F469518
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 616 | 231 | 616 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300005444|Ga0070694_100043437|Ga0070694_1000434373 |
| Length | 262 |
| Sequence | MAARPTAEGDIGMSRTANLLFAILAYAIFFATFLYLIVFVGDFAFAGRTVDVGPAAPLAAAVVIDVALIALFGVQHSVMARQGFKRWWTRVIPAPAERSVYVLMASAALIILMSLWRPIDSIVWNVSTPALASLIWVLFWIGWFTVLLSTFLINHFELFGLQQAWFHWRGRQAEPPKFRTPLFYKWIRHPLYLGFFLAFWATPEMTAGHLLLAAGVSVYMLIAIRYEERDLIDLFGKDYEDYREQAGMLTPRIRRRNRSPAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 80 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 129 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 130 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 131 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 132 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 133 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 135 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 136 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 137 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 138 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 139 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 142 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 143 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 144 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 145 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 146 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 147 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 148 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 149 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 150 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 152 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 153 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 155 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 156 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 157 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 158 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 159 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 160 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 161 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 162 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 163 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 164 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 165 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 166 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 167 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 203 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 204 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 205 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 209 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 210 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 214 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 215 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 220 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 221 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 222 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 223 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 224 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 225 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 226 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.65 |
| Nodule | 0 |
| Rhizoplane | 4.55 |
| Rhizosphere | 93.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10000837 | 3300001990 | Bacteria | 10956 |
| 2 | JGI24735J21928_10003578 | 3300002067 | Bacteria | 5278 |
| 3 | JGI24742J22300_10039564 | 3300002244 | Unclassified | 838 |
| 4 | rootL2_10227603 | 3300003322 | Unclassified | 1336 |
| 5 | Ga0065715_10091270 | 3300005293 | Bacteria | 5926 |
| 6 | Ga0070658_10014827 | 3300005327 | Bacteria | 6246 |
| 7 | Ga0070658_10067826 | 3300005327 | Bacteria | 2915 |
| 8 | Ga0070658_10273656 | 3300005327 | Bacteria | 1436 |
| 9 | Ga0070658_10463130 | 3300005327 | Bacteria | 1093 |
| 10 | Ga0070658_10594960 | 3300005327 | Bacteria | 958 |
| 11 | Ga0070676_10036889 | 3300005328 | Bacteria | 2817 |
| 12 | Ga0070670_100001186 | 3300005331 | Bacteria | 20646 |
| 13 | Ga0070670_100016571 | 3300005331 | Bacteria | 6325 |
| 14 | Ga0070670_100054799 | 3300005331 | Bacteria | 3423 |
| 15 | Ga0070670_100058060 | 3300005331 | Bacteria | 3322 |
| 16 | Ga0070677_10013309 | 3300005333 | Bacteria | 2875 |
| 17 | Ga0070677_10064672 | 3300005333 | Bacteria | 1520 |
| 18 | Ga0070677_10086012 | 3300005333 | Bacteria | 1357 |
| 19 | Ga0070677_10126703 | 3300005333 | Bacteria | 1160 |
| 20 | Ga0070666_10147928 | 3300005335 | Bacteria | 1638 |
| 21 | Ga0070666_10271933 | 3300005335 | Bacteria | 1203 |
| 22 | Ga0070680_100121271 | 3300005336 | Bacteria | 2183 |
| 23 | Ga0070660_100034999 | 3300005339 | Bacteria | 3799 |
| 24 | Ga0070660_100109272 | 3300005339 | Bacteria | 2199 |
| 25 | Ga0070660_100549275 | 3300005339 | Bacteria | 964 |
| 26 | Ga0070689_100120587 | 3300005340 | Bacteria | 2094 |
| 27 | Ga0070689_100326175 | 3300005340 | Unclassified | 1283 |
| 28 | Ga0070661_100014342 | 3300005344 | Bacteria | 5583 |
| 29 | Ga0070661_100190311 | 3300005344 | Bacteria | 1565 |
| 30 | Ga0070661_100287209 | 3300005344 | Bacteria | 1277 |
| 31 | Ga0070661_100571582 | 3300005344 | Bacteria | 911 |
| 32 | Ga0070668_100035488 | 3300005347 | Bacteria | 3802 |
| 33 | Ga0070668_100272100 | 3300005347 | Bacteria | 1412 |
| 34 | Ga0070668_100371657 | 3300005347 | Bacteria | 1215 |
| 35 | Ga0070668_100426448 | 3300005347 | Bacteria | 1136 |
| 36 | Ga0070668_100615816 | 3300005347 | Unclassified | 951 |
| 37 | Ga0070669_100012623 | 3300005353 | Bacteria | 5996 |
| 38 | Ga0070669_100016538 | 3300005353 | Bacteria | 5265 |
| 39 | Ga0070669_100034942 | 3300005353 | Bacteria | 3640 |
| 40 | Ga0070669_100091705 | 3300005353 | Bacteria | 2279 |
| 41 | Ga0070669_100099311 | 3300005353 | Bacteria | 2194 |
| 42 | Ga0070675_100009019 | 3300005354 | Bacteria | 7746 |
| 43 | Ga0070675_100223641 | 3300005354 | Bacteria | 1640 |
| 44 | Ga0070675_100247536 | 3300005354 | Bacteria | 1559 |
| 45 | Ga0070671_100000051 | 3300005355 | Bacteria | 79207 |
| 46 | Ga0070671_100023390 | 3300005355 | Bacteria | 5058 |
| 47 | Ga0070671_100036881 | 3300005355 | Bacteria | 4053 |
| 48 | Ga0070671_100042452 | 3300005355 | Bacteria | 3780 |
| 49 | Ga0070671_100066228 | 3300005355 | Bacteria | 3010 |
| 50 | Ga0070671_100131362 | 3300005355 | Bacteria | 2109 |
| 51 | Ga0070671_100241992 | 3300005355 | Bacteria | 1532 |
| 52 | Ga0070674_100070580 | 3300005356 | Bacteria | 2468 |
| 53 | Ga0070673_100078110 | 3300005364 | Bacteria | 2677 |
| 54 | Ga0070673_100096424 | 3300005364 | Bacteria | 2427 |
| 55 | Ga0070673_100108272 | 3300005364 | Bacteria | 2300 |
| 56 | Ga0070673_100367821 | 3300005364 | Bacteria | 1279 |
| 57 | Ga0070659_100008617 | 3300005366 | Bacteria | 7459 |
| 58 | Ga0070659_100027917 | 3300005366 | Bacteria | 4352 |
| 59 | Ga0070659_100138163 | 3300005366 | Bacteria | 1983 |
| 60 | Ga0070659_100420584 | 3300005366 | Bacteria | 1130 |
| 61 | Ga0070667_100018227 | 3300005367 | Bacteria | 5821 |
| 62 | Ga0070667_100022426 | 3300005367 | Bacteria | 5236 |
| 63 | Ga0070667_100023656 | 3300005367 | Bacteria | 5099 |
| 64 | Ga0070667_100089870 | 3300005367 | Bacteria | 2639 |
| 65 | Ga0070713_100009408 | 3300005436 | Bacteria | 6994 |
| 66 | Ga0070694_100043437 | 3300005444 | Bacteria | 3005 |
| 67 | Ga0070663_100017308 | 3300005455 | Bacteria | 4702 |
| 68 | Ga0070663_100051507 | 3300005455 | Bacteria | 2933 |
| 69 | Ga0070663_100179938 | 3300005455 | Bacteria | 1639 |
| 70 | Ga0070678_100010816 | 3300005456 | Bacteria | 5594 |
| 71 | Ga0070678_100025742 | 3300005456 | Bacteria | 3965 |
| 72 | Ga0070678_100106737 | 3300005456 | Bacteria | 2183 |
| 73 | Ga0070678_100436067 | 3300005456 | Bacteria | 1145 |
| 74 | Ga0070662_100001195 | 3300005457 | Bacteria | 15948 |
| 75 | Ga0070662_100002559 | 3300005457 | Bacteria | 11198 |
| 76 | Ga0070662_100005921 | 3300005457 | Bacteria | 7842 |
| 77 | Ga0070662_100049117 | 3300005457 | Bacteria | 3042 |
| 78 | Ga0070662_100078627 | 3300005457 | Bacteria | 2451 |
| 79 | Ga0070662_100366533 | 3300005457 | Bacteria | 1183 |
| 80 | Ga0068867_100081831 | 3300005459 | Bacteria | 2435 |
| 81 | Ga0068867_100133078 | 3300005459 | Bacteria | 1935 |
| 82 | Ga0068867_100152249 | 3300005459 | Bacteria | 1818 |
| 83 | Ga0070679_100014712 | 3300005530 | Bacteria | 7521 |
| 84 | Ga0070679_100070254 | 3300005530 | Bacteria | 3494 |
| 85 | Ga0068853_100029613 | 3300005539 | Bacteria | 4618 |
| 86 | Ga0068853_100046035 | 3300005539 | Bacteria | 3739 |
| 87 | Ga0068853_100285248 | 3300005539 | Bacteria | 1523 |
| 88 | Ga0068853_100297151 | 3300005539 | Bacteria | 1492 |
| 89 | Ga0070672_100000170 | 3300005543 | Bacteria | 36164 |
| 90 | Ga0070672_100028979 | 3300005543 | Bacteria | 4146 |
| 91 | Ga0070672_100034628 | 3300005543 | Bacteria | 3834 |
| 92 | Ga0070672_100040819 | 3300005543 | Bacteria | 3563 |
| 93 | Ga0070672_100085930 | 3300005543 | Bacteria | 2529 |
| 94 | Ga0070672_100362227 | 3300005543 | Bacteria | 1238 |
| 95 | Ga0070695_100066652 | 3300005545 | Bacteria | 2347 |
| 96 | Ga0070696_100014446 | 3300005546 | Bacteria | 5296 |
| 97 | Ga0070696_100098641 | 3300005546 | Bacteria | 2090 |
| 98 | Ga0070693_100028510 | 3300005547 | Bacteria | 3036 |
| 99 | Ga0070665_100003837 | 3300005548 | Bacteria | 15903 |
| 100 | Ga0070665_100382596 | 3300005548 | Bacteria | 1415 |
| 101 | Ga0068855_100592673 | 3300005563 | Bacteria | 1196 |
| 102 | Ga0070664_100004436 | 3300005564 | Bacteria | 11270 |
| 103 | Ga0070664_100027929 | 3300005564 | Bacteria | 4693 |
| 104 | Ga0070664_100033148 | 3300005564 | Bacteria | 4324 |
| 105 | Ga0070664_100205983 | 3300005564 | Bacteria | 1756 |
| 106 | Ga0070664_100289239 | 3300005564 | Bacteria | 1479 |
| 107 | Ga0070664_100521030 | 3300005564 | Bacteria | 1097 |
| 108 | Ga0068857_100012932 | 3300005577 | Bacteria | 7271 |
| 109 | Ga0068857_100028505 | 3300005577 | Bacteria | 4927 |
| 110 | Ga0068857_100034684 | 3300005577 | Bacteria | 4463 |
| 111 | Ga0068857_100198097 | 3300005577 | Bacteria | 1830 |
| 112 | Ga0068857_100332636 | 3300005577 | Bacteria | 1404 |
| 113 | Ga0068854_100011508 | 3300005578 | Bacteria | 5764 |
| 114 | Ga0068854_100127428 | 3300005578 | Bacteria | 1940 |
| 115 | Ga0068854_100154952 | 3300005578 | Bacteria | 1769 |
| 116 | Ga0068856_100277447 | 3300005614 | Bacteria | 1693 |
| 117 | Ga0068852_100145130 | 3300005616 | Bacteria | 2200 |
| 118 | Ga0068852_100188765 | 3300005616 | Bacteria | 1943 |
| 119 | Ga0068852_100235123 | 3300005616 | Bacteria | 1749 |
| 120 | Ga0068852_100389629 | 3300005616 | Bacteria | 1368 |
| 121 | Ga0068852_100468928 | 3300005616 | Bacteria | 1249 |
| 122 | Ga0068852_100788403 | 3300005616 | Bacteria | 964 |
| 123 | Ga0068859_100000685 | 3300005617 | Bacteria | 34047 |
| 124 | Ga0068859_100009717 | 3300005617 | Bacteria | 9713 |
| 125 | Ga0068859_100017516 | 3300005617 | Bacteria | 7201 |
| 126 | Ga0068859_100083607 | 3300005617 | Bacteria | 3235 |
| 127 | Ga0068859_100187836 | 3300005617 | Bacteria | 2150 |
| 128 | Ga0068864_100000847 | 3300005618 | Bacteria | 25807 |
| 129 | Ga0068864_100001619 | 3300005618 | Bacteria | 18541 |
| 130 | Ga0068864_100039809 | 3300005618 | Bacteria | 4017 |
| 131 | Ga0068864_100077259 | 3300005618 | Bacteria | 2911 |
| 132 | Ga0068864_100296904 | 3300005618 | Bacteria | 1512 |
| 133 | Ga0068861_100091426 | 3300005719 | Bacteria | 2403 |
| 134 | Ga0068861_100173987 | 3300005719 | Bacteria | 1787 |
| 135 | Ga0068861_100367393 | 3300005719 | Bacteria | 1267 |
| 136 | Ga0068863_100007730 | 3300005841 | Bacteria | 10513 |
| 137 | Ga0068863_100009665 | 3300005841 | Bacteria | 9410 |
| 138 | Ga0068863_100029749 | 3300005841 | Bacteria | 5215 |
| 139 | Ga0068863_100048789 | 3300005841 | Bacteria | 4014 |
| 140 | Ga0068863_100058908 | 3300005841 | Bacteria | 3634 |
| 141 | Ga0068863_100149896 | 3300005841 | Bacteria | 2231 |
| 142 | Ga0068863_100299722 | 3300005841 | Bacteria | 1559 |
| 143 | Ga0068863_100303291 | 3300005841 | Bacteria | 1549 |
| 144 | Ga0068858_100000655 | 3300005842 | Bacteria | 36151 |
| 145 | Ga0068858_100022867 | 3300005842 | Bacteria | 5831 |
| 146 | Ga0068858_100147228 | 3300005842 | Bacteria | 2212 |
| 147 | Ga0068860_100066251 | 3300005843 | Bacteria | 3431 |
| 148 | Ga0068860_100112868 | 3300005843 | Bacteria | 2598 |
| 149 | Ga0068860_100167202 | 3300005843 | Bacteria | 2123 |
| 150 | Ga0068860_100483966 | 3300005843 | Bacteria | 1234 |
| 151 | Ga0068860_101039472 | 3300005843 | Bacteria | 838 |
| 152 | Ga0068862_100009116 | 3300005844 | Bacteria | 8214 |
| 153 | Ga0068862_100042308 | 3300005844 | Bacteria | 3881 |
| 154 | Ga0068862_100052345 | 3300005844 | Bacteria | 3493 |
| 155 | Ga0068862_100103999 | 3300005844 | Bacteria | 2487 |
| 156 | Ga0068862_100207919 | 3300005844 | Bacteria | 1767 |
| 157 | Ga0081539_10043435 | 3300005985 | Bacteria | 2605 |
| 158 | Ga0081539_10069093 | 3300005985 | Bacteria | 1903 |
| 159 | Ga0070717_10006369 | 3300006028 | Bacteria | 8676 |
| 160 | Ga0075364_10162691 | 3300006051 | Bacteria | 1507 |
| 161 | Ga0070712_100101670 | 3300006175 | Bacteria | 2127 |
| 162 | Ga0075362_10032939 | 3300006177 | Bacteria | 2252 |
| 163 | Ga0097621_100097142 | 3300006237 | Bacteria | 2473 |
| 164 | Ga0097621_100242515 | 3300006237 | Bacteria | 1576 |
| 165 | Ga0068871_100011802 | 3300006358 | Bacteria | 6421 |
| 166 | Ga0075431_100072938 | 3300006847 | Bacteria | 3542 |
| 167 | Ga0097620_100000685 | 3300006931 | Bacteria | 34047 |
| 168 | Ga0097620_100009717 | 3300006931 | Bacteria | 9713 |
| 169 | Ga0097620_100017516 | 3300006931 | Bacteria | 7201 |
| 170 | Ga0097620_100083605 | 3300006931 | Bacteria | 3235 |
| 171 | Ga0097620_100187838 | 3300006931 | Bacteria | 2150 |
| 172 | Ga0105250_10008687 | 3300009092 | Bacteria | 4303 |
| 173 | Ga0111539_10054965 | 3300009094 | Bacteria | 4734 |
| 174 | Ga0111539_10376648 | 3300009094 | Bacteria | 1652 |
| 175 | Ga0105247_10170555 | 3300009101 | Bacteria | 1446 |
| 176 | Ga0105243_10486280 | 3300009148 | Bacteria | 1166 |
| 177 | Ga0105241_10205167 | 3300009174 | Bacteria | 1649 |
| 178 | Ga0105242_10115602 | 3300009176 | Bacteria | 2294 |
| 179 | Ga0105248_10002158 | 3300009177 | Bacteria | 21772 |
| 180 | Ga0105248_10002811 | 3300009177 | Bacteria | 19328 |
| 181 | Ga0105248_10010002 | 3300009177 | Bacteria | 10441 |
| 182 | Ga0105248_10010251 | 3300009177 | Bacteria | 10317 |
| 183 | Ga0105248_10015484 | 3300009177 | Bacteria | 8407 |
| 184 | Ga0105248_10036474 | 3300009177 | Bacteria | 5499 |
| 185 | Ga0105248_10310692 | 3300009177 | Bacteria | 1775 |
| 186 | Ga0105248_10472196 | 3300009177 | Bacteria | 1414 |
| 187 | Ga0105248_10500643 | 3300009177 | Bacteria | 1370 |
| 188 | Ga0105248_10526080 | 3300009177 | Bacteria | 1334 |
| 189 | Ga0105248_10616811 | 3300009177 | Bacteria | 1224 |
| 190 | Ga0105249_10040279 | 3300009553 | Bacteria | 4243 |
| 191 | Ga0105249_10089432 | 3300009553 | Bacteria | 2878 |
| 192 | Ga0105246_10063503 | 3300011119 | Bacteria | 2576 |
| 193 | Ga0105246_10092278 | 3300011119 | Bacteria | 2185 |
| 194 | Ga0157327_1004374 | 3300012512 | Bacteria | 1091 |
| 195 | Ga0157373_10018646 | 3300013100 | Bacteria | 5050 |
| 196 | Ga0157373_10038318 | 3300013100 | Bacteria | 3436 |
| 197 | Ga0157373_10194631 | 3300013100 | Bacteria | 1429 |
| 198 | Ga0157373_10241617 | 3300013100 | Bacteria | 1277 |
| 199 | Ga0157369_10002493 | 3300013105 | Bacteria | 22063 |
| 200 | Ga0157369_10242075 | 3300013105 | Bacteria | 1884 |
| 201 | Ga0157374_10406098 | 3300013296 | Bacteria | 1359 |
| 202 | Ga0157378_10153110 | 3300013297 | Bacteria | 2149 |
| 203 | Ga0163162_10009361 | 3300013306 | Bacteria | 9525 |
| 204 | Ga0163162_10090527 | 3300013306 | Bacteria | 3141 |
| 205 | Ga0163162_10320695 | 3300013306 | Bacteria | 1682 |
| 206 | Ga0157375_10112122 | 3300013308 | Bacteria | 2827 |
| 207 | Ga0157375_10458525 | 3300013308 | Bacteria | 1440 |
| 208 | Ga0163163_10000307 | 3300014325 | Bacteria | 48168 |
| 209 | Ga0163163_10092057 | 3300014325 | Unclassified | 3047 |
| 210 | Ga0157380_10009741 | 3300014326 | Bacteria | 6895 |
| 211 | Ga0157380_10033760 | 3300014326 | Bacteria | 3942 |
| 212 | Ga0157380_10814384 | 3300014326 | Bacteria | 952 |
| 213 | Ga0182008_10155310 | 3300014497 | Bacteria | 1149 |
| 214 | Ga0157379_10011314 | 3300014968 | Bacteria | 7778 |
| 215 | Ga0157379_10363070 | 3300014968 | Bacteria | 1327 |
| 216 | Ga0163161_10030812 | 3300017792 | Bacteria | 3819 |
| 217 | Ga0163161_10068025 | 3300017792 | Bacteria | 2602 |
| 218 | Ga0213875_10001046 | 3300021388 | Bacteria | 19467 |
| 219 | Ga0207697_10012170 | 3300025315 | Bacteria | 3617 |
| 220 | Ga0207696_1020379 | 3300025711 | Bacteria | 2141 |
| 221 | Ga0207682_10001448 | 3300025893 | Bacteria | 10955 |
| 222 | Ga0207682_10029502 | 3300025893 | Bacteria | 2193 |
| 223 | Ga0207682_10049135 | 3300025893 | Bacteria | 1741 |
| 224 | Ga0207710_10058608 | 3300025900 | Bacteria | 1741 |
| 225 | Ga0207688_10029423 | 3300025901 | Bacteria | 3024 |
| 226 | Ga0207688_10149983 | 3300025901 | Bacteria | 1377 |
| 227 | Ga0207688_10182670 | 3300025901 | Bacteria | 1251 |
| 228 | Ga0207680_10120023 | 3300025903 | Bacteria | 1718 |
| 229 | Ga0207680_10428055 | 3300025903 | Bacteria | 938 |
| 230 | Ga0207647_10015414 | 3300025904 | Bacteria | 5240 |
| 231 | Ga0207647_10016791 | 3300025904 | Bacteria | 4988 |
| 232 | Ga0207645_10028161 | 3300025907 | Bacteria | 3628 |
| 233 | Ga0207705_10011438 | 3300025909 | Bacteria | 6422 |
| 234 | Ga0207705_10042434 | 3300025909 | Bacteria | 3265 |
| 235 | Ga0207705_10204444 | 3300025909 | Bacteria | 1497 |
| 236 | Ga0207705_10252443 | 3300025909 | Bacteria | 1345 |
| 237 | Ga0207705_10315244 | 3300025909 | Bacteria | 1201 |
| 238 | Ga0207693_10120911 | 3300025915 | Bacteria | 2056 |
| 239 | Ga0207662_10163888 | 3300025918 | Bacteria | 1422 |
| 240 | Ga0207657_10012036 | 3300025919 | Bacteria | 8558 |
| 241 | Ga0207657_10022935 | 3300025919 | Bacteria | 5824 |
| 242 | Ga0207657_10048389 | 3300025919 | Bacteria | 3713 |
| 243 | Ga0207649_10030568 | 3300025920 | Bacteria | 3192 |
| 244 | Ga0207649_10065284 | 3300025920 | Bacteria | 2303 |
| 245 | Ga0207649_10243692 | 3300025920 | Bacteria | 1291 |
| 246 | Ga0207649_10384194 | 3300025920 | Bacteria | 1047 |
| 247 | Ga0207652_10039973 | 3300025921 | Bacteria | 3982 |
| 248 | Ga0207652_10070871 | 3300025921 | Bacteria | 3028 |
| 249 | Ga0207681_10057474 | 3300025923 | Bacteria | 2659 |
| 250 | Ga0207681_10188982 | 3300025923 | Bacteria | 1574 |
| 251 | Ga0207659_10194420 | 3300025926 | Bacteria | 1616 |
| 252 | Ga0207664_10244269 | 3300025929 | Bacteria | 1564 |
| 253 | Ga0207644_10000052 | 3300025931 | Bacteria | 91473 |
| 254 | Ga0207644_10003062 | 3300025931 | Bacteria | 10764 |
| 255 | Ga0207644_10013892 | 3300025931 | Bacteria | 5379 |
| 256 | Ga0207644_10026790 | 3300025931 | Bacteria | 3977 |
| 257 | Ga0207644_10039361 | 3300025931 | Bacteria | 3336 |
| 258 | Ga0207644_10087606 | 3300025931 | Bacteria | 2314 |
| 259 | Ga0207644_10180377 | 3300025931 | Bacteria | 1654 |
| 260 | Ga0207644_10318001 | 3300025931 | Bacteria | 1258 |
| 261 | Ga0207644_10398874 | 3300025931 | Bacteria | 1124 |
| 262 | Ga0207690_10016532 | 3300025932 | Bacteria | 4491 |
| 263 | Ga0207690_10016810 | 3300025932 | Bacteria | 4457 |
| 264 | Ga0207690_10077147 | 3300025932 | Bacteria | 2315 |
| 265 | Ga0207690_10090793 | 3300025932 | Bacteria | 2157 |
| 266 | Ga0207706_10000299 | 3300025933 | Bacteria | 53751 |
| 267 | Ga0207706_10009249 | 3300025933 | Bacteria | 9054 |
| 268 | Ga0207706_10009297 | 3300025933 | Bacteria | 9025 |
| 269 | Ga0207706_10025399 | 3300025933 | Bacteria | 5308 |
| 270 | Ga0207706_10047040 | 3300025933 | Bacteria | 3818 |
| 271 | Ga0207706_10071290 | 3300025933 | Bacteria | 3056 |
| 272 | Ga0207686_10302489 | 3300025934 | Bacteria | 1188 |
| 273 | Ga0207709_10303028 | 3300025935 | Bacteria | 1189 |
| 274 | Ga0207669_10017079 | 3300025937 | Bacteria | 3711 |
| 275 | Ga0207669_10035772 | 3300025937 | Bacteria | 2830 |
| 276 | Ga0207665_10065120 | 3300025939 | Bacteria | 2477 |
| 277 | Ga0207691_10000765 | 3300025940 | Bacteria | 31799 |
| 278 | Ga0207691_10042808 | 3300025940 | Bacteria | 4174 |
| 279 | Ga0207691_10135850 | 3300025940 | Bacteria | 2169 |
| 280 | Ga0207691_10362031 | 3300025940 | Bacteria | 1240 |
| 281 | Ga0207691_10447372 | 3300025940 | Bacteria | 1100 |
| 282 | Ga0207711_10000420 | 3300025941 | Bacteria | 44798 |
| 283 | Ga0207711_10001243 | 3300025941 | Bacteria | 24174 |
| 284 | Ga0207711_10006081 | 3300025941 | Bacteria | 10197 |
| 285 | Ga0207711_10006371 | 3300025941 | Bacteria | 9947 |
| 286 | Ga0207711_10062568 | 3300025941 | Bacteria | 3210 |
| 287 | Ga0207711_10096157 | 3300025941 | Bacteria | 2613 |
| 288 | Ga0207711_10382802 | 3300025941 | Bacteria | 1306 |
| 289 | Ga0207711_10500069 | 3300025941 | Bacteria | 1133 |
| 290 | Ga0207689_10050354 | 3300025942 | Bacteria | 3435 |
| 291 | Ga0207679_10021413 | 3300025945 | Bacteria | 4383 |
| 292 | Ga0207679_10031469 | 3300025945 | Bacteria | 3713 |
| 293 | Ga0207679_10083298 | 3300025945 | Bacteria | 2451 |
| 294 | Ga0207679_10162355 | 3300025945 | Bacteria | 1830 |
| 295 | Ga0207679_10164998 | 3300025945 | Bacteria | 1817 |
| 296 | Ga0207679_10187376 | 3300025945 | Bacteria | 1717 |
| 297 | Ga0207667_10949867 | 3300025949 | Bacteria | 849 |
| 298 | Ga0207651_10017325 | 3300025960 | Bacteria | 4254 |
| 299 | Ga0207651_10036190 | 3300025960 | Bacteria | 3220 |
| 300 | Ga0207651_10039183 | 3300025960 | Bacteria | 3122 |
| 301 | Ga0207651_10048616 | 3300025960 | Bacteria | 2869 |
| 302 | Ga0207651_10053889 | 3300025960 | Bacteria | 2752 |
| 303 | Ga0207712_10039903 | 3300025961 | Bacteria | 3219 |
| 304 | Ga0207712_10168002 | 3300025961 | Bacteria | 1712 |
| 305 | Ga0207668_10034340 | 3300025972 | Bacteria | 3367 |
| 306 | Ga0207640_10270707 | 3300025981 | Bacteria | 1329 |
| 307 | Ga0207658_10010095 | 3300025986 | Bacteria | 6413 |
| 308 | Ga0207658_10010272 | 3300025986 | Bacteria | 6360 |
| 309 | Ga0207658_10038601 | 3300025986 | Bacteria | 3441 |
| 310 | Ga0207658_10157388 | 3300025986 | Bacteria | 1858 |
| 311 | Ga0207658_10191313 | 3300025986 | Bacteria | 1701 |
| 312 | Ga0207658_10380388 | 3300025986 | Bacteria | 1236 |
| 313 | Ga0207703_10014764 | 3300026035 | Bacteria | 6096 |
| 314 | Ga0207703_10015617 | 3300026035 | Bacteria | 5923 |
| 315 | Ga0207703_10131906 | 3300026035 | Bacteria | 2159 |
| 316 | Ga0207639_10102963 | 3300026041 | Bacteria | 2312 |
| 317 | Ga0207678_10040429 | 3300026067 | Bacteria | 4045 |
| 318 | Ga0207678_10046207 | 3300026067 | Bacteria | 3765 |
| 319 | Ga0207678_10063460 | 3300026067 | Bacteria | 3174 |
| 320 | Ga0207678_10097907 | 3300026067 | Bacteria | 2506 |
| 321 | Ga0207641_10000502 | 3300026088 | Bacteria | 44127 |
| 322 | Ga0207641_10032553 | 3300026088 | Bacteria | 4328 |
| 323 | Ga0207641_10033656 | 3300026088 | Bacteria | 4257 |
| 324 | Ga0207641_10051398 | 3300026088 | Bacteria | 3490 |
| 325 | Ga0207641_10084618 | 3300026088 | Bacteria | 2761 |
| 326 | Ga0207641_10177002 | 3300026088 | Bacteria | 1951 |
| 327 | Ga0207648_10008755 | 3300026089 | Bacteria | 9754 |
| 328 | Ga0207648_10089716 | 3300026089 | Bacteria | 2686 |
| 329 | Ga0207648_10216123 | 3300026089 | Bacteria | 1703 |
| 330 | Ga0207676_10000694 | 3300026095 | Bacteria | 26554 |
| 331 | Ga0207676_10002166 | 3300026095 | Bacteria | 14176 |
| 332 | Ga0207676_10004533 | 3300026095 | Bacteria | 9828 |
| 333 | Ga0207676_10122021 | 3300026095 | Bacteria | 2199 |
| 334 | Ga0207676_10337350 | 3300026095 | Bacteria | 1389 |
| 335 | Ga0207676_10449805 | 3300026095 | Bacteria | 1214 |
| 336 | Ga0207676_10451026 | 3300026095 | Bacteria | 1212 |
| 337 | Ga0207674_10000086 | 3300026116 | Bacteria | 100722 |
| 338 | Ga0207674_10002589 | 3300026116 | Bacteria | 22783 |
| 339 | Ga0207674_10048314 | 3300026116 | Bacteria | 4356 |
| 340 | Ga0207674_10140417 | 3300026116 | Bacteria | 2375 |
| 341 | Ga0207675_100032623 | 3300026118 | Bacteria | 4851 |
| 342 | Ga0207675_100088082 | 3300026118 | Bacteria | 2916 |
| 343 | Ga0207675_100523906 | 3300026118 | Bacteria | 1182 |
| 344 | Ga0207683_10005095 | 3300026121 | Bacteria | 11274 |
| 345 | Ga0207683_10043209 | 3300026121 | Bacteria | 3938 |
| 346 | Ga0207698_10092001 | 3300026142 | Bacteria | 2485 |
| 347 | Ga0207698_10104964 | 3300026142 | Bacteria | 2353 |
| 348 | Ga0207698_10123447 | 3300026142 | Bacteria | 2197 |
| 349 | Ga0207698_10165364 | 3300026142 | Bacteria | 1941 |
| 350 | Ga0207698_10855946 | 3300026142 | Bacteria | 914 |
| 351 | Ga0209970_1032022 | 3300027614 | Bacteria | 916 |
| 352 | Ga0209974_10010160 | 3300027876 | Bacteria | 3179 |
| 353 | Ga0268265_10003659 | 3300028380 | Bacteria | 10962 |
| 354 | Ga0268265_10011100 | 3300028380 | Bacteria | 6087 |
| 355 | Ga0268265_10046757 | 3300028380 | Bacteria | 3237 |
| 356 | Ga0268265_10089082 | 3300028380 | Bacteria | 2460 |
| 357 | Ga0268265_10335024 | 3300028380 | Bacteria | 1375 |
| 358 | Ga0268264_10000410 | 3300028381 | Bacteria | 60680 |
| 359 | Ga0268264_10000418 | 3300028381 | Bacteria | 59942 |
| 360 | Ga0268264_10024906 | 3300028381 | Bacteria | 4890 |
| 361 | Ga0268264_10199932 | 3300028381 | Bacteria | 1828 |
| 362 | Ga0268264_10264832 | 3300028381 | Bacteria | 1603 |
| 363 | Ga0268264_10739027 | 3300028381 | Bacteria | 979 |
| 364 | Ga0265334_10039265 | 3300028573 | Bacteria | 1859 |
| 365 | Ga0316182_1108277 | 3300030745 | Bacteria | 1697 |
| 366 | Ga0265330_10021275 | 3300031235 | Bacteria | 2962 |
| 367 | Ga0307513_10117555 | 3300031456 | Bacteria | 2636 |
| 368 | Ga0307408_100076035 | 3300031548 | Bacteria | 2496 |
| 369 | Ga0307408_100089857 | 3300031548 | Bacteria | 2316 |
| 370 | Ga0307408_100094196 | 3300031548 | Bacteria | 2267 |
| 371 | Ga0307408_100175578 | 3300031548 | Bacteria | 1714 |
| 372 | Ga0307405_10022731 | 3300031731 | Bacteria | 3551 |
| 373 | Ga0307405_10054188 | 3300031731 | Bacteria | 2502 |
| 374 | Ga0307405_10105211 | 3300031731 | Bacteria | 1900 |
| 375 | Ga0307405_10140027 | 3300031731 | Bacteria | 1685 |
| 376 | Ga0307405_10624427 | 3300031731 | Bacteria | 882 |
| 377 | Ga0307413_10000456 | 3300031824 | Bacteria | 13342 |
| 378 | Ga0307413_10023856 | 3300031824 | Bacteria | 3322 |
| 379 | Ga0307413_10303930 | 3300031824 | Bacteria | 1211 |
| 380 | Ga0307413_10462631 | 3300031824 | Bacteria | 1009 |
| 381 | Ga0307410_10000393 | 3300031852 | Bacteria | 17209 |
| 382 | Ga0307410_10003164 | 3300031852 | Bacteria | 8189 |
| 383 | Ga0307410_10004456 | 3300031852 | Bacteria | 7243 |
| 384 | Ga0307410_10045082 | 3300031852 | Bacteria | 2933 |
| 385 | Ga0307410_10059010 | 3300031852 | Bacteria | 2618 |
| 386 | Ga0307410_10300655 | 3300031852 | Bacteria | 1266 |
| 387 | Ga0307406_10041271 | 3300031901 | Bacteria | 2874 |
| 388 | Ga0307406_10116982 | 3300031901 | Bacteria | 1846 |
| 389 | Ga0307407_10002528 | 3300031903 | Bacteria | 7184 |
| 390 | Ga0307407_10003078 | 3300031903 | Bacteria | 6731 |
| 391 | Ga0307407_10158241 | 3300031903 | Bacteria | 1480 |
| 392 | Ga0307407_10189653 | 3300031903 | Bacteria | 1369 |
| 393 | Ga0307407_10431245 | 3300031903 | Bacteria | 952 |
| 394 | Ga0307412_10006554 | 3300031911 | Bacteria | 6591 |
| 395 | Ga0307412_10042145 | 3300031911 | Bacteria | 2963 |
| 396 | Ga0307412_10274287 | 3300031911 | Bacteria | 1321 |
| 397 | Ga0307409_100000418 | 3300031995 | Bacteria | 18065 |
| 398 | Ga0307409_100011560 | 3300031995 | Bacteria | 5575 |
| 399 | Ga0307409_100016495 | 3300031995 | Bacteria | 4888 |
| 400 | Ga0307409_100039238 | 3300031995 | Bacteria | 3511 |
| 401 | Ga0307409_100115379 | 3300031995 | Bacteria | 2261 |
| 402 | Ga0307409_100138111 | 3300031995 | Bacteria | 2095 |
| 403 | Ga0307409_100617882 | 3300031995 | Bacteria | 1073 |
| 404 | Ga0307416_100007131 | 3300032002 | Bacteria | 7066 |
| 405 | Ga0307416_100043277 | 3300032002 | Bacteria | 3524 |
| 406 | Ga0307416_100099465 | 3300032002 | Bacteria | 2526 |
| 407 | Ga0307416_100117870 | 3300032002 | Bacteria | 2358 |
| 408 | Ga0307416_100177774 | 3300032002 | Bacteria | 1991 |
| 409 | Ga0307416_100255557 | 3300032002 | Bacteria | 1708 |
| 410 | Ga0307416_100292099 | 3300032002 | Bacteria | 1614 |
| 411 | Ga0307416_101146597 | 3300032002 | Bacteria | 882 |
| 412 | Ga0307414_10006871 | 3300032004 | Bacteria | 6367 |
| 413 | Ga0307414_10036166 | 3300032004 | Bacteria | 3294 |
| 414 | Ga0307414_10041174 | 3300032004 | Bacteria | 3126 |
| 415 | Ga0307414_10768985 | 3300032004 | Bacteria | 876 |
| 416 | Ga0307411_10009246 | 3300032005 | Bacteria | 5167 |
| 417 | Ga0307411_10011297 | 3300032005 | Bacteria | 4812 |
| 418 | Ga0307411_10018894 | 3300032005 | Bacteria | 3967 |
| 419 | Ga0307411_10023982 | 3300032005 | Bacteria | 3627 |
| 420 | Ga0307411_10026563 | 3300032005 | Bacteria | 3487 |
| 421 | Ga0307411_10137703 | 3300032005 | Bacteria | 1795 |
| 422 | Ga0307411_10285595 | 3300032005 | Bacteria | 1315 |
| 423 | Ga0307415_100007620 | 3300032126 | Bacteria | 5935 |
| 424 | Ga0307415_100012547 | 3300032126 | Bacteria | 4904 |
| 425 | Ga0307415_100025634 | 3300032126 | Bacteria | 3704 |
| 426 | Ga0307415_100029019 | 3300032126 | Bacteria | 3529 |
| 427 | Ga0307415_100121998 | 3300032126 | Bacteria | 1956 |
| 428 | Ga0307415_100519608 | 3300032126 | Bacteria | 1044 |
| 429 | Ga0373934_0003383 | 3300035086 | Bacteria | 5841 |
| 430 | Ga0373953_0000807 | 3300035117 | Bacteria | 8744 |
| 431 | Ga0373954_0003796 | 3300035118 | Bacteria | 6448 |
| 432 | Ga0373956_0008718 | 3300035119 | Bacteria | 4107 |
| 433 | Ga0373957_0000854 | 3300035120 | Bacteria | 7968 |
| 434 | Ga0373943_0002765 | 3300035170 | Bacteria | 7988 |
| 435 | Ga0373955_0000373 | 3300035172 | Bacteria | 18929 |
| 436 | Ga0373927_0070119 | 3300035695 | Bacteria | 2269 |
| 437 | Ga0373933_0004235 | 3300035724 | Bacteria | 7905 |
| 438 | Ga0373925_0182164 | 3300037068 | Bacteria | 1663 |
| 439 | Ga0395899_0000302 | 3300037312 | Bacteria | 63367 |
| 440 | Ga0395899_0010784 | 3300037312 | Bacteria | 7004 |
| 441 | Ga0395899_0046160 | 3300037312 | Bacteria | 3245 |
| 442 | Ga0395899_0046858 | 3300037312 | Bacteria | 3219 |
| 443 | Ga0395899_0074724 | 3300037312 | Bacteria | 2475 |
| 444 | Ga0395899_0084951 | 3300037312 | Bacteria | 2300 |
| 445 | Ga0395899_0113071 | 3300037312 | Bacteria | 1950 |
| 446 | Ga0395899_0114614 | 3300037312 | Bacteria | 1935 |
| 447 | Ga0395899_0171669 | 3300037312 | Bacteria | 1527 |
| 448 | Ga0395899_0354888 | 3300037312 | Bacteria | 980 |
| 449 | Ga0395900_0007215 | 3300037418 | Bacteria | 11514 |
| 450 | Ga0395900_0008571 | 3300037418 | Bacteria | 10510 |
| 451 | Ga0395900_0009579 | 3300037418 | Bacteria | 9929 |
| 452 | Ga0395900_0017256 | 3300037418 | Bacteria | 7367 |
| 453 | Ga0395900_0029983 | 3300037418 | Bacteria | 5583 |
| 454 | Ga0395900_0078313 | 3300037418 | Bacteria | 3396 |
| 455 | Ga0395900_0085727 | 3300037418 | Bacteria | 3237 |
| 456 | Ga0395900_0087720 | 3300037418 | Bacteria | 3197 |
| 457 | Ga0395900_0165240 | 3300037418 | Bacteria | 2256 |
| 458 | Ga0395900_0192872 | 3300037418 | Bacteria | 2065 |
| 459 | Ga0395900_0197581 | 3300037418 | Bacteria | 2037 |
| 460 | Ga0395900_0304863 | 3300037418 | Bacteria | 1577 |
| 461 | Ga0395900_0322079 | 3300037418 | Bacteria | 1526 |
| 462 | Ga0395900_0326679 | 3300037418 | Bacteria | 1513 |
| 463 | Ga0395900_0370688 | 3300037418 | Bacteria | 1401 |
| 464 | Ga0395898_0000054 | 3300037466 | Bacteria | 279561 |
| 465 | Ga0395898_0001674 | 3300037466 | Bacteria | 29720 |
| 466 | Ga0395898_0003637 | 3300037466 | Bacteria | 17137 |
| 467 | Ga0395898_0048516 | 3300037466 | Bacteria | 4163 |
| 468 | Ga0395898_0163288 | 3300037466 | Bacteria | 2130 |
| 469 | Ga0395898_0168402 | 3300037466 | Bacteria | 2094 |
| 470 | Ga0395898_0171256 | 3300037466 | Bacteria | 2076 |
| 471 | Ga0395898_0446770 | 3300037466 | Bacteria | 1231 |
| 472 | Ga0395905_0000046 | 3300037471 | Bacteria | 240463 |
| 473 | Ga0395905_0000500 | 3300037471 | Bacteria | 53853 |
| 474 | Ga0395905_0000886 | 3300037471 | Bacteria | 39025 |
| 475 | Ga0395905_0002780 | 3300037471 | Bacteria | 19161 |
| 476 | Ga0395905_0005100 | 3300037471 | Bacteria | 13501 |
| 477 | Ga0395905_0006839 | 3300037471 | Bacteria | 11406 |
| 478 | Ga0395905_0011712 | 3300037471 | Bacteria | 8466 |
| 479 | Ga0395905_0013031 | 3300037471 | Bacteria | 7988 |
| 480 | Ga0395905_0025708 | 3300037471 | Bacteria | 5551 |
| 481 | Ga0395905_0026302 | 3300037471 | Bacteria | 5487 |
| 482 | Ga0395905_0028313 | 3300037471 | Bacteria | 5281 |
| 483 | Ga0395905_0031061 | 3300037471 | Bacteria | 5030 |
| 484 | Ga0395905_0033274 | 3300037471 | Bacteria | 4843 |
| 485 | Ga0395905_0038376 | 3300037471 | Bacteria | 4495 |
| 486 | Ga0395905_0039983 | 3300037471 | Bacteria | 4400 |
| 487 | Ga0395905_0044718 | 3300037471 | Bacteria | 4154 |
| 488 | Ga0395905_0054666 | 3300037471 | Bacteria | 3736 |
| 489 | Ga0395905_0105538 | 3300037471 | Bacteria | 2645 |
| 490 | Ga0395905_0205245 | 3300037471 | Bacteria | 1847 |
| 491 | Ga0395905_0297914 | 3300037471 | Bacteria | 1500 |
| 492 | Ga0395905_0310092 | 3300037471 | Bacteria | 1466 |
| 493 | Ga0395905_0481813 | 3300037471 | Bacteria | 1140 |
| 494 | Ga0395905_0660102 | 3300037471 | Bacteria | 948 |
| 495 | Ga0436364_0986946 | 3300037853 | Bacteria | 208509 |
| 496 | Ga0395901_0000181 | 3300038443 | Bacteria | 81816 |
| 497 | Ga0395901_0002142 | 3300038443 | Bacteria | 20180 |
| 498 | Ga0395901_0002161 | 3300038443 | Bacteria | 20073 |
| 499 | Ga0395901_0016015 | 3300038443 | Bacteria | 7638 |
| 500 | Ga0395901_0040320 | 3300038443 | Bacteria | 4836 |
| 501 | Ga0395901_0079087 | 3300038443 | Bacteria | 3433 |
| 502 | Ga0395901_0091864 | 3300038443 | Bacteria | 3177 |
| 503 | Ga0395901_0128239 | 3300038443 | Unclassified | 2666 |
| 504 | Ga0395901_0150608 | 3300038443 | Bacteria | 2444 |
| 505 | Ga0395901_0181409 | 3300038443 | Bacteria | 2208 |
| 506 | Ga0395901_0185298 | 3300038443 | Bacteria | 2183 |
| 507 | Ga0395901_0509315 | 3300038443 | Bacteria | 1224 |
| 508 | Ga0395901_0566880 | 3300038443 | Bacteria | 1149 |
| 509 | Ga0436365_1237401 | 3300039437 | Bacteria | 6540 |
| 510 | Ga0439448_0020938 | 3300042005 | Bacteria | 2027 |
| 511 | Ga0439432_014439 | 3300042006 | Bacteria | 2673 |
| 512 | Ga0439432_029495 | 3300042006 | Bacteria | 1783 |
| 513 | Ga0450889_000026 | 3300042144 | Bacteria | 12524 |
| 514 | Ga0439458_0000006 | 3300042157 | Bacteria | 32402 |
| 515 | Ga0466963_0066238 | 3300044694 | Bacteria | 2423 |
| 516 | Ga0466963_0089857 | 3300044694 | Bacteria | 2090 |
| 517 | Ga0466967_0168666 | 3300045976 | Bacteria | 2058 |
| 518 | Ga0466967_0253171 | 3300045976 | Bacteria | 1683 |
| 519 | Ga0466967_0299516 | 3300045976 | Bacteria | 1547 |
| 520 | Ga0466967_0322300 | 3300045976 | Bacteria | 1490 |
| 521 | Ga0495592_0004664 | 3300046454 | Bacteria | 10042 |
| 522 | Ga0495629_0001178 | 3300046459 | Bacteria | 20631 |
| 523 | Ga0495653_0000649 | 3300046463 | Bacteria | 26543 |
| 524 | Ga0495585_0037570 | 3300046492 | Bacteria | 2727 |
| 525 | Ga0495608_0000370 | 3300046511 | Bacteria | 31473 |
| 526 | Ga0495618_0023380 | 3300046514 | Bacteria | 3821 |
| 527 | Ga0495628_0003886 | 3300046516 | Bacteria | 13316 |
| 528 | Ga0495663_0019439 | 3300046525 | Bacteria | 1944 |
| 529 | Ga0495663_0045361 | 3300046525 | Bacteria | 1348 |
| 530 | Ga0495642_0031658 | 3300046528 | Bacteria | 2121 |
| 531 | Ga0495642_0120310 | 3300046528 | Bacteria | 1126 |
| 532 | Ga0495652_0004487 | 3300046529 | Bacteria | 13323 |
| 533 | Ga0495640_0018949 | 3300046533 | Bacteria | 5090 |
| 534 | Ga0495587_0007276 | 3300046536 | Bacteria | 7175 |
| 535 | Ga0495621_0007952 | 3300046539 | Bacteria | 3158 |
| 536 | Ga0495621_0012851 | 3300046539 | Bacteria | 2618 |
| 537 | Ga0495645_0009816 | 3300046543 | Bacteria | 6696 |
| 538 | Ga0495667_0001867 | 3300046559 | Bacteria | 13981 |
| 539 | Ga0495634_0055780 | 3300046642 | Bacteria | 2641 |
| 540 | Ga0495635_0001073 | 3300046663 | Bacteria | 18141 |
| 541 | Ga0495659_0003471 | 3300046664 | Bacteria | 5030 |
| 542 | Ga0495657_0013088 | 3300046675 | Bacteria | 6132 |
| 543 | Ga0495599_0000475 | 3300046678 | Bacteria | 22902 |
| 544 | Ga0495623_0001366 | 3300046679 | Bacteria | 16548 |
| 545 | Ga0495669_0000089 | 3300046684 | Bacteria | 60373 |
| 546 | Ga0495669_0001738 | 3300046684 | Bacteria | 8920 |
| 547 | Ga0495669_0009229 | 3300046684 | Bacteria | 4157 |
| 548 | Ga0495669_0015740 | 3300046684 | Bacteria | 3238 |
| 549 | Ga0495669_0038151 | 3300046684 | Bacteria | 2127 |
| 550 | Ga0495669_0044579 | 3300046684 | Bacteria | 1976 |
| 551 | Ga0495669_0104520 | 3300046684 | Bacteria | 1318 |
| 552 | Ga0495669_0160478 | 3300046684 | Bacteria | 1067 |
| 553 | Ga0495613_0095125 | 3300046689 | Bacteria | 2155 |
| 554 | Ga0495670_0067580 | 3300046691 | Bacteria | 1804 |
| 555 | Ga0495604_0003287 | 3300047317 | Bacteria | 12904 |
| 556 | Ga0495636_0040746 | 3300047318 | Bacteria | 1926 |
| 557 | Ga0495674_0006675 | 3300047319 | Bacteria | 11060 |
| 558 | Ga0495680_0001144 | 3300047322 | Bacteria | 29215 |
| 559 | Ga0495675_0010681 | 3300047444 | Bacteria | 5743 |
| 560 | Ga0495677_0003604 | 3300047445 | Bacteria | 6007 |
| 561 | Ga0495677_0028989 | 3300047445 | Bacteria | 2012 |
| 562 | Ga0495677_0072815 | 3300047445 | Bacteria | 1282 |
| 563 | Ga0495677_0184714 | 3300047445 | Bacteria | 808 |
| 564 | Ga0495684_0000227 | 3300047471 | Bacteria | 44020 |
| 565 | Ga0495593_0000615 | 3300047673 | Bacteria | 20374 |
| 566 | Ga0495602_0009537 | 3300048088 | Bacteria | 10089 |
| 567 | Ga0495615_0077002 | 3300048090 | Bacteria | 909 |
| 568 | Ga0496100_0286880 | 3300048903 | Bacteria | 1229 |
| 569 | Ga0496102_0595125 | 3300048905 | Bacteria | 1029 |
| 570 | Ga0496105_0049892 | 3300048908 | Bacteria | 3457 |
| 571 | Ga0496106_0060393 | 3300048909 | Bacteria | 2874 |
| 572 | Ga0496107_0069625 | 3300048910 | Bacteria | 2554 |
| 573 | Ga0496107_0080872 | 3300048910 | Bacteria | 2370 |
| 574 | Ga0496107_0124982 | 3300048910 | Bacteria | 1897 |
| 575 | Ga0496107_0166587 | 3300048910 | Bacteria | 1634 |
| 576 | Ga0496108_0008282 | 3300048911 | Bacteria | 8432 |
| 577 | Ga0496108_0012900 | 3300048911 | Bacteria | 6809 |
| 578 | Ga0496108_0431877 | 3300048911 | Bacteria | 1150 |
| 579 | Ga0496109_0000610 | 3300048912 | Bacteria | 29899 |
| 580 | Ga0496109_0184811 | 3300048912 | Bacteria | 1958 |
| 581 | Ga0496110_0042617 | 3300048913 | Bacteria | 3962 |
| 582 | Ga0496110_0124861 | 3300048913 | Bacteria | 2321 |
| 583 | Ga0496111_0056000 | 3300048914 | Bacteria | 2852 |
| 584 | Ga0496111_0139446 | 3300048914 | Bacteria | 1796 |
| 585 | Ga0496111_0197942 | 3300048914 | Bacteria | 1494 |
| 586 | Ga0496112_0004014 | 3300048915 | Bacteria | 12339 |
| 587 | Ga0496112_0029745 | 3300048915 | Bacteria | 5284 |
| 588 | Ga0496112_0084881 | 3300048915 | Bacteria | 3132 |
| 589 | Ga0496112_0126185 | 3300048915 | Bacteria | 2530 |
| 590 | Ga0496112_0271166 | 3300048915 | Bacteria | 1645 |
| 591 | Ga0496113_0000952 | 3300048916 | Bacteria | 15412 |
| 592 | Ga0496113_0003882 | 3300048916 | Bacteria | 9051 |
| 593 | Ga0496113_0113320 | 3300048916 | Bacteria | 2113 |
| 594 | Ga0496114_0353456 | 3300048917 | Bacteria | 1300 |
| 595 | Ga0496115_0025556 | 3300048918 | Bacteria | 4599 |
| 596 | Ga0501292_040616 | 3300049515 | Bacteria | 803 |
| 597 | Ga0501067_0021297 | 3300049583 | Bacteria | 3587 |
| 598 | Ga0501067_0127853 | 3300049583 | Bacteria | 1414 |
| 599 | Ga0501068_0103677 | 3300049584 | Bacteria | 1764 |
| 600 | Ga0501223_019090 | 3300049663 | Bacteria | 1348 |
| 601 | Ga0501233_060988 | 3300049668 | Bacteria | 936 |
| 602 | Ga0501249_009214 | 3300049679 | Bacteria | 2053 |
| 603 | Ga0501257_074204 | 3300049686 | Bacteria | 872 |
| 604 | Ga0501258_002637 | 3300049687 | Bacteria | 1591 |
| 605 | Ga0501234_006090 | 3300049707 | Bacteria | 1889 |
| 606 | Ga0501262_029681 | 3300049759 | Bacteria | 783 |
| 607 | Ga0501268_001525 | 3300049765 | Bacteria | 2900 |
| 608 | Ga0501268_014389 | 3300049765 | Bacteria | 1289 |
| 609 | nmdc:mga03683_8044_c1 | 3300050489 | Bacteria | 3690 |
| 610 | nmdc:mga06r32_34683_c1 | 3300050510 | Bacteria | 4759 |
| 611 | nmdc:mga08y16_215338_c1 | 3300050511 | Bacteria | 1989 |
| 612 | nmdc:mga08y16_564570_c1 | 3300050511 | Bacteria | 1150 |
| 613 | Ga0495601_0001461 | 3300053077 | Bacteria | 13022 |
| 614 | Ga0495595_0000709 | 3300053084 | Bacteria | 12704 |
| 615 | Ga0495619_0000561 | 3300053085 | Bacteria | 24566 |
| 616 | Ga0500616_0034045 | 3300053153 | Bacteria | 2777 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002244 | JGI24742J22300_10039564 | JGI24742J22300_100395642 | 205 |
| 2 | 3300048915 | Ga0496112_0126185 | Ga0496112_0126185_788_1498 | 220 |
| 3 | 3300031548 | Ga0307408_100094196 | Ga0307408_1000941963 | 222 |
| 4 | 3300005327 | Ga0070658_10067826 | Ga0070658_100678263 | 225 |
| 5 | 3300005344 | Ga0070661_100287209 | Ga0070661_1002872091 | 225 |
| 6 | 3300005364 | Ga0070673_100096424 | Ga0070673_1000964243 | 225 |
| 7 | 3300005614 | Ga0068856_100277447 | Ga0068856_1002774471 | 225 |
| 8 | 3300005616 | Ga0068852_100145130 | Ga0068852_1001451303 | 225 |
| 9 | 3300005618 | Ga0068864_100296904 | Ga0068864_1002969042 | 225 |
| 10 | 3300006237 | Ga0097621_100242515 | Ga0097621_1002425152 | 225 |
| 11 | 3300009177 | Ga0105248_10015484 | Ga0105248_100154843 | 225 |
| 12 | 3300013296 | Ga0157374_10406098 | Ga0157374_104060982 | 225 |
| 13 | 3300025920 | Ga0207649_10243692 | Ga0207649_102436922 | 225 |
| 14 | 3300025931 | Ga0207644_10039361 | Ga0207644_100393613 | 225 |
| 15 | 3300025941 | Ga0207711_10096157 | Ga0207711_100961573 | 225 |
| 16 | 3300025960 | Ga0207651_10036190 | Ga0207651_100361904 | 225 |
| 17 | 3300026095 | Ga0207676_10337350 | Ga0207676_103373502 | 225 |
| 18 | 3300026142 | Ga0207698_10123447 | Ga0207698_101234472 | 225 |
| 19 | 3300037471 | Ga0395905_0205245 | Ga0395905_0205245_868_1605 | 225 |
| 20 | 3300048903 | Ga0496100_0286880 | Ga0496100_0286880_25_762 | 225 |
| 21 | 3300048908 | Ga0496105_0049892 | Ga0496105_0049892_848_1585 | 225 |
| 22 | 3300048912 | Ga0496109_0184811 | Ga0496109_0184811_110_847 | 225 |
| 23 | 3300048914 | Ga0496111_0056000 | Ga0496111_0056000_935_1672 | 225 |
| 24 | 3300048915 | Ga0496112_0084881 | Ga0496112_0084881_1078_1815 | 225 |
| 25 | 3300048916 | Ga0496113_0113320 | Ga0496113_0113320_352_1089 | 225 |
| 26 | 3300005327 | Ga0070658_10463130 | Ga0070658_104631301 | 226 |
| 27 | 3300025909 | Ga0207705_10204444 | Ga0207705_102044443 | 226 |
| 28 | 3300005353 | Ga0070669_100034942 | Ga0070669_1000349421 | 227 |
| 29 | 3300005355 | Ga0070671_100023390 | Ga0070671_1000233907 | 227 |
| 30 | 3300005364 | Ga0070673_100078110 | Ga0070673_1000781105 | 227 |
| 31 | 3300005367 | Ga0070667_100022426 | Ga0070667_1000224263 | 227 |
| 32 | 3300005617 | Ga0068859_100000685 | Ga0068859_1000006852 | 227 |
| 33 | 3300005618 | Ga0068864_100000847 | Ga0068864_1000008475 | 227 |
| 34 | 3300005841 | Ga0068863_100009665 | Ga0068863_1000096654 | 227 |
| 35 | 3300005842 | Ga0068858_100000655 | Ga0068858_1000006559 | 227 |
| 36 | 3300005843 | Ga0068860_100167202 | Ga0068860_1001672022 | 227 |
| 37 | 3300005844 | Ga0068862_100103999 | Ga0068862_1001039992 | 227 |
| 38 | 3300006931 | Ga0097620_100000685 | Ga0097620_10000068531 | 227 |
| 39 | 3300009092 | Ga0105250_10008687 | Ga0105250_100086872 | 227 |
| 40 | 3300009101 | Ga0105247_10170555 | Ga0105247_101705553 | 227 |
| 41 | 3300009177 | Ga0105248_10002811 | Ga0105248_100028119 | 227 |
| 42 | 3300009553 | Ga0105249_10040279 | Ga0105249_100402794 | 227 |
| 43 | 3300013306 | Ga0163162_10009361 | Ga0163162_100093619 | 227 |
| 44 | 3300013308 | Ga0157375_10458525 | Ga0157375_104585252 | 227 |
| 45 | 3300014325 | Ga0163163_10000307 | Ga0163163_1000030728 | 227 |
| 46 | 3300014968 | Ga0157379_10011314 | Ga0157379_100113145 | 227 |
| 47 | 3300025711 | Ga0207696_1020379 | Ga0207696_10203792 | 227 |
| 48 | 3300025900 | Ga0207710_10058608 | Ga0207710_100586083 | 227 |
| 49 | 3300025923 | Ga0207681_10057474 | Ga0207681_100574744 | 227 |
| 50 | 3300025931 | Ga0207644_10013892 | Ga0207644_100138927 | 227 |
| 51 | 3300025941 | Ga0207711_10001243 | Ga0207711_1000124323 | 227 |
| 52 | 3300025960 | Ga0207651_10053889 | Ga0207651_100538892 | 227 |
| 53 | 3300025961 | Ga0207712_10039903 | Ga0207712_100399034 | 227 |
| 54 | 3300025986 | Ga0207658_10010272 | Ga0207658_100102722 | 227 |
| 55 | 3300026035 | Ga0207703_10015617 | Ga0207703_100156179 | 227 |
| 56 | 3300026088 | Ga0207641_10000502 | Ga0207641_1000050225 | 227 |
| 57 | 3300026095 | Ga0207676_10000694 | Ga0207676_1000069427 | 227 |
| 58 | 3300028381 | Ga0268264_10000410 | Ga0268264_1000041033 | 227 |
| 59 | 3300028381 | Ga0268264_10000418 | Ga0268264_1000041827 | 227 |
| 60 | 3300006175 | Ga0070712_100101670 | Ga0070712_1001016702 | 228 |
| 61 | 3300025915 | Ga0207693_10120911 | Ga0207693_101209112 | 228 |
| 62 | 3300031995 | Ga0307409_100617882 | Ga0307409_1006178822 | 229 |
| 63 | 3300009177 | Ga0105248_10002158 | Ga0105248_1000215818 | 230 |
| 64 | 3300048911 | Ga0496108_0012900 | Ga0496108_0012900_616_1353 | 230 |
| 65 | 3300048914 | Ga0496111_0139446 | Ga0496111_0139446_233_970 | 230 |
| 66 | 3300048915 | Ga0496112_0004014 | Ga0496112_0004014_10171_10908 | 230 |
| 67 | 3300048916 | Ga0496113_0000952 | Ga0496113_0000952_2983_3720 | 230 |
| 68 | 3300037312 | Ga0395899_0084951 | Ga0395899_0084951_255_1001 | 231 |
| 69 | 3300037418 | Ga0395900_0029983 | Ga0395900_0029983_3207_3953 | 231 |
| 70 | 3300038443 | Ga0395901_0509315 | Ga0395901_0509315_357_1103 | 231 |
| 71 | 3300009177 | Ga0105248_10010251 | Ga0105248_100102514 | 232 |
| 72 | 3300013306 | Ga0163162_10090527 | Ga0163162_100905275 | 232 |
| 73 | 3300014968 | Ga0157379_10363070 | Ga0157379_103630702 | 232 |
| 74 | 3300025941 | Ga0207711_10006081 | Ga0207711_100060814 | 232 |
| 75 | 3300048914 | Ga0496111_0197942 | Ga0496111_0197942_557_1297 | 232 |
| 76 | 3300003322 | rootL2_10227603 | rootL2_102276033 | 233 |
| 77 | 3300005985 | Ga0081539_10043435 | Ga0081539_100434353 | 233 |
| 78 | 3300013308 | Ga0157375_10112122 | Ga0157375_101121221 | 233 |
| 79 | 3300005546 | Ga0070696_100098641 | Ga0070696_1000986412 | 234 |
| 80 | 3300005339 | Ga0070660_100109272 | Ga0070660_1001092722 | 235 |
| 81 | 3300013100 | Ga0157373_10038318 | Ga0157373_100383182 | 235 |
| 82 | 3300037312 | Ga0395899_0074724 | Ga0395899_0074724_767_1516 | 235 |
| 83 | 3300037312 | Ga0395899_0171669 | Ga0395899_0171669_646_1380 | 235 |
| 84 | 3300037418 | Ga0395900_0192872 | Ga0395900_0192872_1138_1887 | 235 |
| 85 | 3300037418 | Ga0395900_0370688 | Ga0395900_0370688_442_1191 | 235 |
| 86 | 3300037471 | Ga0395905_0310092 | Ga0395905_0310092_664_1413 | 235 |
| 87 | 3300038443 | Ga0395901_0091864 | Ga0395901_0091864_24_773 | 235 |
| 88 | 3300005331 | Ga0070670_100058060 | Ga0070670_1000580602 | 236 |
| 89 | 3300005347 | Ga0070668_100371657 | Ga0070668_1003716572 | 236 |
| 90 | 3300025931 | Ga0207644_10000052 | Ga0207644_100000525 | 236 |
| 91 | 3300025941 | Ga0207711_10000420 | Ga0207711_1000042016 | 236 |
| 92 | 3300049687 | Ga0501258_002637 | Ga0501258_002637_410_1123 | 237 |
| 93 | 3300049759 | Ga0501262_029681 | Ga0501262_029681_15_728 | 237 |
| 94 | 3300005844 | Ga0068862_100042308 | Ga0068862_1000423082 | 238 |
| 95 | 3300028380 | Ga0268265_10046757 | Ga0268265_100467574 | 238 |
| 96 | 3300048905 | Ga0496102_0595125 | Ga0496102_0595125_139_861 | 238 |
| 97 | 3300013100 | Ga0157373_10018646 | Ga0157373_100186464 | 239 |
| 98 | 3300013297 | Ga0157378_10153110 | Ga0157378_101531104 | 240 |
| 99 | 3300014497 | Ga0182008_10155310 | Ga0182008_101553101 | 240 |
| 100 | 3300028573 | Ga0265334_10039265 | Ga0265334_100392652 | 240 |
| 101 | 3300031235 | Ga0265330_10021275 | Ga0265330_100212752 | 240 |
| 102 | 3300035086 | Ga0373934_0003383 | Ga0373934_0003383_4013_4735 | 240 |
| 103 | 3300035117 | Ga0373953_0000807 | Ga0373953_0000807_5617_6339 | 240 |
| 104 | 3300035118 | Ga0373954_0003796 | Ga0373954_0003796_2232_2954 | 240 |
| 105 | 3300035119 | Ga0373956_0008718 | Ga0373956_0008718_351_1073 | 240 |
| 106 | 3300035120 | Ga0373957_0000854 | Ga0373957_0000854_419_1141 | 240 |
| 107 | 3300035172 | Ga0373955_0000373 | Ga0373955_0000373_7185_7907 | 240 |
| 108 | 3300035724 | Ga0373933_0004235 | Ga0373933_0004235_6609_7331 | 240 |
| 109 | 3300037312 | Ga0395899_0000302 | Ga0395899_0000302_40771_41493 | 240 |
| 110 | 3300037312 | Ga0395899_0113071 | Ga0395899_0113071_1082_1804 | 240 |
| 111 | 3300037418 | Ga0395900_0007215 | Ga0395900_0007215_2751_3473 | 240 |
| 112 | 3300037466 | Ga0395898_0000054 | Ga0395898_0000054_61712_62434 | 240 |
| 113 | 3300037466 | Ga0395898_0001674 | Ga0395898_0001674_18087_18809 | 240 |
| 114 | 3300037471 | Ga0395905_0000046 | Ga0395905_0000046_22718_23440 | 240 |
| 115 | 3300037471 | Ga0395905_0002780 | Ga0395905_0002780_18034_18756 | 240 |
| 116 | 3300038443 | Ga0395901_0002142 | Ga0395901_0002142_4589_5311 | 240 |
| 117 | 3300038443 | Ga0395901_0002161 | Ga0395901_0002161_15592_16314 | 240 |
| 118 | 3300044694 | Ga0466963_0066238 | Ga0466963_0066238_1552_2289 | 240 |
| 119 | 3300045976 | Ga0466967_0168666 | Ga0466967_0168666_22_765 | 240 |
| 120 | 3300045976 | Ga0466967_0253171 | Ga0466967_0253171_494_1228 | 240 |
| 121 | 3300046454 | Ga0495592_0004664 | Ga0495592_0004664_2136_2858 | 240 |
| 122 | 3300046459 | Ga0495629_0001178 | Ga0495629_0001178_13300_14022 | 240 |
| 123 | 3300046463 | Ga0495653_0000649 | Ga0495653_0000649_20486_21208 | 240 |
| 124 | 3300046511 | Ga0495608_0000370 | Ga0495608_0000370_24142_24864 | 240 |
| 125 | 3300046514 | Ga0495618_0023380 | Ga0495618_0023380_1772_2494 | 240 |
| 126 | 3300046516 | Ga0495628_0003886 | Ga0495628_0003886_8436_9158 | 240 |
| 127 | 3300046529 | Ga0495652_0004487 | Ga0495652_0004487_7185_7907 | 240 |
| 128 | 3300046533 | Ga0495640_0018949 | Ga0495640_0018949_1321_2043 | 240 |
| 129 | 3300046536 | Ga0495587_0007276 | Ga0495587_0007276_2447_3169 | 240 |
| 130 | 3300046543 | Ga0495645_0009816 | Ga0495645_0009816_2258_2980 | 240 |
| 131 | 3300046559 | Ga0495667_0001867 | Ga0495667_0001867_6075_6797 | 240 |
| 132 | 3300046642 | Ga0495634_0055780 | Ga0495634_0055780_1789_2511 | 240 |
| 133 | 3300046663 | Ga0495635_0001073 | Ga0495635_0001073_4183_4905 | 240 |
| 134 | 3300046675 | Ga0495657_0013088 | Ga0495657_0013088_1228_1950 | 240 |
| 135 | 3300046678 | Ga0495599_0000475 | Ga0495599_0000475_16563_17285 | 240 |
| 136 | 3300046679 | Ga0495623_0001366 | Ga0495623_0001366_6482_7204 | 240 |
| 137 | 3300046689 | Ga0495613_0095125 | Ga0495613_0095125_399_1121 | 240 |
| 138 | 3300047317 | Ga0495604_0003287 | Ga0495604_0003287_7634_8356 | 240 |
| 139 | 3300047319 | Ga0495674_0006675 | Ga0495674_0006675_7845_8567 | 240 |
| 140 | 3300047322 | Ga0495680_0001144 | Ga0495680_0001144_8033_8755 | 240 |
| 141 | 3300047444 | Ga0495675_0010681 | Ga0495675_0010681_1989_2711 | 240 |
| 142 | 3300047471 | Ga0495684_0000227 | Ga0495684_0000227_8723_9445 | 240 |
| 143 | 3300047673 | Ga0495593_0000615 | Ga0495593_0000615_10566_11288 | 240 |
| 144 | 3300048088 | Ga0495602_0009537 | Ga0495602_0009537_5136_5858 | 240 |
| 145 | 3300048912 | Ga0496109_0000610 | Ga0496109_0000610_15549_16286 | 240 |
| 146 | 3300048913 | Ga0496110_0124861 | Ga0496110_0124861_1114_1851 | 240 |
| 147 | 3300048915 | Ga0496112_0029745 | Ga0496112_0029745_845_1567 | 240 |
| 148 | 3300048916 | Ga0496113_0003882 | Ga0496113_0003882_5227_5949 | 240 |
| 149 | 3300053077 | Ga0495601_0001461 | Ga0495601_0001461_4610_5332 | 240 |
| 150 | 3300053084 | Ga0495595_0000709 | Ga0495595_0000709_4237_4959 | 240 |
| 151 | 3300053085 | Ga0495619_0000561 | Ga0495619_0000561_11345_12067 | 240 |
| 152 | 3300009177 | Ga0105248_10616811 | Ga0105248_106168112 | 241 |
| 153 | 3300048917 | Ga0496114_0353456 | Ga0496114_0353456_175_909 | 241 |
| 154 | 3300046684 | Ga0495669_0009229 | Ga0495669_0009229_82_810 | 242 |
| 155 | 3300005719 | Ga0068861_100367393 | Ga0068861_1003673931 | 243 |
| 156 | 3300006237 | Ga0097621_100097142 | Ga0097621_1000971425 | 243 |
| 157 | 3300006358 | Ga0068871_100011802 | Ga0068871_1000118026 | 243 |
| 158 | 3300021388 | Ga0213875_10001046 | Ga0213875_1000104610 | 243 |
| 159 | 3300026118 | Ga0207675_100523906 | Ga0207675_1005239062 | 243 |
| 160 | 3300031548 | Ga0307408_100076035 | Ga0307408_1000760355 | 243 |
| 161 | 3300031731 | Ga0307405_10624427 | Ga0307405_106244271 | 243 |
| 162 | 3300031824 | Ga0307413_10462631 | Ga0307413_104626312 | 243 |
| 163 | 3300031852 | Ga0307410_10004456 | Ga0307410_100044561 | 243 |
| 164 | 3300031852 | Ga0307410_10300655 | Ga0307410_103006553 | 243 |
| 165 | 3300031903 | Ga0307407_10002528 | Ga0307407_1000252811 | 243 |
| 166 | 3300031903 | Ga0307407_10431245 | Ga0307407_104312451 | 243 |
| 167 | 3300031911 | Ga0307412_10006554 | Ga0307412_1000655410 | 243 |
| 168 | 3300031995 | Ga0307409_100039238 | Ga0307409_1000392381 | 243 |
| 169 | 3300032002 | Ga0307416_100007131 | Ga0307416_10000713111 | 243 |
| 170 | 3300032002 | Ga0307416_101146597 | Ga0307416_1011465971 | 243 |
| 171 | 3300032004 | Ga0307414_10768985 | Ga0307414_107689851 | 243 |
| 172 | 3300032005 | Ga0307411_10285595 | Ga0307411_102855952 | 243 |
| 173 | 3300032126 | Ga0307415_100519608 | Ga0307415_1005196082 | 243 |
| 174 | 3300037312 | Ga0395899_0046160 | Ga0395899_0046160_508_1239 | 243 |
| 175 | 3300037418 | Ga0395900_0008571 | Ga0395900_0008571_5951_6682 | 243 |
| 176 | 3300037471 | Ga0395905_0013031 | Ga0395905_0013031_5086_5817 | 243 |
| 177 | 3300037471 | Ga0395905_0025708 | Ga0395905_0025708_4290_5021 | 243 |
| 178 | 3300037853 | Ga0436364_0986946 | Ga0436364_0986946_179149_179880 | 243 |
| 179 | 3300038443 | Ga0395901_0150608 | Ga0395901_0150608_403_1134 | 243 |
| 180 | 3300042006 | Ga0439432_014439 | Ga0439432_014439_321_1052 | 243 |
| 181 | 3300048913 | Ga0496110_0042617 | Ga0496110_0042617_3218_3949 | 243 |
| 182 | 3300049515 | Ga0501292_040616 | Ga0501292_040616_28_759 | 243 |
| 183 | 3300049663 | Ga0501223_019090 | Ga0501223_019090_388_1119 | 243 |
| 184 | 3300049707 | Ga0501234_006090 | Ga0501234_006090_20_751 | 243 |
| 185 | 3300049765 | Ga0501268_014389 | Ga0501268_014389_465_1196 | 243 |
| 186 | 3300005293 | Ga0065715_10091270 | Ga0065715_100912705 | 244 |
| 187 | 3300005331 | Ga0070670_100001186 | Ga0070670_1000011862 | 244 |
| 188 | 3300005331 | Ga0070670_100016571 | Ga0070670_1000165714 | 244 |
| 189 | 3300005333 | Ga0070677_10013309 | Ga0070677_100133094 | 244 |
| 190 | 3300005333 | Ga0070677_10086012 | Ga0070677_100860122 | 244 |
| 191 | 3300005333 | Ga0070677_10126703 | Ga0070677_101267032 | 244 |
| 192 | 3300005335 | Ga0070666_10147928 | Ga0070666_101479282 | 244 |
| 193 | 3300005340 | Ga0070689_100120587 | Ga0070689_1001205873 | 244 |
| 194 | 3300005344 | Ga0070661_100014342 | Ga0070661_1000143422 | 244 |
| 195 | 3300005347 | Ga0070668_100035488 | Ga0070668_1000354883 | 244 |
| 196 | 3300005347 | Ga0070668_100426448 | Ga0070668_1004264481 | 244 |
| 197 | 3300005347 | Ga0070668_100615816 | Ga0070668_1006158162 | 244 |
| 198 | 3300005353 | Ga0070669_100016538 | Ga0070669_1000165384 | 244 |
| 199 | 3300005353 | Ga0070669_100091705 | Ga0070669_1000917051 | 244 |
| 200 | 3300005354 | Ga0070675_100009019 | Ga0070675_1000090196 | 244 |
| 201 | 3300005355 | Ga0070671_100000051 | Ga0070671_10000005122 | 244 |
| 202 | 3300005355 | Ga0070671_100036881 | Ga0070671_1000368812 | 244 |
| 203 | 3300005356 | Ga0070674_100070580 | Ga0070674_1000705803 | 244 |
| 204 | 3300005364 | Ga0070673_100108272 | Ga0070673_1001082722 | 244 |
| 205 | 3300005367 | Ga0070667_100018227 | Ga0070667_1000182274 | 244 |
| 206 | 3300005456 | Ga0070678_100010816 | Ga0070678_1000108162 | 244 |
| 207 | 3300005456 | Ga0070678_100025742 | Ga0070678_1000257423 | 244 |
| 208 | 3300005456 | Ga0070678_100436067 | Ga0070678_1004360671 | 244 |
| 209 | 3300005457 | Ga0070662_100002559 | Ga0070662_1000025599 | 244 |
| 210 | 3300005457 | Ga0070662_100005921 | Ga0070662_1000059212 | 244 |
| 211 | 3300005457 | Ga0070662_100049117 | Ga0070662_1000491173 | 244 |
| 212 | 3300005459 | Ga0068867_100133078 | Ga0068867_1001330783 | 244 |
| 213 | 3300005539 | Ga0068853_100046035 | Ga0068853_1000460352 | 244 |
| 214 | 3300005543 | Ga0070672_100000170 | Ga0070672_10000017016 | 244 |
| 215 | 3300005543 | Ga0070672_100034628 | Ga0070672_1000346286 | 244 |
| 216 | 3300005543 | Ga0070672_100040819 | Ga0070672_1000408194 | 244 |
| 217 | 3300005564 | Ga0070664_100033148 | Ga0070664_1000331483 | 244 |
| 218 | 3300005577 | Ga0068857_100332636 | Ga0068857_1003326363 | 244 |
| 219 | 3300005617 | Ga0068859_100017516 | Ga0068859_1000175162 | 244 |
| 220 | 3300005618 | Ga0068864_100077259 | Ga0068864_1000772593 | 244 |
| 221 | 3300005719 | Ga0068861_100091426 | Ga0068861_1000914262 | 244 |
| 222 | 3300005841 | Ga0068863_100299722 | Ga0068863_1002997222 | 244 |
| 223 | 3300005843 | Ga0068860_100112868 | Ga0068860_1001128682 | 244 |
| 224 | 3300005844 | Ga0068862_100009116 | Ga0068862_1000091167 | 244 |
| 225 | 3300006847 | Ga0075431_100072938 | Ga0075431_1000729382 | 244 |
| 226 | 3300006931 | Ga0097620_100017516 | Ga0097620_1000175167 | 244 |
| 227 | 3300009148 | Ga0105243_10486280 | Ga0105243_104862802 | 244 |
| 228 | 3300009176 | Ga0105242_10115602 | Ga0105242_101156022 | 244 |
| 229 | 3300009177 | Ga0105248_10472196 | Ga0105248_104721962 | 244 |
| 230 | 3300009553 | Ga0105249_10089432 | Ga0105249_100894323 | 244 |
| 231 | 3300013306 | Ga0163162_10320695 | Ga0163162_103206951 | 244 |
| 232 | 3300014326 | Ga0157380_10009741 | Ga0157380_100097414 | 244 |
| 233 | 3300014326 | Ga0157380_10033760 | Ga0157380_100337603 | 244 |
| 234 | 3300017792 | Ga0163161_10068025 | Ga0163161_100680251 | 244 |
| 235 | 3300025315 | Ga0207697_10012170 | Ga0207697_100121704 | 244 |
| 236 | 3300025893 | Ga0207682_10001448 | Ga0207682_100014484 | 244 |
| 237 | 3300025901 | Ga0207688_10149983 | Ga0207688_101499832 | 244 |
| 238 | 3300025901 | Ga0207688_10182670 | Ga0207688_101826702 | 244 |
| 239 | 3300025903 | Ga0207680_10120023 | Ga0207680_101200231 | 244 |
| 240 | 3300025920 | Ga0207649_10065284 | Ga0207649_100652842 | 244 |
| 241 | 3300025931 | Ga0207644_10003062 | Ga0207644_1000306213 | 244 |
| 242 | 3300025931 | Ga0207644_10180377 | Ga0207644_101803772 | 244 |
| 243 | 3300025933 | Ga0207706_10009249 | Ga0207706_100092492 | 244 |
| 244 | 3300025933 | Ga0207706_10009297 | Ga0207706_100092977 | 244 |
| 245 | 3300025933 | Ga0207706_10047040 | Ga0207706_100470404 | 244 |
| 246 | 3300025934 | Ga0207686_10302489 | Ga0207686_103024891 | 244 |
| 247 | 3300025935 | Ga0207709_10303028 | Ga0207709_103030282 | 244 |
| 248 | 3300025937 | Ga0207669_10017079 | Ga0207669_100170793 | 244 |
| 249 | 3300025937 | Ga0207669_10035772 | Ga0207669_100357722 | 244 |
| 250 | 3300025940 | Ga0207691_10000765 | Ga0207691_1000076525 | 244 |
| 251 | 3300025940 | Ga0207691_10042808 | Ga0207691_100428084 | 244 |
| 252 | 3300025940 | Ga0207691_10135850 | Ga0207691_101358504 | 244 |
| 253 | 3300025941 | Ga0207711_10382802 | Ga0207711_103828022 | 244 |
| 254 | 3300025945 | Ga0207679_10021413 | Ga0207679_100214135 | 244 |
| 255 | 3300025945 | Ga0207679_10164998 | Ga0207679_101649982 | 244 |
| 256 | 3300025960 | Ga0207651_10039183 | Ga0207651_100391832 | 244 |
| 257 | 3300025960 | Ga0207651_10048616 | Ga0207651_100486164 | 244 |
| 258 | 3300025961 | Ga0207712_10168002 | Ga0207712_101680022 | 244 |
| 259 | 3300025972 | Ga0207668_10034340 | Ga0207668_100343404 | 244 |
| 260 | 3300025986 | Ga0207658_10191313 | Ga0207658_101913131 | 244 |
| 261 | 3300026041 | Ga0207639_10102963 | Ga0207639_101029632 | 244 |
| 262 | 3300026067 | Ga0207678_10063460 | Ga0207678_100634602 | 244 |
| 263 | 3300026089 | Ga0207648_10008755 | Ga0207648_100087556 | 244 |
| 264 | 3300026095 | Ga0207676_10122021 | Ga0207676_101220214 | 244 |
| 265 | 3300026095 | Ga0207676_10451026 | Ga0207676_104510262 | 244 |
| 266 | 3300026116 | Ga0207674_10140417 | Ga0207674_101404174 | 244 |
| 267 | 3300026118 | Ga0207675_100032623 | Ga0207675_1000326232 | 244 |
| 268 | 3300026121 | Ga0207683_10005095 | Ga0207683_1000509510 | 244 |
| 269 | 3300026121 | Ga0207683_10043209 | Ga0207683_100432094 | 244 |
| 270 | 3300028380 | Ga0268265_10011100 | Ga0268265_100111004 | 244 |
| 271 | 3300028381 | Ga0268264_10739027 | Ga0268264_107390271 | 244 |
| 272 | 3300030745 | Ga0316182_1108277 | Ga0316182_11082773 | 244 |
| 273 | 3300031824 | Ga0307413_10000456 | Ga0307413_1000045612 | 244 |
| 274 | 3300031852 | Ga0307410_10000393 | Ga0307410_1000039310 | 244 |
| 275 | 3300031911 | Ga0307412_10274287 | Ga0307412_102742872 | 244 |
| 276 | 3300031995 | Ga0307409_100000418 | Ga0307409_1000004187 | 244 |
| 277 | 3300032004 | Ga0307414_10006871 | Ga0307414_100068717 | 244 |
| 278 | 3300032005 | Ga0307411_10026563 | Ga0307411_100265635 | 244 |
| 279 | 3300037466 | Ga0395898_0171256 | Ga0395898_0171256_750_1493 | 244 |
| 280 | 3300037471 | Ga0395905_0000500 | Ga0395905_0000500_30525_31268 | 244 |
| 281 | 3300038443 | Ga0395901_0000181 | Ga0395901_0000181_29605_30348 | 244 |
| 282 | 3300046525 | Ga0495663_0019439 | Ga0495663_0019439_818_1552 | 244 |
| 283 | 3300046528 | Ga0495642_0031658 | Ga0495642_0031658_496_1230 | 244 |
| 284 | 3300046539 | Ga0495621_0007952 | Ga0495621_0007952_447_1181 | 244 |
| 285 | 3300046539 | Ga0495621_0012851 | Ga0495621_0012851_1458_2216 | 244 |
| 286 | 3300046664 | Ga0495659_0003471 | Ga0495659_0003471_2958_3692 | 244 |
| 287 | 3300046684 | Ga0495669_0160478 | Ga0495669_0160478_53_787 | 244 |
| 288 | 3300046691 | Ga0495670_0067580 | Ga0495670_0067580_428_1162 | 244 |
| 289 | 3300047318 | Ga0495636_0040746 | Ga0495636_0040746_287_1021 | 244 |
| 290 | 3300047445 | Ga0495677_0072815 | Ga0495677_0072815_204_938 | 244 |
| 291 | 3300048090 | Ga0495615_0077002 | Ga0495615_0077002_19_753 | 244 |
| 292 | 3300050510 | nmdc:mga06r32_34683_c1 | nmdc:mga06r32_34683_c1_3502_4236 | 244 |
| 293 | 3300005328 | Ga0070676_10036889 | Ga0070676_100368892 | 245 |
| 294 | 3300005336 | Ga0070680_100121271 | Ga0070680_1001212712 | 245 |
| 295 | 3300005455 | Ga0070663_100179938 | Ga0070663_1001799382 | 245 |
| 296 | 3300005457 | Ga0070662_100001195 | Ga0070662_1000011956 | 245 |
| 297 | 3300005459 | Ga0068867_100152249 | Ga0068867_1001522492 | 245 |
| 298 | 3300005530 | Ga0070679_100070254 | Ga0070679_1000702542 | 245 |
| 299 | 3300005563 | Ga0068855_100592673 | Ga0068855_1005926731 | 245 |
| 300 | 3300005564 | Ga0070664_100289239 | Ga0070664_1002892393 | 245 |
| 301 | 3300025907 | Ga0207645_10028161 | Ga0207645_100281613 | 245 |
| 302 | 3300025921 | Ga0207652_10039973 | Ga0207652_100399736 | 245 |
| 303 | 3300025933 | Ga0207706_10000299 | Ga0207706_1000029951 | 245 |
| 304 | 3300025945 | Ga0207679_10187376 | Ga0207679_101873763 | 245 |
| 305 | 3300026067 | Ga0207678_10040429 | Ga0207678_100404294 | 245 |
| 306 | 3300026089 | Ga0207648_10216123 | Ga0207648_102161232 | 245 |
| 307 | 3300031903 | Ga0307407_10158241 | Ga0307407_101582413 | 245 |
| 308 | 3300032002 | Ga0307416_100177774 | Ga0307416_1001777742 | 245 |
| 309 | 3300032005 | Ga0307411_10137703 | Ga0307411_101377032 | 245 |
| 310 | 3300037312 | Ga0395899_0354888 | Ga0395899_0354888_79_819 | 245 |
| 311 | 3300037418 | Ga0395900_0197581 | Ga0395900_0197581_1214_1954 | 245 |
| 312 | 3300046528 | Ga0495642_0120310 | Ga0495642_0120310_170_922 | 245 |
| 313 | 3300047445 | Ga0495677_0003604 | Ga0495677_0003604_3785_4537 | 245 |
| 314 | 3300002067 | JGI24735J21928_10003578 | JGI24735J21928_100035786 | 246 |
| 315 | 3300005327 | Ga0070658_10014827 | Ga0070658_100148273 | 246 |
| 316 | 3300005327 | Ga0070658_10273656 | Ga0070658_102736563 | 246 |
| 317 | 3300005327 | Ga0070658_10594960 | Ga0070658_105949601 | 246 |
| 318 | 3300005331 | Ga0070670_100054799 | Ga0070670_1000547994 | 246 |
| 319 | 3300005333 | Ga0070677_10064672 | Ga0070677_100646722 | 246 |
| 320 | 3300005335 | Ga0070666_10271933 | Ga0070666_102719331 | 246 |
| 321 | 3300005339 | Ga0070660_100034999 | Ga0070660_1000349993 | 246 |
| 322 | 3300005339 | Ga0070660_100549275 | Ga0070660_1005492751 | 246 |
| 323 | 3300005340 | Ga0070689_100326175 | Ga0070689_1003261752 | 246 |
| 324 | 3300005344 | Ga0070661_100190311 | Ga0070661_1001903111 | 246 |
| 325 | 3300005344 | Ga0070661_100571582 | Ga0070661_1005715821 | 246 |
| 326 | 3300005347 | Ga0070668_100272100 | Ga0070668_1002721002 | 246 |
| 327 | 3300005353 | Ga0070669_100012623 | Ga0070669_1000126236 | 246 |
| 328 | 3300005353 | Ga0070669_100099311 | Ga0070669_1000993114 | 246 |
| 329 | 3300005354 | Ga0070675_100223641 | Ga0070675_1002236412 | 246 |
| 330 | 3300005354 | Ga0070675_100247536 | Ga0070675_1002475363 | 246 |
| 331 | 3300005355 | Ga0070671_100042452 | Ga0070671_1000424525 | 246 |
| 332 | 3300005355 | Ga0070671_100066228 | Ga0070671_1000662282 | 246 |
| 333 | 3300005355 | Ga0070671_100131362 | Ga0070671_1001313623 | 246 |
| 334 | 3300005355 | Ga0070671_100241992 | Ga0070671_1002419921 | 246 |
| 335 | 3300005364 | Ga0070673_100367821 | Ga0070673_1003678211 | 246 |
| 336 | 3300005366 | Ga0070659_100008617 | Ga0070659_1000086174 | 246 |
| 337 | 3300005366 | Ga0070659_100138163 | Ga0070659_1001381633 | 246 |
| 338 | 3300005366 | Ga0070659_100420584 | Ga0070659_1004205841 | 246 |
| 339 | 3300005367 | Ga0070667_100023656 | Ga0070667_1000236562 | 246 |
| 340 | 3300005367 | Ga0070667_100089870 | Ga0070667_1000898703 | 246 |
| 341 | 3300005436 | Ga0070713_100009408 | Ga0070713_1000094082 | 246 |
| 342 | 3300005444 | Ga0070694_100043437 | Ga0070694_1000434373 | 246 |
| 343 | 3300005455 | Ga0070663_100017308 | Ga0070663_1000173086 | 246 |
| 344 | 3300005455 | Ga0070663_100051507 | Ga0070663_1000515075 | 246 |
| 345 | 3300005456 | Ga0070678_100106737 | Ga0070678_1001067372 | 246 |
| 346 | 3300005457 | Ga0070662_100078627 | Ga0070662_1000786272 | 246 |
| 347 | 3300005457 | Ga0070662_100366533 | Ga0070662_1003665332 | 246 |
| 348 | 3300005459 | Ga0068867_100081831 | Ga0068867_1000818315 | 246 |
| 349 | 3300005530 | Ga0070679_100014712 | Ga0070679_1000147123 | 246 |
| 350 | 3300005539 | Ga0068853_100029613 | Ga0068853_1000296135 | 246 |
| 351 | 3300005539 | Ga0068853_100285248 | Ga0068853_1002852482 | 246 |
| 352 | 3300005539 | Ga0068853_100297151 | Ga0068853_1002971512 | 246 |
| 353 | 3300005543 | Ga0070672_100028979 | Ga0070672_1000289792 | 246 |
| 354 | 3300005543 | Ga0070672_100085930 | Ga0070672_1000859302 | 246 |
| 355 | 3300005543 | Ga0070672_100362227 | Ga0070672_1003622272 | 246 |
| 356 | 3300005545 | Ga0070695_100066652 | Ga0070695_1000666524 | 246 |
| 357 | 3300005546 | Ga0070696_100014446 | Ga0070696_1000144463 | 246 |
| 358 | 3300005547 | Ga0070693_100028510 | Ga0070693_1000285103 | 246 |
| 359 | 3300005548 | Ga0070665_100003837 | Ga0070665_10000383720 | 246 |
| 360 | 3300005548 | Ga0070665_100382596 | Ga0070665_1003825962 | 246 |
| 361 | 3300005564 | Ga0070664_100004436 | Ga0070664_1000044369 | 246 |
| 362 | 3300005564 | Ga0070664_100027929 | Ga0070664_1000279295 | 246 |
| 363 | 3300005564 | Ga0070664_100205983 | Ga0070664_1002059832 | 246 |
| 364 | 3300005577 | Ga0068857_100012932 | Ga0068857_10001293210 | 246 |
| 365 | 3300005577 | Ga0068857_100034684 | Ga0068857_1000346845 | 246 |
| 366 | 3300005577 | Ga0068857_100198097 | Ga0068857_1001980974 | 246 |
| 367 | 3300005578 | Ga0068854_100011508 | Ga0068854_1000115088 | 246 |
| 368 | 3300005578 | Ga0068854_100127428 | Ga0068854_1001274282 | 246 |
| 369 | 3300005578 | Ga0068854_100154952 | Ga0068854_1001549524 | 246 |
| 370 | 3300005616 | Ga0068852_100188765 | Ga0068852_1001887652 | 246 |
| 371 | 3300005616 | Ga0068852_100235123 | Ga0068852_1002351232 | 246 |
| 372 | 3300005616 | Ga0068852_100389629 | Ga0068852_1003896292 | 246 |
| 373 | 3300005616 | Ga0068852_100468928 | Ga0068852_1004689281 | 246 |
| 374 | 3300005616 | Ga0068852_100788403 | Ga0068852_1007884031 | 246 |
| 375 | 3300005617 | Ga0068859_100009717 | Ga0068859_1000097179 | 246 |
| 376 | 3300005617 | Ga0068859_100083607 | Ga0068859_1000836072 | 246 |
| 377 | 3300005617 | Ga0068859_100187836 | Ga0068859_1001878361 | 246 |
| 378 | 3300005618 | Ga0068864_100001619 | Ga0068864_1000016194 | 246 |
| 379 | 3300005618 | Ga0068864_100039809 | Ga0068864_1000398095 | 246 |
| 380 | 3300005719 | Ga0068861_100173987 | Ga0068861_1001739872 | 246 |
| 381 | 3300005841 | Ga0068863_100029749 | Ga0068863_1000297495 | 246 |
| 382 | 3300005841 | Ga0068863_100048789 | Ga0068863_1000487892 | 246 |
| 383 | 3300005841 | Ga0068863_100058908 | Ga0068863_1000589084 | 246 |
| 384 | 3300005841 | Ga0068863_100149896 | Ga0068863_1001498964 | 246 |
| 385 | 3300005841 | Ga0068863_100303291 | Ga0068863_1003032912 | 246 |
| 386 | 3300005842 | Ga0068858_100022867 | Ga0068858_1000228678 | 246 |
| 387 | 3300005842 | Ga0068858_100147228 | Ga0068858_1001472283 | 246 |
| 388 | 3300005843 | Ga0068860_100066251 | Ga0068860_1000662515 | 246 |
| 389 | 3300005843 | Ga0068860_100483966 | Ga0068860_1004839662 | 246 |
| 390 | 3300005843 | Ga0068860_101039472 | Ga0068860_1010394721 | 246 |
| 391 | 3300005844 | Ga0068862_100052345 | Ga0068862_1000523453 | 246 |
| 392 | 3300005844 | Ga0068862_100207919 | Ga0068862_1002079192 | 246 |
| 393 | 3300005985 | Ga0081539_10069093 | Ga0081539_100690932 | 246 |
| 394 | 3300006028 | Ga0070717_10006369 | Ga0070717_100063695 | 246 |
| 395 | 3300006051 | Ga0075364_10162691 | Ga0075364_101626913 | 246 |
| 396 | 3300006177 | Ga0075362_10032939 | Ga0075362_100329394 | 246 |
| 397 | 3300006931 | Ga0097620_100009717 | Ga0097620_1000097179 | 246 |
| 398 | 3300006931 | Ga0097620_100083605 | Ga0097620_1000836052 | 246 |
| 399 | 3300006931 | Ga0097620_100187838 | Ga0097620_1001878381 | 246 |
| 400 | 3300009094 | Ga0111539_10054965 | Ga0111539_100549655 | 246 |
| 401 | 3300009094 | Ga0111539_10376648 | Ga0111539_103766482 | 246 |
| 402 | 3300009174 | Ga0105241_10205167 | Ga0105241_102051672 | 246 |
| 403 | 3300009177 | Ga0105248_10010002 | Ga0105248_100100022 | 246 |
| 404 | 3300009177 | Ga0105248_10036474 | Ga0105248_100364742 | 246 |
| 405 | 3300009177 | Ga0105248_10310692 | Ga0105248_103106922 | 246 |
| 406 | 3300009177 | Ga0105248_10500643 | Ga0105248_105006432 | 246 |
| 407 | 3300009177 | Ga0105248_10526080 | Ga0105248_105260802 | 246 |
| 408 | 3300011119 | Ga0105246_10092278 | Ga0105246_100922783 | 246 |
| 409 | 3300012512 | Ga0157327_1004374 | Ga0157327_10043742 | 246 |
| 410 | 3300013100 | Ga0157373_10194631 | Ga0157373_101946313 | 246 |
| 411 | 3300013100 | Ga0157373_10241617 | Ga0157373_102416172 | 246 |
| 412 | 3300013105 | Ga0157369_10002493 | Ga0157369_100024937 | 246 |
| 413 | 3300013105 | Ga0157369_10242075 | Ga0157369_102420752 | 246 |
| 414 | 3300014326 | Ga0157380_10814384 | Ga0157380_108143841 | 246 |
| 415 | 3300017792 | Ga0163161_10030812 | Ga0163161_100308123 | 246 |
| 416 | 3300025893 | Ga0207682_10029502 | Ga0207682_100295022 | 246 |
| 417 | 3300025893 | Ga0207682_10049135 | Ga0207682_100491352 | 246 |
| 418 | 3300025903 | Ga0207680_10428055 | Ga0207680_104280551 | 246 |
| 419 | 3300025904 | Ga0207647_10016791 | Ga0207647_100167913 | 246 |
| 420 | 3300025909 | Ga0207705_10011438 | Ga0207705_100114383 | 246 |
| 421 | 3300025909 | Ga0207705_10042434 | Ga0207705_100424345 | 246 |
| 422 | 3300025909 | Ga0207705_10252443 | Ga0207705_102524433 | 246 |
| 423 | 3300025909 | Ga0207705_10315244 | Ga0207705_103152441 | 246 |
| 424 | 3300025918 | Ga0207662_10163888 | Ga0207662_101638883 | 246 |
| 425 | 3300025919 | Ga0207657_10012036 | Ga0207657_100120365 | 246 |
| 426 | 3300025919 | Ga0207657_10022935 | Ga0207657_100229354 | 246 |
| 427 | 3300025919 | Ga0207657_10048389 | Ga0207657_100483894 | 246 |
| 428 | 3300025920 | Ga0207649_10030568 | Ga0207649_100305682 | 246 |
| 429 | 3300025920 | Ga0207649_10384194 | Ga0207649_103841942 | 246 |
| 430 | 3300025921 | Ga0207652_10070871 | Ga0207652_100708712 | 246 |
| 431 | 3300025923 | Ga0207681_10188982 | Ga0207681_101889822 | 246 |
| 432 | 3300025926 | Ga0207659_10194420 | Ga0207659_101944203 | 246 |
| 433 | 3300025929 | Ga0207664_10244269 | Ga0207664_102442691 | 246 |
| 434 | 3300025931 | Ga0207644_10026790 | Ga0207644_100267905 | 246 |
| 435 | 3300025931 | Ga0207644_10087606 | Ga0207644_100876062 | 246 |
| 436 | 3300025931 | Ga0207644_10318001 | Ga0207644_103180011 | 246 |
| 437 | 3300025931 | Ga0207644_10398874 | Ga0207644_103988742 | 246 |
| 438 | 3300025932 | Ga0207690_10016810 | Ga0207690_100168105 | 246 |
| 439 | 3300025932 | Ga0207690_10077147 | Ga0207690_100771472 | 246 |
| 440 | 3300025932 | Ga0207690_10090793 | Ga0207690_100907933 | 246 |
| 441 | 3300025933 | Ga0207706_10025399 | Ga0207706_100253992 | 246 |
| 442 | 3300025933 | Ga0207706_10071290 | Ga0207706_100712905 | 246 |
| 443 | 3300025939 | Ga0207665_10065120 | Ga0207665_100651202 | 246 |
| 444 | 3300025940 | Ga0207691_10362031 | Ga0207691_103620312 | 246 |
| 445 | 3300025940 | Ga0207691_10447372 | Ga0207691_104473722 | 246 |
| 446 | 3300025941 | Ga0207711_10006371 | Ga0207711_100063712 | 246 |
| 447 | 3300025941 | Ga0207711_10062568 | Ga0207711_100625682 | 246 |
| 448 | 3300025941 | Ga0207711_10500069 | Ga0207711_105000692 | 246 |
| 449 | 3300025942 | Ga0207689_10050354 | Ga0207689_100503545 | 246 |
| 450 | 3300025945 | Ga0207679_10031469 | Ga0207679_100314693 | 246 |
| 451 | 3300025945 | Ga0207679_10083298 | Ga0207679_100832984 | 246 |
| 452 | 3300025945 | Ga0207679_10162355 | Ga0207679_101623552 | 246 |
| 453 | 3300025949 | Ga0207667_10949867 | Ga0207667_109498671 | 246 |
| 454 | 3300025960 | Ga0207651_10017325 | Ga0207651_100173253 | 246 |
| 455 | 3300025981 | Ga0207640_10270707 | Ga0207640_102707072 | 246 |
| 456 | 3300025986 | Ga0207658_10010095 | Ga0207658_100100956 | 246 |
| 457 | 3300025986 | Ga0207658_10038601 | Ga0207658_100386012 | 246 |
| 458 | 3300025986 | Ga0207658_10157388 | Ga0207658_101573884 | 246 |
| 459 | 3300025986 | Ga0207658_10380388 | Ga0207658_103803881 | 246 |
| 460 | 3300026035 | Ga0207703_10014764 | Ga0207703_100147649 | 246 |
| 461 | 3300026035 | Ga0207703_10131906 | Ga0207703_101319062 | 246 |
| 462 | 3300026067 | Ga0207678_10046207 | Ga0207678_100462075 | 246 |
| 463 | 3300026067 | Ga0207678_10097907 | Ga0207678_100979075 | 246 |
| 464 | 3300026088 | Ga0207641_10033656 | Ga0207641_100336563 | 246 |
| 465 | 3300026088 | Ga0207641_10051398 | Ga0207641_100513982 | 246 |
| 466 | 3300026088 | Ga0207641_10084618 | Ga0207641_100846183 | 246 |
| 467 | 3300026088 | Ga0207641_10177002 | Ga0207641_101770022 | 246 |
| 468 | 3300026089 | Ga0207648_10089716 | Ga0207648_100897164 | 246 |
| 469 | 3300026095 | Ga0207676_10002166 | Ga0207676_100021662 | 246 |
| 470 | 3300026095 | Ga0207676_10004533 | Ga0207676_1000453310 | 246 |
| 471 | 3300026095 | Ga0207676_10449805 | Ga0207676_104498052 | 246 |
| 472 | 3300026116 | Ga0207674_10002589 | Ga0207674_100025897 | 246 |
| 473 | 3300026116 | Ga0207674_10048314 | Ga0207674_100483142 | 246 |
| 474 | 3300026118 | Ga0207675_100088082 | Ga0207675_1000880825 | 246 |
| 475 | 3300026142 | Ga0207698_10092001 | Ga0207698_100920012 | 246 |
| 476 | 3300026142 | Ga0207698_10104964 | Ga0207698_101049642 | 246 |
| 477 | 3300026142 | Ga0207698_10165364 | Ga0207698_101653642 | 246 |
| 478 | 3300026142 | Ga0207698_10855946 | Ga0207698_108559461 | 246 |
| 479 | 3300027614 | Ga0209970_1032022 | Ga0209970_10320221 | 246 |
| 480 | 3300027876 | Ga0209974_10010160 | Ga0209974_100101605 | 246 |
| 481 | 3300028380 | Ga0268265_10003659 | Ga0268265_1000365914 | 246 |
| 482 | 3300028380 | Ga0268265_10089082 | Ga0268265_100890823 | 246 |
| 483 | 3300028380 | Ga0268265_10335024 | Ga0268265_103350243 | 246 |
| 484 | 3300028381 | Ga0268264_10024906 | Ga0268264_100249062 | 246 |
| 485 | 3300028381 | Ga0268264_10199932 | Ga0268264_101999321 | 246 |
| 486 | 3300028381 | Ga0268264_10264832 | Ga0268264_102648323 | 246 |
| 487 | 3300031456 | Ga0307513_10117555 | Ga0307513_101175552 | 246 |
| 488 | 3300031548 | Ga0307408_100089857 | Ga0307408_1000898572 | 246 |
| 489 | 3300031548 | Ga0307408_100175578 | Ga0307408_1001755782 | 246 |
| 490 | 3300031731 | Ga0307405_10022731 | Ga0307405_100227315 | 246 |
| 491 | 3300031731 | Ga0307405_10054188 | Ga0307405_100541884 | 246 |
| 492 | 3300031731 | Ga0307405_10105211 | Ga0307405_101052112 | 246 |
| 493 | 3300031731 | Ga0307405_10140027 | Ga0307405_101400274 | 246 |
| 494 | 3300031824 | Ga0307413_10023856 | Ga0307413_100238564 | 246 |
| 495 | 3300031824 | Ga0307413_10303930 | Ga0307413_103039301 | 246 |
| 496 | 3300031852 | Ga0307410_10003164 | Ga0307410_1000316411 | 246 |
| 497 | 3300031852 | Ga0307410_10045082 | Ga0307410_100450823 | 246 |
| 498 | 3300031852 | Ga0307410_10059010 | Ga0307410_100590103 | 246 |
| 499 | 3300031901 | Ga0307406_10041271 | Ga0307406_100412714 | 246 |
| 500 | 3300031901 | Ga0307406_10116982 | Ga0307406_101169823 | 246 |
| 501 | 3300031903 | Ga0307407_10003078 | Ga0307407_100030784 | 246 |
| 502 | 3300031903 | Ga0307407_10189653 | Ga0307407_101896532 | 246 |
| 503 | 3300031911 | Ga0307412_10042145 | Ga0307412_100421452 | 246 |
| 504 | 3300031995 | Ga0307409_100011560 | Ga0307409_1000115606 | 246 |
| 505 | 3300031995 | Ga0307409_100016495 | Ga0307409_1000164954 | 246 |
| 506 | 3300031995 | Ga0307409_100115379 | Ga0307409_1001153795 | 246 |
| 507 | 3300031995 | Ga0307409_100138111 | Ga0307409_1001381114 | 246 |
| 508 | 3300032002 | Ga0307416_100043277 | Ga0307416_1000432774 | 246 |
| 509 | 3300032002 | Ga0307416_100099465 | Ga0307416_1000994652 | 246 |
| 510 | 3300032002 | Ga0307416_100117870 | Ga0307416_1001178703 | 246 |
| 511 | 3300032002 | Ga0307416_100255557 | Ga0307416_1002555572 | 246 |
| 512 | 3300032002 | Ga0307416_100292099 | Ga0307416_1002920992 | 246 |
| 513 | 3300032004 | Ga0307414_10036166 | Ga0307414_100361662 | 246 |
| 514 | 3300032004 | Ga0307414_10041174 | Ga0307414_100411742 | 246 |
| 515 | 3300032005 | Ga0307411_10009246 | Ga0307411_100092469 | 246 |
| 516 | 3300032005 | Ga0307411_10011297 | Ga0307411_100112976 | 246 |
| 517 | 3300032005 | Ga0307411_10018894 | Ga0307411_100188945 | 246 |
| 518 | 3300032005 | Ga0307411_10023982 | Ga0307411_100239824 | 246 |
| 519 | 3300032126 | Ga0307415_100007620 | Ga0307415_1000076204 | 246 |
| 520 | 3300032126 | Ga0307415_100012547 | Ga0307415_1000125475 | 246 |
| 521 | 3300032126 | Ga0307415_100025634 | Ga0307415_1000256342 | 246 |
| 522 | 3300032126 | Ga0307415_100029019 | Ga0307415_1000290195 | 246 |
| 523 | 3300032126 | Ga0307415_100121998 | Ga0307415_1001219982 | 246 |
| 524 | 3300035170 | Ga0373943_0002765 | Ga0373943_0002765_6938_7711 | 246 |
| 525 | 3300035695 | Ga0373927_0070119 | Ga0373927_0070119_149_922 | 246 |
| 526 | 3300037068 | Ga0373925_0182164 | Ga0373925_0182164_261_1034 | 246 |
| 527 | 3300037312 | Ga0395899_0010784 | Ga0395899_0010784_4008_4763 | 246 |
| 528 | 3300037312 | Ga0395899_0046858 | Ga0395899_0046858_499_1239 | 246 |
| 529 | 3300037312 | Ga0395899_0114614 | Ga0395899_0114614_279_1022 | 246 |
| 530 | 3300037418 | Ga0395900_0009579 | Ga0395900_0009579_4257_5012 | 246 |
| 531 | 3300037418 | Ga0395900_0017256 | Ga0395900_0017256_3646_4386 | 246 |
| 532 | 3300037418 | Ga0395900_0078313 | Ga0395900_0078313_1690_2442 | 246 |
| 533 | 3300037418 | Ga0395900_0087720 | Ga0395900_0087720_1669_2412 | 246 |
| 534 | 3300037418 | Ga0395900_0165240 | Ga0395900_0165240_885_1625 | 246 |
| 535 | 3300037418 | Ga0395900_0304863 | Ga0395900_0304863_426_1172 | 246 |
| 536 | 3300037418 | Ga0395900_0322079 | Ga0395900_0322079_308_1048 | 246 |
| 537 | 3300037466 | Ga0395898_0003637 | Ga0395898_0003637_12521_13276 | 246 |
| 538 | 3300037466 | Ga0395898_0048516 | Ga0395898_0048516_2627_3370 | 246 |
| 539 | 3300037466 | Ga0395898_0163288 | Ga0395898_0163288_250_996 | 246 |
| 540 | 3300037466 | Ga0395898_0168402 | Ga0395898_0168402_1292_2044 | 246 |
| 541 | 3300037466 | Ga0395898_0446770 | Ga0395898_0446770_406_1152 | 246 |
| 542 | 3300037471 | Ga0395905_0000886 | Ga0395905_0000886_38081_38821 | 246 |
| 543 | 3300037471 | Ga0395905_0005100 | Ga0395905_0005100_6016_6771 | 246 |
| 544 | 3300037471 | Ga0395905_0026302 | Ga0395905_0026302_4582_5334 | 246 |
| 545 | 3300037471 | Ga0395905_0028313 | Ga0395905_0028313_1150_1890 | 246 |
| 546 | 3300037471 | Ga0395905_0031061 | Ga0395905_0031061_2537_3277 | 246 |
| 547 | 3300037471 | Ga0395905_0038376 | Ga0395905_0038376_1937_2677 | 246 |
| 548 | 3300037471 | Ga0395905_0039983 | Ga0395905_0039983_1800_2543 | 246 |
| 549 | 3300037471 | Ga0395905_0044718 | Ga0395905_0044718_1743_2486 | 246 |
| 550 | 3300037471 | Ga0395905_0054666 | Ga0395905_0054666_1717_2460 | 246 |
| 551 | 3300037471 | Ga0395905_0105538 | Ga0395905_0105538_154_906 | 246 |
| 552 | 3300037471 | Ga0395905_0297914 | Ga0395905_0297914_168_908 | 246 |
| 553 | 3300037471 | Ga0395905_0660102 | Ga0395905_0660102_182_925 | 246 |
| 554 | 3300038443 | Ga0395901_0016015 | Ga0395901_0016015_6818_7573 | 246 |
| 555 | 3300038443 | Ga0395901_0079087 | Ga0395901_0079087_1541_2284 | 246 |
| 556 | 3300038443 | Ga0395901_0128239 | Ga0395901_0128239_156_896 | 246 |
| 557 | 3300038443 | Ga0395901_0185298 | Ga0395901_0185298_1164_1907 | 246 |
| 558 | 3300039437 | Ga0436365_1237401 | Ga0436365_1237401_2008_2748 | 246 |
| 559 | 3300042006 | Ga0439432_029495 | Ga0439432_029495_61_816 | 246 |
| 560 | 3300042144 | Ga0450889_000026 | Ga0450889_000026_600_1388 | 246 |
| 561 | 3300044694 | Ga0466963_0089857 | Ga0466963_0089857_331_1083 | 246 |
| 562 | 3300045976 | Ga0466967_0299516 | Ga0466967_0299516_97_843 | 246 |
| 563 | 3300045976 | Ga0466967_0322300 | Ga0466967_0322300_352_1104 | 246 |
| 564 | 3300046492 | Ga0495585_0037570 | Ga0495585_0037570_189_935 | 246 |
| 565 | 3300046525 | Ga0495663_0045361 | Ga0495663_0045361_95_838 | 246 |
| 566 | 3300046684 | Ga0495669_0000089 | Ga0495669_0000089_17091_17831 | 246 |
| 567 | 3300046684 | Ga0495669_0001738 | Ga0495669_0001738_252_995 | 246 |
| 568 | 3300046684 | Ga0495669_0015740 | Ga0495669_0015740_2053_2808 | 246 |
| 569 | 3300046684 | Ga0495669_0038151 | Ga0495669_0038151_314_1054 | 246 |
| 570 | 3300046684 | Ga0495669_0044579 | Ga0495669_0044579_433_1173 | 246 |
| 571 | 3300046684 | Ga0495669_0104520 | Ga0495669_0104520_390_1130 | 246 |
| 572 | 3300047445 | Ga0495677_0028989 | Ga0495677_0028989_692_1435 | 246 |
| 573 | 3300047445 | Ga0495677_0184714 | Ga0495677_0184714_16_768 | 246 |
| 574 | 3300048909 | Ga0496106_0060393 | Ga0496106_0060393_587_1327 | 246 |
| 575 | 3300048910 | Ga0496107_0069625 | Ga0496107_0069625_1707_2447 | 246 |
| 576 | 3300048910 | Ga0496107_0080872 | Ga0496107_0080872_821_1576 | 246 |
| 577 | 3300048910 | Ga0496107_0124982 | Ga0496107_0124982_476_1216 | 246 |
| 578 | 3300048910 | Ga0496107_0166587 | Ga0496107_0166587_514_1257 | 246 |
| 579 | 3300048911 | Ga0496108_0008282 | Ga0496108_0008282_4861_5601 | 246 |
| 580 | 3300048911 | Ga0496108_0431877 | Ga0496108_0431877_65_811 | 246 |
| 581 | 3300048915 | Ga0496112_0271166 | Ga0496112_0271166_367_1122 | 246 |
| 582 | 3300048918 | Ga0496115_0025556 | Ga0496115_0025556_1328_2083 | 246 |
| 583 | 3300049583 | Ga0501067_0021297 | Ga0501067_0021297_173_913 | 246 |
| 584 | 3300049583 | Ga0501067_0127853 | Ga0501067_0127853_336_1091 | 246 |
| 585 | 3300049584 | Ga0501068_0103677 | Ga0501068_0103677_207_947 | 246 |
| 586 | 3300049668 | Ga0501233_060988 | Ga0501233_060988_43_783 | 246 |
| 587 | 3300049679 | Ga0501249_009214 | Ga0501249_009214_97_849 | 246 |
| 588 | 3300049686 | Ga0501257_074204 | Ga0501257_074204_53_805 | 246 |
| 589 | 3300049765 | Ga0501268_001525 | Ga0501268_001525_1042_1794 | 246 |
| 590 | 3300050489 | nmdc:mga03683_8044_c1 | nmdc:mga03683_8044_c1_349_1098 | 246 |
| 591 | 3300050511 | nmdc:mga08y16_215338_c1 | nmdc:mga08y16_215338_c1_329_1117 | 246 |
| 592 | 3300050511 | nmdc:mga08y16_564570_c1 | nmdc:mga08y16_564570_c1_378_1133 | 246 |
| 593 | 3300053153 | Ga0500616_0034045 | Ga0500616_0034045_1943_2683 | 246 |
| 594 | 3300001990 | JGI24737J22298_10000837 | JGI24737J22298_1000083710 | 249 |
| 595 | 3300005366 | Ga0070659_100027917 | Ga0070659_1000279173 | 249 |
| 596 | 3300005564 | Ga0070664_100521030 | Ga0070664_1005210302 | 249 |
| 597 | 3300005577 | Ga0068857_100028505 | Ga0068857_1000285054 | 249 |
| 598 | 3300005841 | Ga0068863_100007730 | Ga0068863_1000077305 | 249 |
| 599 | 3300011119 | Ga0105246_10063503 | Ga0105246_100635032 | 249 |
| 600 | 3300014325 | Ga0163163_10092057 | Ga0163163_100920572 | 249 |
| 601 | 3300025901 | Ga0207688_10029423 | Ga0207688_100294232 | 249 |
| 602 | 3300025904 | Ga0207647_10015414 | Ga0207647_100154145 | 249 |
| 603 | 3300025932 | Ga0207690_10016532 | Ga0207690_100165323 | 249 |
| 604 | 3300026088 | Ga0207641_10032553 | Ga0207641_100325532 | 249 |
| 605 | 3300026116 | Ga0207674_10000086 | Ga0207674_1000008660 | 249 |
| 606 | 3300037418 | Ga0395900_0085727 | Ga0395900_0085727_2160_2939 | 249 |
| 607 | 3300037418 | Ga0395900_0326679 | Ga0395900_0326679_191_943 | 249 |
| 608 | 3300037471 | Ga0395905_0006839 | Ga0395905_0006839_2755_3534 | 249 |
| 609 | 3300037471 | Ga0395905_0011712 | Ga0395905_0011712_7375_8127 | 249 |
| 610 | 3300037471 | Ga0395905_0033274 | Ga0395905_0033274_3587_4336 | 249 |
| 611 | 3300037471 | Ga0395905_0481813 | Ga0395905_0481813_262_1014 | 249 |
| 612 | 3300038443 | Ga0395901_0040320 | Ga0395901_0040320_966_1745 | 249 |
| 613 | 3300038443 | Ga0395901_0181409 | Ga0395901_0181409_336_1085 | 249 |
| 614 | 3300038443 | Ga0395901_0566880 | Ga0395901_0566880_124_876 | 249 |
| 615 | 3300042005 | Ga0439448_0020938 | Ga0439448_0020938_314_1063 | 249 |
| 616 | 3300042157 | Ga0439458_0000006 | Ga0439458_0000006_27020_27769 | 249 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bw1-assembly1.cif.gz_A | crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride | 0.4056 | 1 | 242 |
| 4quv-assembly3.cif.gz_A | structure of an integral membrane delta(14)-sterol reductase | 0.4044 | 22 | 237 |
| 7bw1-assembly1.cif.gz_A | crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride | 0.3999 | 1 | 242 |
| 4quv-assembly3.cif.gz_B | structure of an integral membrane delta(14)-sterol reductase | 0.3884 | 20 | 242 |
| 4quv-assembly3.cif.gz_A | structure of an integral membrane delta(14)-sterol reductase | 0.3566 | 22 | 237 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O05883_47_239_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.9449 | 49 | 243 | 1.20.120.1630 |
| af_O05883_47_239_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.9354 | 49 | 243 | 1.20.120.1630 |
| af_Q54JG5_70_234_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8146 | 50 | 212 | 1.20.120.1630 |
| af_Q9VEG9_60_228_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8112 | 50 | 213 | 1.20.120.1630 |
| af_Q54JG5_70_234_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8012 | 50 | 212 | 1.20.120.1630 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A349TD55-F1-model_v4 | methanethiol S-methyltransferase (EC 2.1.1.334) | 0.9695 | 1 | 242 |
GO:0008168
GO:0016020 GO:0032259 |
| AF-A0A0M9TZ98-F1-model_v4 | deleted | 0.9668 | 1 | 246 |
|
| AF-A0A2A8CXH1-F1-model_v4 | methanethiol S-methyltransferase (EC 2.1.1.334) | 0.9663 | 1 | 242 |
GO:0008168
GO:0016020 GO:0032259 |
| AF-A0A6I6SQV3-F1-model_v4 | methanethiol S-methyltransferase (EC 2.1.1.334) | 0.9662 | 2 | 245 |
GO:0008168
GO:0016020 GO:0032259 |
| AF-A0A2M9ZNI7-F1-model_v4 | NnrU domain-containing protein | 0.9658 | 1 | 245 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar