1497
236 Ga0207705_10252443 3300025909 Bacteria 1345
237 Ga0207705_10315244 3300025909 Bacteria 1201
238 Ga0207693_10120911 3300025915 Bacteria 2056
239 Ga0207662_10163888 3300025918 Bacteria 1422
240 Ga0207657_10012036 3300025919 Bacteria 8558
241 Ga0207657_10022935 3300025919 Bacteria 5824
242 Ga0207657_10048389 3300025919 Bacteria 3713
243 Ga0207649_10030568 3300025920 Bacteria 3192
244 Ga0207649_10065284 3300025920 Bacteria 2303
245 Ga0207649_10243692 3300025920 Bacteria 1291
246 Ga0207649_10384194 3300025920 Bacteria 1047
247 Ga0207652_10039973 3300025921 Bacteria 3982
248 Ga0207652_10070871 3300025921 Bacteria 3028
249 Ga0207681_10057474 3300025923 Bacteria 2659
250 Ga0207681_10188982 3300025923 Bacteria 1574
251 Ga0207659_10194420 3300025926 Bacteria 1616
252 Ga0207664_10244269 3300025929 Bacteria 1564
253 Ga0207644_10000052 3300025931 Bacteria 91473
254 Ga0207644_10003062 3300025931 Bacteria 10764
255 Ga0207644_10013892 3300025931 Bacteria 5379
256 Ga0207644_10026790 3300025931 Bacteria 3977
257 Ga0207644_10039361 3300025931 Bacteria 3336
258 Ga0207644_10087606 3300025931 Bacteria 2314
259 Ga0207644_10180377 3300025931 Bacteria 1654
260 Ga0207644_10318001 3300025931 Bacteria 1258
261 Ga0207644_10398874 3300025931 Bacteria 1124
262 Ga0207690_10016532 3300025932 Bacteria 4491
263 Ga0207690_10016810 3300025932 Bacteria 4457
264 Ga0207690_10077147 3300025932 Bacteria 2315
265 Ga0207690_10090793 3300025932 Bacteria 2157
266 Ga0207706_10000299 3300025933 Bacteria 53751
267 Ga0207706_10009249 3300025933 Bacteria 9054
268 Ga0207706_10009297 3300025933 Bacteria 9025
269 Ga0207706_10025399 3300025933 Bacteria 5308
270 Ga0207706_10047040 3300025933 Bacteria 3818
271 Ga0207706_10071290 3300025933 Bacteria 3056
272 Ga0207686_10302489 3300025934 Bacteria 1188
273 Ga0207709_10303028 3300025935 Bacteria 1189
274 Ga0207669_10017079 3300025937 Bacteria 3711
275 Ga0207669_10035772 3300025937 Bacteria 2830
276 Ga0207665_10065120 3300025939 Bacteria 2477
277 Ga0207691_10000765 3300025940 Bacteria 31799
278 Ga0207691_10042808 3300025940 Bacteria 4174
279 Ga0207691_10135850 3300025940 Bacteria 2169
280 Ga0207691_10362031 3300025940 Bacteria 1240
281 Ga0207691_10447372 3300025940 Bacteria 1100
282 Ga0207711_10000420 3300025941 Bacteria 44798
283 Ga0207711_10001243 3300025941 Bacteria 24174
284 Ga0207711_10006081 3300025941 Bacteria 10197
285 Ga0207711_10006371 3300025941 Bacteria 9947
286 Ga0207711_10062568 3300025941 Bacteria 3210
287 Ga0207711_10096157 3300025941 Bacteria 2613
288 Ga0207711_10382802 3300025941 Bacteria 1306
289 Ga0207711_10500069 3300025941 Bacteria 1133
290 Ga0207689_10050354 3300025942 Bacteria 3435
291 Ga0207679_10021413 3300025945 Bacteria 4383
292 Ga0207679_10031469 3300025945 Bacteria 3713
293 Ga0207679_10083298 3300025945 Bacteria 2451
294 Ga0207679_10162355 3300025945 Bacteria 1830
295 Ga0207679_10164998 3300025945 Bacteria 1817
296 Ga0207679_10187376 3300025945 Bacteria 1717
297 Ga0207667_10949867 3300025949 Bacteria 849
298 Ga0207651_10017325 3300025960 Bacteria 4254
299 Ga0207651_10036190 3300025960 Bacteria 3220
300 Ga0207651_10039183 3300025960 Bacteria 3122
301 Ga0207651_10048616 3300025960 Bacteria 2869
302 Ga0207651_10053889 3300025960 Bacteria 2752
303 Ga0207712_10039903 3300025961 Bacteria 3219
304 Ga0207712_10168002 3300025961 Bacteria 1712
305 Ga0207668_10034340 3300025972 Bacteria 3367
306 Ga0207640_10270707 3300025981 Bacteria 1329
307 Ga0207658_10010095 3300025986 Bacteria 6413
308 Ga0207658_10010272 3300025986 Bacteria 6360
309 Ga0207658_10038601 3300025986 Bacteria 3441
310 Ga0207658_10157388 3300025986 Bacteria 1858
311 Ga0207658_10191313 3300025986 Bacteria 1701
312 Ga0207658_10380388 3300025986 Bacteria 1236
313 Ga0207703_10014764 3300026035 Bacteria 6096
314 Ga0207703_10015617 3300026035 Bacteria 5923
315 Ga0207703_10131906 3300026035 Bacteria 2159
316 Ga0207639_10102963 3300026041 Bacteria 2312
317 Ga0207678_10040429 3300026067 Bacteria 4045
318 Ga0207678_10046207 3300026067 Bacteria 3765
319 Ga0207678_10063460 3300026067 Bacteria 3174
320 Ga0207678_10097907 3300026067 Bacteria 2506
321 Ga0207641_10000502 3300026088 Bacteria 44127
322 Ga0207641_10032553 3300026088 Bacteria 4328
323 Ga0207641_10033656 3300026088 Bacteria 4257
324 Ga0207641_10051398 3300026088 Bacteria 3490
325 Ga0207641_10084618 3300026088 Bacteria 2761
326 Ga0207641_10177002 3300026088 Bacteria 1951
327 Ga0207648_10008755 3300026089 Bacteria 9754
328 Ga0207648_10089716 3300026089 Bacteria 2686
329 Ga0207648_10216123 3300026089 Bacteria 1703
330 Ga0207676_10000694 3300026095 Bacteria 26554
331 Ga0207676_10002166 3300026095 Bacteria 14176
332 Ga0207676_10004533 3300026095 Bacteria 9828
333 Ga0207676_10122021 3300026095 Bacteria 2199
334 Ga0207676_10337350 3300026095 Bacteria 1389
335 Ga0207676_10449805 3300026095 Bacteria 1214
336 Ga0207676_10451026 3300026095 Bacteria 1212
337 Ga0207674_10000086 3300026116 Bacteria 100722
338 Ga0207674_10002589 3300026116 Bacteria 22783
339 Ga0207674_10048314 3300026116 Bacteria 4356
340 Ga0207674_10140417 3300026116 Bacteria 2375
341 Ga0207675_100032623 3300026118 Bacteria 4851
342 Ga0207675_100088082 3300026118 Bacteria 2916
343 Ga0207675_100523906 3300026118 Bacteria 1182
344 Ga0207683_10005095 3300026121 Bacteria 11274
345 Ga0207683_10043209 3300026121 Bacteria 3938
346 Ga0207698_10092001 3300026142 Bacteria 2485
347 Ga0207698_10104964 3300026142 Bacteria 2353
348 Ga0207698_10123447 3300026142 Bacteria 2197
349 Ga0207698_10165364 3300026142 Bacteria 1941
350 Ga0207698_10855946 3300026142 Bacteria 914
351 Ga0209970_1032022 3300027614 Bacteria 916
352 Ga0209974_10010160 3300027876 Bacteria 3179
353 Ga0268265_10003659 3300028380 Bacteria 10962
354 Ga0268265_10011100 3300028380 Bacteria 6087
355 Ga0268265_10046757 3300028380 Bacteria 3237
356 Ga0268265_10089082 3300028380 Bacteria 2460
357 Ga0268265_10335024 3300028380 Bacteria 1375
358 Ga0268264_10000410 3300028381 Bacteria 60680
359 Ga0268264_10000418 3300028381 Bacteria 59942
360 Ga0268264_10024906 3300028381 Bacteria 4890
361 Ga0268264_10199932 3300028381 Bacteria 1828
362 Ga0268264_10264832 3300028381 Bacteria 1603
363 Ga0268264_10739027 3300028381 Bacteria 979
364 Ga0265334_10039265 3300028573 Bacteria 1859
365 Ga0316182_1108277 3300030745 Bacteria 1697
366 Ga0265330_10021275 3300031235 Bacteria 2962
367 Ga0307513_10117555 3300031456 Bacteria 2636
368 Ga0307408_100076035 3300031548 Bacteria 2496
369 Ga0307408_100089857 3300031548 Bacteria 2316
370 Ga0307408_100094196 3300031548 Bacteria 2267
371 Ga0307408_100175578 3300031548 Bacteria 1714
372 Ga0307405_10022731 3300031731 Bacteria 3551
373 Ga0307405_10054188 3300031731 Bacteria 2502
374 Ga0307405_10105211 3300031731 Bacteria 1900
375 Ga0307405_10140027 3300031731 Bacteria 1685
376 Ga0307405_10624427 3300031731 Bacteria 882
377 Ga0307413_10000456 3300031824 Bacteria 13342
378 Ga0307413_10023856 3300031824 Bacteria 3322
379 Ga0307413_10303930 3300031824 Bacteria 1211
380 Ga0307413_10462631 3300031824 Bacteria 1009
381 Ga0307410_10000393 3300031852 Bacteria 17209
382 Ga0307410_10003164 3300031852 Bacteria 8189
383 Ga0307410_10004456 3300031852 Bacteria 7243
384 Ga0307410_10045082 3300031852 Bacteria 2933
385 Ga0307410_10059010 3300031852 Bacteria 2618
386 Ga0307410_10300655 3300031852 Bacteria 1266
387 Ga0307406_10041271 3300031901 Bacteria 2874
388 Ga0307406_10116982 3300031901 Bacteria 1846
389 Ga0307407_10002528 3300031903 Bacteria 7184
390 Ga0307407_10003078 3300031903 Bacteria 6731
391 Ga0307407_10158241 3300031903 Bacteria 1480
392 Ga0307407_10189653 3300031903 Bacteria 1369
393 Ga0307407_10431245 3300031903 Bacteria 952
394 Ga0307412_10006554 3300031911 Bacteria 6591
395 Ga0307412_10042145 3300031911 Bacteria 2963
396 Ga0307412_10274287 3300031911 Bacteria 1321
397 Ga0307409_100000418 3300031995 Bacteria 18065
398 Ga0307409_100011560 3300031995 Bacteria 5575
399 Ga0307409_100016495 3300031995 Bacteria 4888
400 Ga0307409_100039238 3300031995 Bacteria 3511
401 Ga0307409_100115379 3300031995 Bacteria 2261
402 Ga0307409_100138111 3300031995 Bacteria 2095
403 Ga0307409_100617882 3300031995 Bacteria 1073
404 Ga0307416_100007131 3300032002 Bacteria 7066
405 Ga0307416_100043277 3300032002 Bacteria 3524
406 Ga0307416_100099465 3300032002 Bacteria 2526
407 Ga0307416_100117870 3300032002 Bacteria 2358
408 Ga0307416_100177774 3300032002 Bacteria 1991
409 Ga0307416_100255557 3300032002 Bacteria 1708
410 Ga0307416_100292099 3300032002 Bacteria 1614
411 Ga0307416_101146597 3300032002 Bacteria 882
412 Ga0307414_10006871 3300032004 Bacteria 6367
413 Ga0307414_10036166 3300032004 Bacteria 3294
414 Ga0307414_10041174 3300032004 Bacteria 3126
415 Ga0307414_10768985 3300032004 Bacteria 876
416 Ga0307411_10009246 3300032005 Bacteria 5167
417 Ga0307411_10011297 3300032005 Bacteria 4812
418 Ga0307411_10018894 3300032005 Bacteria 3967
419 Ga0307411_10023982 3300032005 Bacteria 3627
420 Ga0307411_10026563 3300032005 Bacteria 3487
421 Ga0307411_10137703 3300032005 Bacteria 1795
422 Ga0307411_10285595 3300032005 Bacteria 1315
423 Ga0307415_100007620 3300032126 Bacteria 5935
424 Ga0307415_100012547 3300032126 Bacteria 4904
425 Ga0307415_100025634 3300032126 Bacteria 3704
426 Ga0307415_100029019 3300032126 Bacteria 3529
427 Ga0307415_100121998 3300032126 Bacteria 1956
428 Ga0307415_100519608 3300032126 Bacteria 1044
429 Ga0373934_0003383 3300035086 Bacteria 5841
430 Ga0373953_0000807 3300035117 Bacteria 8744
431 Ga0373954_0003796 3300035118 Bacteria 6448
432 Ga0373956_0008718 3300035119 Bacteria 4107
433 Ga0373957_0000854 3300035120 Bacteria 7968
434 Ga0373943_0002765 3300035170 Bacteria 7988
435 Ga0373955_0000373 3300035172 Bacteria 18929
436 Ga0373927_0070119 3300035695 Bacteria 2269
437 Ga0373933_0004235 3300035724 Bacteria 7905
438 Ga0373925_0182164 3300037068 Bacteria 1663
439 Ga0395899_0000302 3300037312 Bacteria 63367
440 Ga0395899_0010784 3300037312 Bacteria 7004
441 Ga0395899_0046160 3300037312 Bacteria 3245
442 Ga0395899_0046858 3300037312 Bacteria 3219
443 Ga0395899_0074724 3300037312 Bacteria 2475
444 Ga0395899_0084951 3300037312 Bacteria 2300
445 Ga0395899_0113071 3300037312 Bacteria 1950
446 Ga0395899_0114614 3300037312 Bacteria 1935
447 Ga0395899_0171669 3300037312 Bacteria 1527
448 Ga0395899_0354888 3300037312 Bacteria 980
449 Ga0395900_0007215 3300037418 Bacteria 11514
450 Ga0395900_0008571 3300037418 Bacteria 10510
451 Ga0395900_0009579 3300037418 Bacteria 9929
452 Ga0395900_0017256 3300037418 Bacteria 7367
453 Ga0395900_0029983 3300037418 Bacteria 5583
454 Ga0395900_0078313 3300037418 Bacteria 3396
455 Ga0395900_0085727 3300037418 Bacteria 3237
456 Ga0395900_0087720 3300037418 Bacteria 3197
457 Ga0395900_0165240 3300037418 Bacteria 2256
458 Ga0395900_0192872 3300037418 Bacteria 2065
459 Ga0395900_0197581 3300037418 Bacteria 2037
460 Ga0395900_0304863 3300037418 Bacteria 1577
461 Ga0395900_0322079 3300037418 Bacteria 1526
462 Ga0395900_0326679 3300037418 Bacteria 1513
463 Ga0395900_0370688 3300037418 Bacteria 1401
464 Ga0395898_0000054 3300037466 Bacteria 279561
465 Ga0395898_0001674 3300037466 Bacteria 29720
466 Ga0395898_0003637 3300037466 Bacteria 17137
467 Ga0395898_0048516 3300037466 Bacteria 4163
468 Ga0395898_0163288 3300037466 Bacteria 2130
469 Ga0395898_0168402 3300037466 Bacteria 2094
470 Ga0395898_0171256 3300037466 Bacteria 2076
471 Ga0395898_0446770 3300037466 Bacteria 1231
472 Ga0395905_0000046 3300037471 Bacteria 240463
473 Ga0395905_0000500 3300037471 Bacteria 53853
474 Ga0395905_0000886 3300037471 Bacteria 39025
475 Ga0395905_0002780 3300037471 Bacteria 19161
476 Ga0395905_0005100 3300037471 Bacteria 13501
477 Ga0395905_0006839 3300037471 Bacteria 11406
478 Ga0395905_0011712 3300037471 Bacteria 8466
479 Ga0395905_0013031 3300037471 Bacteria 7988
480 Ga0395905_0025708 3300037471 Bacteria 5551
481 Ga0395905_0026302 3300037471 Bacteria 5487
482 Ga0395905_0028313 3300037471 Bacteria 5281
483 Ga0395905_0031061 3300037471 Bacteria 5030
484 Ga0395905_0033274 3300037471 Bacteria 4843
485 Ga0395905_0038376 3300037471 Bacteria 4495
486 Ga0395905_0039983 3300037471 Bacteria 4400
487 Ga0395905_0044718 3300037471 Bacteria 4154
488 Ga0395905_0054666 3300037471 Bacteria 3736
489 Ga0395905_0105538 3300037471 Bacteria 2645
490 Ga0395905_0205245 3300037471 Bacteria 1847
491 Ga0395905_0297914 3300037471 Bacteria 1500
492 Ga0395905_0310092 3300037471 Bacteria 1466
493 Ga0395905_0481813 3300037471 Bacteria 1140
494 Ga0395905_0660102 3300037471 Bacteria 948
495 Ga0436364_0986946 3300037853 Bacteria 208509
496 Ga0395901_0000181 3300038443 Bacteria 81816
497 Ga0395901_0002142 3300038443 Bacteria 20180
498 Ga0395901_0002161 3300038443 Bacteria 20073
499 Ga0395901_0016015 3300038443 Bacteria 7638
500 Ga0395901_0040320 3300038443 Bacteria 4836
501 Ga0395901_0079087 3300038443 Bacteria 3433
502 Ga0395901_0091864 3300038443 Bacteria 3177
503 Ga0395901_0128239 3300038443 Unclassified 2666
504 Ga0395901_0150608 3300038443 Bacteria 2444
505 Ga0395901_0181409 3300038443 Bacteria 2208
506 Ga0395901_0185298 3300038443 Bacteria 2183
507 Ga0395901_0509315 3300038443 Bacteria 1224
508 Ga0395901_0566880 3300038443 Bacteria 1149
509 Ga0436365_1237401 3300039437 Bacteria 6540
510 Ga0439448_0020938 3300042005 Bacteria 2027
511 Ga0439432_014439 3300042006 Bacteria 2673
512 Ga0439432_029495 3300042006 Bacteria 1783
513 Ga0450889_000026 3300042144 Bacteria 12524
514 Ga0439458_0000006 3300042157 Bacteria 32402
515 Ga0466963_0066238 3300044694 Bacteria 2423
516 Ga0466963_0089857 3300044694 Bacteria 2090
517 Ga0466967_0168666 3300045976 Bacteria 2058
518 Ga0466967_0253171 3300045976 Bacteria 1683
519 Ga0466967_0299516 3300045976 Bacteria 1547
520 Ga0466967_0322300 3300045976 Bacteria 1490
521 Ga0495592_0004664 3300046454 Bacteria 10042
522 Ga0495629_0001178 3300046459 Bacteria 20631
523 Ga0495653_0000649 3300046463 Bacteria 26543
524 Ga0495585_0037570 3300046492 Bacteria 2727
525 Ga0495608_0000370 3300046511 Bacteria 31473
526 Ga0495618_0023380 3300046514 Bacteria 3821
527 Ga0495628_0003886 3300046516 Bacteria 13316
528 Ga0495663_0019439 3300046525 Bacteria 1944
529 Ga0495663_0045361 3300046525 Bacteria 1348
530 Ga0495642_0031658 3300046528 Bacteria 2121
531 Ga0495642_0120310 3300046528 Bacteria 1126
532 Ga0495652_0004487 3300046529 Bacteria 13323
533 Ga0495640_0018949 3300046533 Bacteria 5090
534 Ga0495587_0007276 3300046536 Bacteria 7175
535 Ga0495621_0007952 3300046539 Bacteria 3158
536 Ga0495621_0012851 3300046539 Bacteria 2618
537 Ga0495645_0009816 3300046543 Bacteria 6696
538 Ga0495667_0001867 3300046559 Bacteria 13981
539 Ga0495634_0055780 3300046642 Bacteria 2641
540 Ga0495635_0001073 3300046663 Bacteria 18141
541 Ga0495659_0003471 3300046664 Bacteria 5030
542 Ga0495657_0013088 3300046675 Bacteria 6132
543 Ga0495599_0000475 3300046678 Bacteria 22902
544 Ga0495623_0001366 3300046679 Bacteria 16548
545 Ga0495669_0000089 3300046684 Bacteria 60373
546 Ga0495669_0001738 3300046684 Bacteria 8920
547 Ga0495669_0009229 3300046684 Bacteria 4157
548 Ga0495669_0015740 3300046684 Bacteria 3238
549 Ga0495669_0038151 3300046684 Bacteria 2127
550 Ga0495669_0044579 3300046684 Bacteria 1976
551 Ga0495669_0104520 3300046684 Bacteria 1318
552 Ga0495669_0160478 3300046684 Bacteria 1067
553 Ga0495613_0095125 3300046689 Bacteria 2155
554 Ga0495670_0067580 3300046691 Bacteria 1804
555 Ga0495604_0003287 3300047317 Bacteria 12904
556 Ga0495636_0040746 3300047318 Bacteria 1926
557 Ga0495674_0006675 3300047319 Bacteria 11060
558 Ga0495680_0001144 3300047322 Bacteria 29215
559 Ga0495675_0010681 3300047444 Bacteria 5743
560 Ga0495677_0003604 3300047445 Bacteria 6007
561 Ga0495677_0028989 3300047445 Bacteria 2012
562 Ga0495677_0072815 3300047445 Bacteria 1282
563 Ga0495677_0184714 3300047445 Bacteria 808
564 Ga0495684_0000227 3300047471 Bacteria 44020
565 Ga0495593_0000615 3300047673 Bacteria 20374
566 Ga0495602_0009537 3300048088 Bacteria 10089
567 Ga0495615_0077002 3300048090 Bacteria 909
568 Ga0496100_0286880 3300048903 Bacteria 1229
569 Ga0496102_0595125 3300048905 Bacteria 1029
570 Ga0496105_0049892 3300048908 Bacteria 3457
571 Ga0496106_0060393 3300048909 Bacteria 2874
572 Ga0496107_0069625 3300048910 Bacteria 2554
573 Ga0496107_0080872 3300048910 Bacteria 2370
574 Ga0496107_0124982 3300048910 Bacteria 1897
575 Ga0496107_0166587 3300048910 Bacteria 1634
576 Ga0496108_0008282 3300048911 Bacteria 8432
577 Ga0496108_0012900 3300048911 Bacteria 6809
578 Ga0496108_0431877 3300048911 Bacteria 1150
579 Ga0496109_0000610 3300048912 Bacteria 29899
580 Ga0496109_0184811 3300048912 Bacteria 1958
581 Ga0496110_0042617 3300048913 Bacteria 3962
582 Ga0496110_0124861 3300048913 Bacteria 2321
583 Ga0496111_0056000 3300048914 Bacteria 2852
584 Ga0496111_0139446 3300048914 Bacteria 1796
585 Ga0496111_0197942 3300048914 Bacteria 1494
586 Ga0496112_0004014 3300048915 Bacteria 12339
587 Ga0496112_0029745 3300048915 Bacteria 5284
588 Ga0496112_0084881 3300048915 Bacteria 3132
589 Ga0496112_0126185 3300048915 Bacteria 2530
590 Ga0496112_0271166 3300048915 Bacteria 1645
591 Ga0496113_0000952 3300048916 Bacteria 15412
592 Ga0496113_0003882 3300048916 Bacteria 9051
593 Ga0496113_0113320 3300048916 Bacteria 2113
594 Ga0496114_0353456 3300048917 Bacteria 1300
595 Ga0496115_0025556 3300048918 Bacteria 4599
596 Ga0501292_040616 3300049515 Bacteria 803
597 Ga0501067_0021297 3300049583 Bacteria 3587
598 Ga0501067_0127853 3300049583 Bacteria 1414
599 Ga0501068_0103677 3300049584 Bacteria 1764
600 Ga0501223_019090 3300049663 Bacteria 1348
601 Ga0501233_060988 3300049668 Bacteria 936
602 Ga0501249_009214 3300049679 Bacteria 2053
603 Ga0501257_074204 3300049686 Bacteria 872
604 Ga0501258_002637 3300049687 Bacteria 1591
605 Ga0501234_006090 3300049707 Bacteria 1889
606 Ga0501262_029681 3300049759 Bacteria 783
607 Ga0501268_001525 3300049765 Bacteria 2900
608 Ga0501268_014389 3300049765 Bacteria 1289
609 nmdc:mga03683_8044_c1 3300050489 Bacteria 3690
610 nmdc:mga06r32_34683_c1 3300050510 Bacteria 4759
611 nmdc:mga08y16_215338_c1 3300050511 Bacteria 1989
612 nmdc:mga08y16_564570_c1 3300050511 Bacteria 1150
613 Ga0495601_0001461 3300053077 Bacteria 13022
614 Ga0495595_0000709 3300053084 Bacteria 12704
615 Ga0495619_0000561 3300053085 Bacteria 24566
616 Ga0500616_0034045 3300053153 Bacteria 2777

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002244 JGI24742J22300_10039564 JGI24742J22300_100395642 205
2 3300048915 Ga0496112_0126185 Ga0496112_0126185_788_1498 220
3 3300031548 Ga0307408_100094196 Ga0307408_1000941963 222
4 3300005327 Ga0070658_10067826 Ga0070658_100678263 225
5 3300005344 Ga0070661_100287209 Ga0070661_1002872091 225
6 3300005364 Ga0070673_100096424 Ga0070673_1000964243 225
7 3300005614 Ga0068856_100277447 Ga0068856_1002774471 225
8 3300005616 Ga0068852_100145130 Ga0068852_1001451303 225
9 3300005618 Ga0068864_100296904 Ga0068864_1002969042 225
10 3300006237 Ga0097621_100242515 Ga0097621_1002425152 225
11 3300009177 Ga0105248_10015484 Ga0105248_100154843 225
12 3300013296 Ga0157374_10406098 Ga0157374_104060982 225
13 3300025920 Ga0207649_10243692 Ga0207649_102436922 225
14 3300025931 Ga0207644_10039361 Ga0207644_100393613 225
15 3300025941 Ga0207711_10096157 Ga0207711_100961573 225
16 3300025960 Ga0207651_10036190 Ga0207651_100361904 225
17 3300026095 Ga0207676_10337350 Ga0207676_103373502 225
18 3300026142 Ga0207698_10123447 Ga0207698_101234472 225
19 3300037471 Ga0395905_0205245 Ga0395905_0205245_868_1605 225
20 3300048903 Ga0496100_0286880 Ga0496100_0286880_25_762 225
21 3300048908 Ga0496105_0049892 Ga0496105_0049892_848_1585 225
22 3300048912 Ga0496109_0184811 Ga0496109_0184811_110_847 225
23 3300048914 Ga0496111_0056000 Ga0496111_0056000_935_1672 225
24 3300048915 Ga0496112_0084881 Ga0496112_0084881_1078_1815 225
25 3300048916 Ga0496113_0113320 Ga0496113_0113320_352_1089 225
26 3300005327 Ga0070658_10463130 Ga0070658_104631301 226
27 3300025909 Ga0207705_10204444 Ga0207705_102044443 226
28 3300005353 Ga0070669_100034942 Ga0070669_1000349421 227
29 3300005355 Ga0070671_100023390 Ga0070671_1000233907 227
30 3300005364 Ga0070673_100078110 Ga0070673_1000781105 227
31 3300005367 Ga0070667_100022426 Ga0070667_1000224263 227
32 3300005617 Ga0068859_100000685 Ga0068859_1000006852 227
33 3300005618 Ga0068864_100000847 Ga0068864_1000008475 227
34 3300005841 Ga0068863_100009665 Ga0068863_1000096654 227
35 3300005842 Ga0068858_100000655 Ga0068858_1000006559 227
36 3300005843 Ga0068860_100167202 Ga0068860_1001672022 227
37 3300005844 Ga0068862_100103999 Ga0068862_1001039992 227
38 3300006931 Ga0097620_100000685 Ga0097620_10000068531 227
39 3300009092 Ga0105250_10008687 Ga0105250_100086872 227
40 3300009101 Ga0105247_10170555 Ga0105247_101705553 227
41 3300009177 Ga0105248_10002811 Ga0105248_100028119 227
42 3300009553 Ga0105249_10040279 Ga0105249_100402794 227
43 3300013306 Ga0163162_10009361 Ga0163162_100093619 227
44 3300013308 Ga0157375_10458525 Ga0157375_104585252 227
45 3300014325 Ga0163163_10000307 Ga0163163_1000030728 227
46 3300014968 Ga0157379_10011314 Ga0157379_100113145 227
47 3300025711 Ga0207696_1020379 Ga0207696_10203792 227
48 3300025900 Ga0207710_10058608 Ga0207710_100586083 227
49 3300025923 Ga0207681_10057474 Ga0207681_100574744 227
50 3300025931 Ga0207644_10013892 Ga0207644_100138927 227
51 3300025941 Ga0207711_10001243 Ga0207711_1000124323 227
52 3300025960 Ga0207651_10053889 Ga0207651_100538892 227
53 3300025961 Ga0207712_10039903 Ga0207712_100399034 227
54 3300025986 Ga0207658_10010272 Ga0207658_100102722 227
55 3300026035 Ga0207703_10015617 Ga0207703_100156179 227
56 3300026088 Ga0207641_10000502 Ga0207641_1000050225 227
57 3300026095 Ga0207676_10000694 Ga0207676_1000069427 227
58 3300028381 Ga0268264_10000410 Ga0268264_1000041033 227
59 3300028381 Ga0268264_10000418 Ga0268264_1000041827 227
60 3300006175 Ga0070712_100101670 Ga0070712_1001016702 228
61 3300025915 Ga0207693_10120911 Ga0207693_101209112 228
62 3300031995 Ga0307409_100617882 Ga0307409_1006178822 229
63 3300009177 Ga0105248_10002158 Ga0105248_1000215818 230
64 3300048911 Ga0496108_0012900 Ga0496108_0012900_616_1353 230
65 3300048914 Ga0496111_0139446 Ga0496111_0139446_233_970 230
66 3300048915 Ga0496112_0004014 Ga0496112_0004014_10171_10908 230
67 3300048916 Ga0496113_0000952 Ga0496113_0000952_2983_3720 230
68 3300037312 Ga0395899_0084951 Ga0395899_0084951_255_1001 231
69 3300037418 Ga0395900_0029983 Ga0395900_0029983_3207_3953 231
70 3300038443 Ga0395901_0509315 Ga0395901_0509315_357_1103 231
71 3300009177 Ga0105248_10010251 Ga0105248_100102514 232
72 3300013306 Ga0163162_10090527 Ga0163162_100905275 232
73 3300014968 Ga0157379_10363070 Ga0157379_103630702 232
74 3300025941 Ga0207711_10006081 Ga0207711_100060814 232
75 3300048914 Ga0496111_0197942 Ga0496111_0197942_557_1297 232
76 3300003322 rootL2_10227603 rootL2_102276033 233
77 3300005985 Ga0081539_10043435 Ga0081539_100434353 233
78 3300013308 Ga0157375_10112122 Ga0157375_101121221 233
79 3300005546 Ga0070696_100098641 Ga0070696_1000986412 234
80 3300005339 Ga0070660_100109272 Ga0070660_1001092722 235
81 3300013100 Ga0157373_10038318 Ga0157373_100383182 235
82 3300037312 Ga0395899_0074724 Ga0395899_0074724_767_1516 235
83 3300037312 Ga0395899_0171669 Ga0395899_0171669_646_1380 235
84 3300037418 Ga0395900_0192872 Ga0395900_0192872_1138_1887 235
85 3300037418 Ga0395900_0370688 Ga0395900_0370688_442_1191 235
86 3300037471 Ga0395905_0310092 Ga0395905_0310092_664_1413 235
87 3300038443 Ga0395901_0091864 Ga0395901_0091864_24_773 235
88 3300005331 Ga0070670_100058060 Ga0070670_1000580602 236
89 3300005347 Ga0070668_100371657 Ga0070668_1003716572 236
90 3300025931 Ga0207644_10000052 Ga0207644_100000525 236
91 3300025941 Ga0207711_10000420 Ga0207711_1000042016 236
92 3300049687 Ga0501258_002637 Ga0501258_002637_410_1123 237
93 3300049759 Ga0501262_029681 Ga0501262_029681_15_728 237
94 3300005844 Ga0068862_100042308 Ga0068862_1000423082 238
95 3300028380 Ga0268265_10046757 Ga0268265_100467574 238
96 3300048905 Ga0496102_0595125 Ga0496102_0595125_139_861 238
97 3300013100 Ga0157373_10018646 Ga0157373_100186464 239
98 3300013297 Ga0157378_10153110 Ga0157378_101531104 240
99 3300014497 Ga0182008_10155310 Ga0182008_101553101 240
100 3300028573 Ga0265334_10039265 Ga0265334_100392652 240
101 3300031235 Ga0265330_10021275 Ga0265330_100212752 240
102 3300035086 Ga0373934_0003383 Ga0373934_0003383_4013_4735 240
103 3300035117 Ga0373953_0000807 Ga0373953_0000807_5617_6339 240
104 3300035118 Ga0373954_0003796 Ga0373954_0003796_2232_2954 240
105 3300035119 Ga0373956_0008718 Ga0373956_0008718_351_1073 240
106 3300035120 Ga0373957_0000854 Ga0373957_0000854_419_1141 240
107 3300035172 Ga0373955_0000373 Ga0373955_0000373_7185_7907 240
108 3300035724 Ga0373933_0004235 Ga0373933_0004235_6609_7331 240
109 3300037312 Ga0395899_0000302 Ga0395899_0000302_40771_41493 240
110 3300037312 Ga0395899_0113071 Ga0395899_0113071_1082_1804 240
111 3300037418 Ga0395900_0007215 Ga0395900_0007215_2751_3473 240
112 3300037466 Ga0395898_0000054 Ga0395898_0000054_61712_62434 240
113 3300037466 Ga0395898_0001674 Ga0395898_0001674_18087_18809 240
114 3300037471 Ga0395905_0000046 Ga0395905_0000046_22718_23440 240
115 3300037471 Ga0395905_0002780 Ga0395905_0002780_18034_18756 240
116 3300038443 Ga0395901_0002142 Ga0395901_0002142_4589_5311 240
117 3300038443 Ga0395901_0002161 Ga0395901_0002161_15592_16314 240
118 3300044694 Ga0466963_0066238 Ga0466963_0066238_1552_2289 240
119 3300045976 Ga0466967_0168666 Ga0466967_0168666_22_765 240
120 3300045976 Ga0466967_0253171 Ga0466967_0253171_494_1228 240
121 3300046454 Ga0495592_0004664 Ga0495592_0004664_2136_2858 240
122 3300046459 Ga0495629_0001178 Ga0495629_0001178_13300_14022 240
123 3300046463 Ga0495653_0000649 Ga0495653_0000649_20486_21208 240
124 3300046511 Ga0495608_0000370 Ga0495608_0000370_24142_24864 240
125 3300046514 Ga0495618_0023380 Ga0495618_0023380_1772_2494 240
126 3300046516 Ga0495628_0003886 Ga0495628_0003886_8436_9158 240
127 3300046529 Ga0495652_0004487 Ga0495652_0004487_7185_7907 240
128 3300046533 Ga0495640_0018949 Ga0495640_0018949_1321_2043 240
129 3300046536 Ga0495587_0007276 Ga0495587_0007276_2447_3169 240
130 3300046543 Ga0495645_0009816 Ga0495645_0009816_2258_2980 240
131 3300046559 Ga0495667_0001867 Ga0495667_0001867_6075_6797 240
132 3300046642 Ga0495634_0055780 Ga0495634_0055780_1789_2511 240
133 3300046663 Ga0495635_0001073 Ga0495635_0001073_4183_4905 240
134 3300046675 Ga0495657_0013088 Ga0495657_0013088_1228_1950 240
135 3300046678 Ga0495599_0000475 Ga0495599_0000475_16563_17285 240
136 3300046679 Ga0495623_0001366 Ga0495623_0001366_6482_7204 240
137 3300046689 Ga0495613_0095125 Ga0495613_0095125_399_1121 240
138 3300047317 Ga0495604_0003287 Ga0495604_0003287_7634_8356 240
139 3300047319 Ga0495674_0006675 Ga0495674_0006675_7845_8567 240
140 3300047322 Ga0495680_0001144 Ga0495680_0001144_8033_8755 240
141 3300047444 Ga0495675_0010681 Ga0495675_0010681_1989_2711 240
142 3300047471 Ga0495684_0000227 Ga0495684_0000227_8723_9445 240
143 3300047673 Ga0495593_0000615 Ga0495593_0000615_10566_11288 240
144 3300048088 Ga0495602_0009537 Ga0495602_0009537_5136_5858 240
145 3300048912 Ga0496109_0000610 Ga0496109_0000610_15549_16286 240
146 3300048913 Ga0496110_0124861 Ga0496110_0124861_1114_1851 240
147 3300048915 Ga0496112_0029745 Ga0496112_0029745_845_1567 240
148 3300048916 Ga0496113_0003882 Ga0496113_0003882_5227_5949 240
149 3300053077 Ga0495601_0001461 Ga0495601_0001461_4610_5332 240
150 3300053084 Ga0495595_0000709 Ga0495595_0000709_4237_4959 240
151 3300053085 Ga0495619_0000561 Ga0495619_0000561_11345_12067 240
152 3300009177 Ga0105248_10616811 Ga0105248_106168112 241
153 3300048917 Ga0496114_0353456 Ga0496114_0353456_175_909 241
154 3300046684 Ga0495669_0009229 Ga0495669_0009229_82_810 242
155 3300005719 Ga0068861_100367393 Ga0068861_1003673931 243
156 3300006237 Ga0097621_100097142 Ga0097621_1000971425 243
157 3300006358 Ga0068871_100011802 Ga0068871_1000118026 243
158 3300021388 Ga0213875_10001046 Ga0213875_1000104610 243
159 3300026118 Ga0207675_100523906 Ga0207675_1005239062 243
160 3300031548 Ga0307408_100076035 Ga0307408_1000760355 243
161 3300031731 Ga0307405_10624427 Ga0307405_106244271 243
162 3300031824 Ga0307413_10462631 Ga0307413_104626312 243
163 3300031852 Ga0307410_10004456 Ga0307410_100044561 243
164 3300031852 Ga0307410_10300655 Ga0307410_103006553 243
165 3300031903 Ga0307407_10002528 Ga0307407_1000252811 243
166 3300031903 Ga0307407_10431245 Ga0307407_104312451 243
167 3300031911 Ga0307412_10006554 Ga0307412_1000655410 243
168 3300031995 Ga0307409_100039238 Ga0307409_1000392381 243
169 3300032002 Ga0307416_100007131 Ga0307416_10000713111 243
170 3300032002 Ga0307416_101146597 Ga0307416_1011465971 243
171 3300032004 Ga0307414_10768985 Ga0307414_107689851 243
172 3300032005 Ga0307411_10285595 Ga0307411_102855952 243
173 3300032126 Ga0307415_100519608 Ga0307415_1005196082 243
174 3300037312 Ga0395899_0046160 Ga0395899_0046160_508_1239 243
175 3300037418 Ga0395900_0008571 Ga0395900_0008571_5951_6682 243
176 3300037471 Ga0395905_0013031 Ga0395905_0013031_5086_5817 243
177 3300037471 Ga0395905_0025708 Ga0395905_0025708_4290_5021 243
178 3300037853 Ga0436364_0986946 Ga0436364_0986946_179149_179880 243
179 3300038443 Ga0395901_0150608 Ga0395901_0150608_403_1134 243
180 3300042006 Ga0439432_014439 Ga0439432_014439_321_1052 243
181 3300048913 Ga0496110_0042617 Ga0496110_0042617_3218_3949 243
182 3300049515 Ga0501292_040616 Ga0501292_040616_28_759 243
183 3300049663 Ga0501223_019090 Ga0501223_019090_388_1119 243
184 3300049707 Ga0501234_006090 Ga0501234_006090_20_751 243
185 3300049765 Ga0501268_014389 Ga0501268_014389_465_1196 243
186 3300005293 Ga0065715_10091270 Ga0065715_100912705 244
187 3300005331 Ga0070670_100001186 Ga0070670_1000011862 244
188 3300005331 Ga0070670_100016571 Ga0070670_1000165714 244
189 3300005333 Ga0070677_10013309 Ga0070677_100133094 244
190 3300005333 Ga0070677_10086012 Ga0070677_100860122 244
191 3300005333 Ga0070677_10126703 Ga0070677_101267032 244
192 3300005335 Ga0070666_10147928 Ga0070666_101479282 244
193 3300005340 Ga0070689_100120587 Ga0070689_1001205873 244
194 3300005344 Ga0070661_100014342 Ga0070661_1000143422 244
195 3300005347 Ga0070668_100035488 Ga0070668_1000354883 244
196 3300005347 Ga0070668_100426448 Ga0070668_1004264481 244
197 3300005347 Ga0070668_100615816 Ga0070668_1006158162 244
198 3300005353 Ga0070669_100016538 Ga0070669_1000165384 244
199 3300005353 Ga0070669_100091705 Ga0070669_1000917051 244
200 3300005354 Ga0070675_100009019 Ga0070675_1000090196 244
201 3300005355 Ga0070671_100000051 Ga0070671_10000005122 244
202 3300005355 Ga0070671_100036881 Ga0070671_1000368812 244
203 3300005356 Ga0070674_100070580 Ga0070674_1000705803 244
204 3300005364 Ga0070673_100108272 Ga0070673_1001082722 244
205 3300005367 Ga0070667_100018227 Ga0070667_1000182274 244
206 3300005456 Ga0070678_100010816 Ga0070678_1000108162 244
207 3300005456 Ga0070678_100025742 Ga0070678_1000257423 244
208 3300005456 Ga0070678_100436067 Ga0070678_1004360671 244
209 3300005457 Ga0070662_100002559 Ga0070662_1000025599 244
210 3300005457 Ga0070662_100005921 Ga0070662_1000059212 244
211 3300005457 Ga0070662_100049117 Ga0070662_1000491173 244
212 3300005459 Ga0068867_100133078 Ga0068867_1001330783 244
213 3300005539 Ga0068853_100046035 Ga0068853_1000460352 244
214 3300005543 Ga0070672_100000170 Ga0070672_10000017016 244
215 3300005543 Ga0070672_100034628 Ga0070672_1000346286 244
216 3300005543 Ga0070672_100040819 Ga0070672_1000408194 244
217 3300005564 Ga0070664_100033148 Ga0070664_1000331483 244
218 3300005577 Ga0068857_100332636 Ga0068857_1003326363 244
219 3300005617 Ga0068859_100017516 Ga0068859_1000175162 244
220 3300005618 Ga0068864_100077259 Ga0068864_1000772593 244
221 3300005719 Ga0068861_100091426 Ga0068861_1000914262 244
222 3300005841 Ga0068863_100299722 Ga0068863_1002997222 244
223 3300005843 Ga0068860_100112868 Ga0068860_1001128682 244
224 3300005844 Ga0068862_100009116 Ga0068862_1000091167 244
225 3300006847 Ga0075431_100072938 Ga0075431_1000729382 244
226 3300006931 Ga0097620_100017516 Ga0097620_1000175167 244
227 3300009148 Ga0105243_10486280 Ga0105243_104862802 244
228 3300009176 Ga0105242_10115602 Ga0105242_101156022 244
229 3300009177 Ga0105248_10472196 Ga0105248_104721962 244
230 3300009553 Ga0105249_10089432 Ga0105249_100894323 244
231 3300013306 Ga0163162_10320695 Ga0163162_103206951 244
232 3300014326 Ga0157380_10009741 Ga0157380_100097414 244
233 3300014326 Ga0157380_10033760 Ga0157380_100337603 244
234 3300017792 Ga0163161_10068025 Ga0163161_100680251 244
235 3300025315 Ga0207697_10012170 Ga0207697_100121704 244
236 3300025893 Ga0207682_10001448 Ga0207682_100014484 244
237 3300025901 Ga0207688_10149983 Ga0207688_101499832 244
238 3300025901 Ga0207688_10182670 Ga0207688_101826702 244
239 3300025903 Ga0207680_10120023 Ga0207680_101200231 244
240 3300025920 Ga0207649_10065284 Ga0207649_100652842 244
241 3300025931 Ga0207644_10003062 Ga0207644_1000306213 244
242 3300025931 Ga0207644_10180377 Ga0207644_101803772 244
243 3300025933 Ga0207706_10009249 Ga0207706_100092492 244
244 3300025933 Ga0207706_10009297 Ga0207706_100092977 244
245 3300025933 Ga0207706_10047040 Ga0207706_100470404 244
246 3300025934 Ga0207686_10302489 Ga0207686_103024891 244
247 3300025935 Ga0207709_10303028 Ga0207709_103030282 244
248 3300025937 Ga0207669_10017079 Ga0207669_100170793 244
249 3300025937 Ga0207669_10035772 Ga0207669_100357722 244
250 3300025940 Ga0207691_10000765 Ga0207691_1000076525 244
251 3300025940 Ga0207691_10042808 Ga0207691_100428084 244
252 3300025940 Ga0207691_10135850 Ga0207691_101358504 244
253 3300025941 Ga0207711_10382802 Ga0207711_103828022 244
254 3300025945 Ga0207679_10021413 Ga0207679_100214135 244
255 3300025945 Ga0207679_10164998 Ga0207679_101649982 244
256 3300025960 Ga0207651_10039183 Ga0207651_100391832 244
257 3300025960 Ga0207651_10048616 Ga0207651_100486164 244
258 3300025961 Ga0207712_10168002 Ga0207712_101680022 244
259 3300025972 Ga0207668_10034340 Ga0207668_100343404 244
260 3300025986 Ga0207658_10191313 Ga0207658_101913131 244
261 3300026041 Ga0207639_10102963 Ga0207639_101029632 244
262 3300026067 Ga0207678_10063460 Ga0207678_100634602 244
263 3300026089 Ga0207648_10008755 Ga0207648_100087556 244
264 3300026095 Ga0207676_10122021 Ga0207676_101220214 244
265 3300026095 Ga0207676_10451026 Ga0207676_104510262 244
266 3300026116 Ga0207674_10140417 Ga0207674_101404174 244
267 3300026118 Ga0207675_100032623 Ga0207675_1000326232 244
268 3300026121 Ga0207683_10005095 Ga0207683_1000509510 244
269 3300026121 Ga0207683_10043209 Ga0207683_100432094 244
270 3300028380 Ga0268265_10011100 Ga0268265_100111004 244
271 3300028381 Ga0268264_10739027 Ga0268264_107390271 244
272 3300030745 Ga0316182_1108277 Ga0316182_11082773 244
273 3300031824 Ga0307413_10000456 Ga0307413_1000045612 244
274 3300031852 Ga0307410_10000393 Ga0307410_1000039310 244
275 3300031911 Ga0307412_10274287 Ga0307412_102742872 244
276 3300031995 Ga0307409_100000418 Ga0307409_1000004187 244
277 3300032004 Ga0307414_10006871 Ga0307414_100068717 244
278 3300032005 Ga0307411_10026563 Ga0307411_100265635 244
279 3300037466 Ga0395898_0171256 Ga0395898_0171256_750_1493 244
280 3300037471 Ga0395905_0000500 Ga0395905_0000500_30525_31268 244
281 3300038443 Ga0395901_0000181 Ga0395901_0000181_29605_30348 244
282 3300046525 Ga0495663_0019439 Ga0495663_0019439_818_1552 244
283 3300046528 Ga0495642_0031658 Ga0495642_0031658_496_1230 244
284 3300046539 Ga0495621_0007952 Ga0495621_0007952_447_1181 244
285 3300046539 Ga0495621_0012851 Ga0495621_0012851_1458_2216 244
286 3300046664 Ga0495659_0003471 Ga0495659_0003471_2958_3692 244
287 3300046684 Ga0495669_0160478 Ga0495669_0160478_53_787 244
288 3300046691 Ga0495670_0067580 Ga0495670_0067580_428_1162 244
289 3300047318 Ga0495636_0040746 Ga0495636_0040746_287_1021 244
290 3300047445 Ga0495677_0072815 Ga0495677_0072815_204_938 244
291 3300048090 Ga0495615_0077002 Ga0495615_0077002_19_753 244
292 3300050510 nmdc:mga06r32_34683_c1 nmdc:mga06r32_34683_c1_3502_4236 244
293 3300005328 Ga0070676_10036889 Ga0070676_100368892 245
294 3300005336 Ga0070680_100121271 Ga0070680_1001212712 245
295 3300005455 Ga0070663_100179938 Ga0070663_1001799382 245
296 3300005457 Ga0070662_100001195 Ga0070662_1000011956 245
297 3300005459 Ga0068867_100152249 Ga0068867_1001522492 245
298 3300005530 Ga0070679_100070254 Ga0070679_1000702542 245
299 3300005563 Ga0068855_100592673 Ga0068855_1005926731 245
300 3300005564 Ga0070664_100289239 Ga0070664_1002892393 245
301 3300025907 Ga0207645_10028161 Ga0207645_100281613 245
302 3300025921 Ga0207652_10039973 Ga0207652_100399736 245
303 3300025933 Ga0207706_10000299 Ga0207706_1000029951 245
304 3300025945 Ga0207679_10187376 Ga0207679_101873763 245
305 3300026067 Ga0207678_10040429 Ga0207678_100404294 245
306 3300026089 Ga0207648_10216123 Ga0207648_102161232 245
307 3300031903 Ga0307407_10158241 Ga0307407_101582413 245
308 3300032002 Ga0307416_100177774 Ga0307416_1001777742 245
309 3300032005 Ga0307411_10137703 Ga0307411_101377032 245
310 3300037312 Ga0395899_0354888 Ga0395899_0354888_79_819 245
311 3300037418 Ga0395900_0197581 Ga0395900_0197581_1214_1954 245
312 3300046528 Ga0495642_0120310 Ga0495642_0120310_170_922 245
313 3300047445 Ga0495677_0003604 Ga0495677_0003604_3785_4537 245
314 3300002067 JGI24735J21928_10003578 JGI24735J21928_100035786 246
315 3300005327 Ga0070658_10014827 Ga0070658_100148273 246
316 3300005327 Ga0070658_10273656 Ga0070658_102736563 246
317 3300005327 Ga0070658_10594960 Ga0070658_105949601 246
318 3300005331 Ga0070670_100054799 Ga0070670_1000547994 246
319 3300005333 Ga0070677_10064672 Ga0070677_100646722 246
320 3300005335 Ga0070666_10271933 Ga0070666_102719331 246
321 3300005339 Ga0070660_100034999 Ga0070660_1000349993 246
322 3300005339 Ga0070660_100549275 Ga0070660_1005492751 246
323 3300005340 Ga0070689_100326175 Ga0070689_1003261752 246
324 3300005344 Ga0070661_100190311 Ga0070661_1001903111 246
325 3300005344 Ga0070661_100571582 Ga0070661_1005715821 246
326 3300005347 Ga0070668_100272100 Ga0070668_1002721002 246
327 3300005353 Ga0070669_100012623 Ga0070669_1000126236 246
328 3300005353 Ga0070669_100099311 Ga0070669_1000993114 246
329 3300005354 Ga0070675_100223641 Ga0070675_1002236412 246
330 3300005354 Ga0070675_100247536 Ga0070675_1002475363 246
331 3300005355 Ga0070671_100042452 Ga0070671_1000424525 246
332 3300005355 Ga0070671_100066228 Ga0070671_1000662282 246
333 3300005355 Ga0070671_100131362 Ga0070671_1001313623 246
334 3300005355 Ga0070671_100241992 Ga0070671_1002419921 246
335 3300005364 Ga0070673_100367821 Ga0070673_1003678211 246
336 3300005366 Ga0070659_100008617 Ga0070659_1000086174 246
337 3300005366 Ga0070659_100138163 Ga0070659_1001381633 246
338 3300005366 Ga0070659_100420584 Ga0070659_1004205841 246
339 3300005367 Ga0070667_100023656 Ga0070667_1000236562 246
340 3300005367 Ga0070667_100089870 Ga0070667_1000898703 246
341 3300005436 Ga0070713_100009408 Ga0070713_1000094082 246
342 3300005444 Ga0070694_100043437 Ga0070694_1000434373 246
343 3300005455 Ga0070663_100017308 Ga0070663_1000173086 246
344 3300005455 Ga0070663_100051507 Ga0070663_1000515075 246
345 3300005456 Ga0070678_100106737 Ga0070678_1001067372 246
346 3300005457 Ga0070662_100078627 Ga0070662_1000786272 246
347 3300005457 Ga0070662_100366533 Ga0070662_1003665332 246
348 3300005459 Ga0068867_100081831 Ga0068867_1000818315 246
349 3300005530 Ga0070679_100014712 Ga0070679_1000147123 246
350 3300005539 Ga0068853_100029613 Ga0068853_1000296135 246
351 3300005539 Ga0068853_100285248 Ga0068853_1002852482 246
352 3300005539 Ga0068853_100297151 Ga0068853_1002971512 246
353 3300005543 Ga0070672_100028979 Ga0070672_1000289792 246
354 3300005543 Ga0070672_100085930 Ga0070672_1000859302 246
355 3300005543 Ga0070672_100362227 Ga0070672_1003622272 246
356 3300005545 Ga0070695_100066652 Ga0070695_1000666524 246
357 3300005546 Ga0070696_100014446 Ga0070696_1000144463 246
358 3300005547 Ga0070693_100028510 Ga0070693_1000285103 246
359 3300005548 Ga0070665_100003837 Ga0070665_10000383720 246
360 3300005548 Ga0070665_100382596 Ga0070665_1003825962 246
361 3300005564 Ga0070664_100004436 Ga0070664_1000044369 246
362 3300005564 Ga0070664_100027929 Ga0070664_1000279295 246
363 3300005564 Ga0070664_100205983 Ga0070664_1002059832 246
364 3300005577 Ga0068857_100012932 Ga0068857_10001293210 246
365 3300005577 Ga0068857_100034684 Ga0068857_1000346845 246
366 3300005577 Ga0068857_100198097 Ga0068857_1001980974 246
367 3300005578 Ga0068854_100011508 Ga0068854_1000115088 246
368 3300005578 Ga0068854_100127428 Ga0068854_1001274282 246
369 3300005578 Ga0068854_100154952 Ga0068854_1001549524 246
370 3300005616 Ga0068852_100188765 Ga0068852_1001887652 246
371 3300005616 Ga0068852_100235123 Ga0068852_1002351232 246
372 3300005616 Ga0068852_100389629 Ga0068852_1003896292 246
373 3300005616 Ga0068852_100468928 Ga0068852_1004689281 246
374 3300005616 Ga0068852_100788403 Ga0068852_1007884031 246
375 3300005617 Ga0068859_100009717 Ga0068859_1000097179 246
376 3300005617 Ga0068859_100083607 Ga0068859_1000836072 246
377 3300005617 Ga0068859_100187836 Ga0068859_1001878361 246
378 3300005618 Ga0068864_100001619 Ga0068864_1000016194 246
379 3300005618 Ga0068864_100039809 Ga0068864_1000398095 246
380 3300005719 Ga0068861_100173987 Ga0068861_1001739872 246
381 3300005841 Ga0068863_100029749 Ga0068863_1000297495 246
382 3300005841 Ga0068863_100048789 Ga0068863_1000487892 246
383 3300005841 Ga0068863_100058908 Ga0068863_1000589084 246
384 3300005841 Ga0068863_100149896 Ga0068863_1001498964 246
385 3300005841 Ga0068863_100303291 Ga0068863_1003032912 246
386 3300005842 Ga0068858_100022867 Ga0068858_1000228678 246
387 3300005842 Ga0068858_100147228 Ga0068858_1001472283 246
388 3300005843 Ga0068860_100066251 Ga0068860_1000662515 246
389 3300005843 Ga0068860_100483966 Ga0068860_1004839662 246
390 3300005843 Ga0068860_101039472 Ga0068860_1010394721 246
391 3300005844 Ga0068862_100052345 Ga0068862_1000523453 246
392 3300005844 Ga0068862_100207919 Ga0068862_1002079192 246
393 3300005985 Ga0081539_10069093 Ga0081539_100690932 246
394 3300006028 Ga0070717_10006369 Ga0070717_100063695 246
395 3300006051 Ga0075364_10162691 Ga0075364_101626913 246
396 3300006177 Ga0075362_10032939 Ga0075362_100329394 246
397 3300006931 Ga0097620_100009717 Ga0097620_1000097179 246
398 3300006931 Ga0097620_100083605 Ga0097620_1000836052 246
399 3300006931 Ga0097620_100187838 Ga0097620_1001878381 246
400 3300009094 Ga0111539_10054965 Ga0111539_100549655 246
401 3300009094 Ga0111539_10376648 Ga0111539_103766482 246
402 3300009174 Ga0105241_10205167 Ga0105241_102051672 246
403 3300009177 Ga0105248_10010002 Ga0105248_100100022 246
404 3300009177 Ga0105248_10036474 Ga0105248_100364742 246
405 3300009177 Ga0105248_10310692 Ga0105248_103106922 246
406 3300009177 Ga0105248_10500643 Ga0105248_105006432 246
407 3300009177 Ga0105248_10526080 Ga0105248_105260802 246
408 3300011119 Ga0105246_10092278 Ga0105246_100922783 246
409 3300012512 Ga0157327_1004374 Ga0157327_10043742 246
410 3300013100 Ga0157373_10194631 Ga0157373_101946313 246
411 3300013100 Ga0157373_10241617 Ga0157373_102416172 246
412 3300013105 Ga0157369_10002493 Ga0157369_100024937 246
413 3300013105 Ga0157369_10242075 Ga0157369_102420752 246
414 3300014326 Ga0157380_10814384 Ga0157380_108143841 246
415 3300017792 Ga0163161_10030812 Ga0163161_100308123 246
416 3300025893 Ga0207682_10029502 Ga0207682_100295022 246
417 3300025893 Ga0207682_10049135 Ga0207682_100491352 246
418 3300025903 Ga0207680_10428055 Ga0207680_104280551 246
419 3300025904 Ga0207647_10016791 Ga0207647_100167913 246
420 3300025909 Ga0207705_10011438 Ga0207705_100114383 246
421 3300025909 Ga0207705_10042434 Ga0207705_100424345 246
422 3300025909 Ga0207705_10252443 Ga0207705_102524433 246
423 3300025909 Ga0207705_10315244 Ga0207705_103152441 246
424 3300025918 Ga0207662_10163888 Ga0207662_101638883 246
425 3300025919 Ga0207657_10012036 Ga0207657_100120365 246
426 3300025919 Ga0207657_10022935 Ga0207657_100229354 246
427 3300025919 Ga0207657_10048389 Ga0207657_100483894 246
428 3300025920 Ga0207649_10030568 Ga0207649_100305682 246
429 3300025920 Ga0207649_10384194 Ga0207649_103841942 246
430 3300025921 Ga0207652_10070871 Ga0207652_100708712 246
431 3300025923 Ga0207681_10188982 Ga0207681_101889822 246
432 3300025926 Ga0207659_10194420 Ga0207659_101944203 246
433 3300025929 Ga0207664_10244269 Ga0207664_102442691 246
434 3300025931 Ga0207644_10026790 Ga0207644_100267905 246
435 3300025931 Ga0207644_10087606 Ga0207644_100876062 246
436 3300025931 Ga0207644_10318001 Ga0207644_103180011 246
437 3300025931 Ga0207644_10398874 Ga0207644_103988742 246
438 3300025932 Ga0207690_10016810 Ga0207690_100168105 246
439 3300025932 Ga0207690_10077147 Ga0207690_100771472 246
440 3300025932 Ga0207690_10090793 Ga0207690_100907933 246
441 3300025933 Ga0207706_10025399 Ga0207706_100253992 246
442 3300025933 Ga0207706_10071290 Ga0207706_100712905 246
443 3300025939 Ga0207665_10065120 Ga0207665_100651202 246
444 3300025940 Ga0207691_10362031 Ga0207691_103620312 246
445 3300025940 Ga0207691_10447372 Ga0207691_104473722 246
446 3300025941 Ga0207711_10006371 Ga0207711_100063712 246
447 3300025941 Ga0207711_10062568 Ga0207711_100625682 246
448 3300025941 Ga0207711_10500069 Ga0207711_105000692 246
449 3300025942 Ga0207689_10050354 Ga0207689_100503545 246
450 3300025945 Ga0207679_10031469 Ga0207679_100314693 246
451 3300025945 Ga0207679_10083298 Ga0207679_100832984 246
452 3300025945 Ga0207679_10162355 Ga0207679_101623552 246
453 3300025949 Ga0207667_10949867 Ga0207667_109498671 246
454 3300025960 Ga0207651_10017325 Ga0207651_100173253 246
455 3300025981 Ga0207640_10270707 Ga0207640_102707072 246
456 3300025986 Ga0207658_10010095 Ga0207658_100100956 246
457 3300025986 Ga0207658_10038601 Ga0207658_100386012 246
458 3300025986 Ga0207658_10157388 Ga0207658_101573884 246
459 3300025986 Ga0207658_10380388 Ga0207658_103803881 246
460 3300026035 Ga0207703_10014764 Ga0207703_100147649 246
461 3300026035 Ga0207703_10131906 Ga0207703_101319062 246
462 3300026067 Ga0207678_10046207 Ga0207678_100462075 246
463 3300026067 Ga0207678_10097907 Ga0207678_100979075 246
464 3300026088 Ga0207641_10033656 Ga0207641_100336563 246
465 3300026088 Ga0207641_10051398 Ga0207641_100513982 246
466 3300026088 Ga0207641_10084618 Ga0207641_100846183 246
467 3300026088 Ga0207641_10177002 Ga0207641_101770022 246
468 3300026089 Ga0207648_10089716 Ga0207648_100897164 246
469 3300026095 Ga0207676_10002166 Ga0207676_100021662 246
470 3300026095 Ga0207676_10004533 Ga0207676_1000453310 246
471 3300026095 Ga0207676_10449805 Ga0207676_104498052 246
472 3300026116 Ga0207674_10002589 Ga0207674_100025897 246
473 3300026116 Ga0207674_10048314 Ga0207674_100483142 246
474 3300026118 Ga0207675_100088082 Ga0207675_1000880825 246
475 3300026142 Ga0207698_10092001 Ga0207698_100920012 246
476 3300026142 Ga0207698_10104964 Ga0207698_101049642 246
477 3300026142 Ga0207698_10165364 Ga0207698_101653642 246
478 3300026142 Ga0207698_10855946 Ga0207698_108559461 246
479 3300027614 Ga0209970_1032022 Ga0209970_10320221 246
480 3300027876 Ga0209974_10010160 Ga0209974_100101605 246
481 3300028380 Ga0268265_10003659 Ga0268265_1000365914 246
482 3300028380 Ga0268265_10089082 Ga0268265_100890823 246
483 3300028380 Ga0268265_10335024 Ga0268265_103350243 246
484 3300028381 Ga0268264_10024906 Ga0268264_100249062 246
485 3300028381 Ga0268264_10199932 Ga0268264_101999321 246
486 3300028381 Ga0268264_10264832 Ga0268264_102648323 246
487 3300031456 Ga0307513_10117555 Ga0307513_101175552 246
488 3300031548 Ga0307408_100089857 Ga0307408_1000898572 246
489 3300031548 Ga0307408_100175578 Ga0307408_1001755782 246
490 3300031731 Ga0307405_10022731 Ga0307405_100227315 246
491 3300031731 Ga0307405_10054188 Ga0307405_100541884 246
492 3300031731 Ga0307405_10105211 Ga0307405_101052112 246
493 3300031731 Ga0307405_10140027 Ga0307405_101400274 246
494 3300031824 Ga0307413_10023856 Ga0307413_100238564 246
495 3300031824 Ga0307413_10303930 Ga0307413_103039301 246
496 3300031852 Ga0307410_10003164 Ga0307410_1000316411 246
497 3300031852 Ga0307410_10045082 Ga0307410_100450823 246
498 3300031852 Ga0307410_10059010 Ga0307410_100590103 246
499 3300031901 Ga0307406_10041271 Ga0307406_100412714 246
500 3300031901 Ga0307406_10116982 Ga0307406_101169823 246
501 3300031903 Ga0307407_10003078 Ga0307407_100030784 246
502 3300031903 Ga0307407_10189653 Ga0307407_101896532 246
503 3300031911 Ga0307412_10042145 Ga0307412_100421452 246
504 3300031995 Ga0307409_100011560 Ga0307409_1000115606 246
505 3300031995 Ga0307409_100016495 Ga0307409_1000164954 246
506 3300031995 Ga0307409_100115379 Ga0307409_1001153795 246
507 3300031995 Ga0307409_100138111 Ga0307409_1001381114 246
508 3300032002 Ga0307416_100043277 Ga0307416_1000432774 246
509 3300032002 Ga0307416_100099465 Ga0307416_1000994652 246
510 3300032002 Ga0307416_100117870 Ga0307416_1001178703 246
511 3300032002 Ga0307416_100255557 Ga0307416_1002555572 246
512 3300032002 Ga0307416_100292099 Ga0307416_1002920992 246
513 3300032004 Ga0307414_10036166 Ga0307414_100361662 246
514 3300032004 Ga0307414_10041174 Ga0307414_100411742 246
515 3300032005 Ga0307411_10009246 Ga0307411_100092469 246
516 3300032005 Ga0307411_10011297 Ga0307411_100112976 246
517 3300032005 Ga0307411_10018894 Ga0307411_100188945 246
518 3300032005 Ga0307411_10023982 Ga0307411_100239824 246
519 3300032126 Ga0307415_100007620 Ga0307415_1000076204 246
520 3300032126 Ga0307415_100012547 Ga0307415_1000125475 246
521 3300032126 Ga0307415_100025634 Ga0307415_1000256342 246
522 3300032126 Ga0307415_100029019 Ga0307415_1000290195 246
523 3300032126 Ga0307415_100121998 Ga0307415_1001219982 246
524 3300035170 Ga0373943_0002765 Ga0373943_0002765_6938_7711 246
525 3300035695 Ga0373927_0070119 Ga0373927_0070119_149_922 246
526 3300037068 Ga0373925_0182164 Ga0373925_0182164_261_1034 246
527 3300037312 Ga0395899_0010784 Ga0395899_0010784_4008_4763 246
528 3300037312 Ga0395899_0046858 Ga0395899_0046858_499_1239 246
529 3300037312 Ga0395899_0114614 Ga0395899_0114614_279_1022 246
530 3300037418 Ga0395900_0009579 Ga0395900_0009579_4257_5012 246
531 3300037418 Ga0395900_0017256 Ga0395900_0017256_3646_4386 246
532 3300037418 Ga0395900_0078313 Ga0395900_0078313_1690_2442 246
533 3300037418 Ga0395900_0087720 Ga0395900_0087720_1669_2412 246
534 3300037418 Ga0395900_0165240 Ga0395900_0165240_885_1625 246
535 3300037418 Ga0395900_0304863 Ga0395900_0304863_426_1172 246
536 3300037418 Ga0395900_0322079 Ga0395900_0322079_308_1048 246
537 3300037466 Ga0395898_0003637 Ga0395898_0003637_12521_13276 246
538 3300037466 Ga0395898_0048516 Ga0395898_0048516_2627_3370 246
539 3300037466 Ga0395898_0163288 Ga0395898_0163288_250_996 246
540 3300037466 Ga0395898_0168402 Ga0395898_0168402_1292_2044 246
541 3300037466 Ga0395898_0446770 Ga0395898_0446770_406_1152 246
542 3300037471 Ga0395905_0000886 Ga0395905_0000886_38081_38821 246
543 3300037471 Ga0395905_0005100 Ga0395905_0005100_6016_6771 246
544 3300037471 Ga0395905_0026302 Ga0395905_0026302_4582_5334 246
545 3300037471 Ga0395905_0028313 Ga0395905_0028313_1150_1890 246
546 3300037471 Ga0395905_0031061 Ga0395905_0031061_2537_3277 246
547 3300037471 Ga0395905_0038376 Ga0395905_0038376_1937_2677 246
548 3300037471 Ga0395905_0039983 Ga0395905_0039983_1800_2543 246
549 3300037471 Ga0395905_0044718 Ga0395905_0044718_1743_2486 246
550 3300037471 Ga0395905_0054666 Ga0395905_0054666_1717_2460 246
551 3300037471 Ga0395905_0105538 Ga0395905_0105538_154_906 246
552 3300037471 Ga0395905_0297914 Ga0395905_0297914_168_908 246
553 3300037471 Ga0395905_0660102 Ga0395905_0660102_182_925 246
554 3300038443 Ga0395901_0016015 Ga0395901_0016015_6818_7573 246
555 3300038443 Ga0395901_0079087 Ga0395901_0079087_1541_2284 246
556 3300038443 Ga0395901_0128239 Ga0395901_0128239_156_896 246
557 3300038443 Ga0395901_0185298 Ga0395901_0185298_1164_1907 246
558 3300039437 Ga0436365_1237401 Ga0436365_1237401_2008_2748 246
559 3300042006 Ga0439432_029495 Ga0439432_029495_61_816 246
560 3300042144 Ga0450889_000026 Ga0450889_000026_600_1388 246
561 3300044694 Ga0466963_0089857 Ga0466963_0089857_331_1083 246
562 3300045976 Ga0466967_0299516 Ga0466967_0299516_97_843 246
563 3300045976 Ga0466967_0322300 Ga0466967_0322300_352_1104 246
564 3300046492 Ga0495585_0037570 Ga0495585_0037570_189_935 246
565 3300046525 Ga0495663_0045361 Ga0495663_0045361_95_838 246
566 3300046684 Ga0495669_0000089 Ga0495669_0000089_17091_17831 246
567 3300046684 Ga0495669_0001738 Ga0495669_0001738_252_995 246
568 3300046684 Ga0495669_0015740 Ga0495669_0015740_2053_2808 246
569 3300046684 Ga0495669_0038151 Ga0495669_0038151_314_1054 246
570 3300046684 Ga0495669_0044579 Ga0495669_0044579_433_1173 246
571 3300046684 Ga0495669_0104520 Ga0495669_0104520_390_1130 246
572 3300047445 Ga0495677_0028989 Ga0495677_0028989_692_1435 246
573 3300047445 Ga0495677_0184714 Ga0495677_0184714_16_768 246
574 3300048909 Ga0496106_0060393 Ga0496106_0060393_587_1327 246
575 3300048910 Ga0496107_0069625 Ga0496107_0069625_1707_2447 246
576 3300048910 Ga0496107_0080872 Ga0496107_0080872_821_1576 246
577 3300048910 Ga0496107_0124982 Ga0496107_0124982_476_1216 246
578 3300048910 Ga0496107_0166587 Ga0496107_0166587_514_1257 246
579 3300048911 Ga0496108_0008282 Ga0496108_0008282_4861_5601 246
580 3300048911 Ga0496108_0431877 Ga0496108_0431877_65_811 246
581 3300048915 Ga0496112_0271166 Ga0496112_0271166_367_1122 246
582 3300048918 Ga0496115_0025556 Ga0496115_0025556_1328_2083 246
583 3300049583 Ga0501067_0021297 Ga0501067_0021297_173_913 246
584 3300049583 Ga0501067_0127853 Ga0501067_0127853_336_1091 246
585 3300049584 Ga0501068_0103677 Ga0501068_0103677_207_947 246
586 3300049668 Ga0501233_060988 Ga0501233_060988_43_783 246
587 3300049679 Ga0501249_009214 Ga0501249_009214_97_849 246
588 3300049686 Ga0501257_074204 Ga0501257_074204_53_805 246
589 3300049765 Ga0501268_001525 Ga0501268_001525_1042_1794 246
590 3300050489 nmdc:mga03683_8044_c1 nmdc:mga03683_8044_c1_349_1098 246
591 3300050511 nmdc:mga08y16_215338_c1 nmdc:mga08y16_215338_c1_329_1117 246
592 3300050511 nmdc:mga08y16_564570_c1 nmdc:mga08y16_564570_c1_378_1133 246
593 3300053153 Ga0500616_0034045 Ga0500616_0034045_1943_2683 246
594 3300001990 JGI24737J22298_10000837 JGI24737J22298_1000083710 249
595 3300005366 Ga0070659_100027917 Ga0070659_1000279173 249
596 3300005564 Ga0070664_100521030 Ga0070664_1005210302 249
597 3300005577 Ga0068857_100028505 Ga0068857_1000285054 249
598 3300005841 Ga0068863_100007730 Ga0068863_1000077305 249
599 3300011119 Ga0105246_10063503 Ga0105246_100635032 249
600 3300014325 Ga0163163_10092057 Ga0163163_100920572 249
601 3300025901 Ga0207688_10029423 Ga0207688_100294232 249
602 3300025904 Ga0207647_10015414 Ga0207647_100154145 249
603 3300025932 Ga0207690_10016532 Ga0207690_100165323 249
604 3300026088 Ga0207641_10032553 Ga0207641_100325532 249
605 3300026116 Ga0207674_10000086 Ga0207674_1000008660 249
606 3300037418 Ga0395900_0085727 Ga0395900_0085727_2160_2939 249
607 3300037418 Ga0395900_0326679 Ga0395900_0326679_191_943 249
608 3300037471 Ga0395905_0006839 Ga0395905_0006839_2755_3534 249
609 3300037471 Ga0395905_0011712 Ga0395905_0011712_7375_8127 249
610 3300037471 Ga0395905_0033274 Ga0395905_0033274_3587_4336 249
611 3300037471 Ga0395905_0481813 Ga0395905_0481813_262_1014 249
612 3300038443 Ga0395901_0040320 Ga0395901_0040320_966_1745 249
613 3300038443 Ga0395901_0181409 Ga0395901_0181409_336_1085 249
614 3300038443 Ga0395901_0566880 Ga0395901_0566880_124_876 249
615 3300042005 Ga0439448_0020938 Ga0439448_0020938_314_1063 249
616 3300042157 Ga0439458_0000006 Ga0439458_0000006_27020_27769 249

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.4056 1 242
4quv-assembly3.cif.gz_A structure of an integral membrane delta(14)-sterol reductase 0.4044 22 237
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.3999 1 242
4quv-assembly3.cif.gz_B structure of an integral membrane delta(14)-sterol reductase 0.3884 20 242
4quv-assembly3.cif.gz_A structure of an integral membrane delta(14)-sterol reductase 0.3566 22 237
ID Description Score Start End Superfamily
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9449 49 243 1.20.120.1630
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9354 49 243 1.20.120.1630
af_Q54JG5_70_234_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8146 50 212 1.20.120.1630
af_Q9VEG9_60_228_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8112 50 213 1.20.120.1630
af_Q54JG5_70_234_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8012 50 212 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A349TD55-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9695 1 242 GO:0008168
GO:0016020
GO:0032259
AF-A0A0M9TZ98-F1-model_v4 deleted 0.9668 1 246
AF-A0A2A8CXH1-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9663 1 242 GO:0008168
GO:0016020
GO:0032259
AF-A0A6I6SQV3-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9662 2 245 GO:0008168
GO:0016020
GO:0032259
AF-A0A2M9ZNI7-F1-model_v4 NnrU domain-containing protein 0.9658 1 245 GO:0016020

Feature Viewer

pLDDT pTM Quality
91.05 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map