F469511

General Info

Members Datasets Scaffolds Average Seq Length
616 340 573 224

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10151988|Ga0070666_101519881
Length 270
Sequence MWRCGGRPQIPDASGAAASDDDRGHDPCRAVAVATAPQARRWQNPPMGTLYLVRHGQASFGAADYDQLSDLGRRQSVRLGEYWRERGMRFDAVITGTLKRHRQTWEGIAEGLGIGPEDVLPWPGLNEYDSEAIIATVHPAKLAKPDSPEMYRHHFRLLRDGLGAWMQGRTEPVGMPSYVDFLAGVTTALDHVRDRHHGAKVLVVSSGGPISTAVGHVLGTSPETTVELNLRIRNTAVTEFAFTPKRHMLLTYNTLPHLDGPAYEGWVTYS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
9 2643221658 Variovorax sp. Root411 Isolate Unclassified
10 2643221672 Variovorax sp. Root434 Isolate Unclassified
11 2643221683 Variovorax sp. Root473 Isolate Unclassified
12 2738541277 Variovorax sp. GV051 Isolate Unclassified
13 2738541307 Variovorax sp. GV008 Isolate Unclassified
14 2738543013 Variovorax sp. BT01 Isolate Unclassified
15 2738543019 Variovorax sp. GV040 Isolate Unclassified
16 2818991446 Variovorax sp. 1180 Isolate Unclassified
17 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
18 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
19 2842677519 Variovorax sp. R-72495 Isolate Unclassified
20 2842733646 Variovorax sp. R-72446 Isolate Unclassified
21 2842747753 Variovorax sp. R-72060 Isolate Unclassified
22 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
23 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
24 2885198086 Variovorax sp. 679 Isolate Unclassified
25 2885211737 Variovorax sp. 553 Isolate Unclassified
26 2899924645 Variovorax sp. 369 Isolate Unclassified
27 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
28 2904456579 Variovorax sp. 2002 Isolate Unclassified
29 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
30 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
31 2928037797 Variovorax sp. 1126 Isolate Unclassified
32 2928044640 Variovorax sp. 1128 Isolate Unclassified
33 2928051484 Variovorax sp. 1133 Isolate Unclassified
34 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
35 2928070936 Variovorax gossypii 1167 Isolate Unclassified
36 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
37 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
38 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
39 2929520902 Variovorax beijingensis 502 Isolate Unclassified
40 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
41 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
42 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
43 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
44 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
45 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
46 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
47 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
48 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
49 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
50 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
51 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
52 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
53 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
54 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
55 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
56 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
57 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
58 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
59 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
60 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
61 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
62 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
63 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
64 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
65 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
66 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
67 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
68 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
69 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
70 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
73 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
74 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
75 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
98 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
157 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
158 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
159 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
160 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
161 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
162 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
163 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
164 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
191 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
192 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
193 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
194 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
195 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
196 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
197 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
198 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
199 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
200 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
201 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
202 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
203 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
204 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
205 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
206 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
207 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
208 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
209 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
210 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
211 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
212 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
213 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
214 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
215 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
216 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
217 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
218 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
219 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
220 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
221 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
222 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
223 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
224 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
225 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
226 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
227 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
228 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
229 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
230 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
233 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
234 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
235 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
236 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
239 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
250 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
251 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
254 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
255 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
256 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
257 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
258 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
259 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
260 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
261 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
262 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
263 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
264 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
271 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
272 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
273 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
274 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
275 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
278 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
286 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
287 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
290 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
291 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
293 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
300 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
301 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
304 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
308 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
312 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
316 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
317 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
318 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
319 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
320 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
321 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
322 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
323 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
324 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
325 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
326 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
327 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
328 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
329 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
330 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
331 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
332 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
333 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
334 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
335 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
336 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
337 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
338 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
339 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
340 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.02
Metatranscriptomes 0
Isolates 6.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.77
Nodule 0.97
Rhizoplane 2.27
Rhizosphere 51.62
Stem 0
Stem Tuber 0
Unclassified 11.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3254866 2162886007 Bacteria 1639
2 JGI24740J21852_10024963 3300001979 Bacteria 2020
3 JGI25158J39367_1006113 3300002739 Bacteria 1739
4 JGI25152J39213_1000055 3300002773 Bacteria 75639
5 JGI25152J39213_1001621 3300002773 Bacteria 9394
6 JGI25150J39212_1000806 3300002774 Bacteria 10615
7 JGI25150J39212_1004342 3300002774 Bacteria 3168
8 JGI25150J39212_1005297 3300002774 Bacteria 2769
9 JGI25150J39212_1006788 3300002774 Bacteria 2337
10 JGI25159J45721_1000456 3300002987 Bacteria 18924
11 JGI25159J45721_1002157 3300002987 Bacteria 7670
12 JGI25151J46595_10000194 3300003187 Bacteria 74948
13 JGI25151J46595_10005584 3300003187 Bacteria 6471
14 JGI25151J46595_10009646 3300003187 Bacteria 4552
15 JGI25153J46596_10000139 3300003215 Bacteria 74948
16 JGI25153J46596_10011766 3300003215 Bacteria 3840
17 rootH1_10000545 3300003316 Bacteria 3558
18 rootH2_10029231 3300003320 Bacteria 2811
19 rootH1_10046084 3300003323 Bacteria 2502
20 rootH1_10065452 3300003323 Bacteria 3664
21 JGI25160J50197_1000137 3300003354 Bacteria 66150
22 JGI25160J50197_1009602 3300003354 Bacteria 3571
23 JGI25161J50226_1001231 3300003374 Bacteria 8300
24 Ga0055535_1000084 3300003761 Bacteria 104652
25 Ga0055542_1000033 3300003762 Bacteria 233997
26 Ga0055526_1000103 3300003771 Bacteria 74948
27 Ga0055526_1004793 3300003771 Bacteria 8008
28 Ga0055537_1001576 3300003773 Bacteria 8665
29 Ga0055537_1002475 3300003773 Bacteria 6176
30 Ga0055524_1003218 3300003775 Bacteria 8008
31 Ga0055524_1003539 3300003775 Bacteria 7550
32 Ga0055536_1003831 3300003781 Bacteria 7919
33 Ga0055536_1005161 3300003781 Bacteria 6454
34 Ga0055536_1005431 3300003781 Bacteria 6232
35 Ga0055536_1016438 3300003781 Bacteria 2474
36 Ga0055536_1025041 3300003781 Bacteria 1711
37 Ga0055534_1000150 3300003784 Bacteria 51661
38 Ga0055534_1001420 3300003784 Bacteria 9528
39 Ga0055534_1001600 3300003784 Bacteria 8786
40 Ga0055534_1004137 3300003784 Bacteria 4307
41 Ga0055528_1002757 3300003790 Bacteria 9203
42 Ga0055528_1008110 3300003790 Bacteria 4552
43 Ga0055528_1009764 3300003790 Bacteria 3979
44 Ga0055530_10001926 3300003791 Bacteria 14155
45 Ga0055530_10027308 3300003791 Bacteria 1561
46 Ga0055540_1002120 3300003792 Bacteria 10835
47 Ga0055540_1002332 3300003792 Bacteria 10165
48 Ga0055540_1003273 3300003792 Bacteria 7923
49 Ga0055540_1004027 3300003792 Bacteria 6842
50 Ga0055540_1007457 3300003792 Bacteria 4122
51 Ga0055531_10000397 3300003794 Bacteria 41683
52 Ga0055531_10003306 3300003794 Bacteria 10324
53 Ga0055531_10004060 3300003794 Bacteria 9074
54 Ga0055531_10004862 3300003794 Bacteria 8007
55 Ga0055543_1002294 3300004625 Bacteria 6458
56 Ga0055543_1005036 3300004625 Bacteria 3447
57 Ga0065165_1001987 3300005262 Bacteria 19243
58 Ga0065165_1009315 3300005262 Bacteria 4419
59 Ga0065165_1024789 3300005262 Bacteria 2008
60 Ga0065714_10066000 3300005288 Bacteria 7848
61 Ga0070658_10119958 3300005327 Bacteria 2185
62 Ga0068869_100088786 3300005334 Bacteria 2321
63 Ga0070666_10151988 3300005335 Bacteria 1615
64 Ga0070661_100035577 3300005344 Bacteria 3617
65 Ga0070669_100006647 3300005353 Bacteria 8329
66 Ga0070678_100301915 3300005456 Bacteria 1361
67 Ga0068867_100203801 3300005459 Bacteria 1585
68 Ga0070679_100002524 3300005530 Bacteria 16591
69 Ga0070679_100041372 3300005530 Bacteria 4587
70 Ga0070679_100367289 3300005530 Bacteria 1386
71 Ga0068853_100007702 3300005539 Bacteria 8637
72 Ga0068855_100041744 3300005563 Bacteria 5436
73 Ga0068855_100221599 3300005563 Bacteria 2121
74 Ga0068855_101031114 3300005563 Bacteria 863
75 Ga0070664_100022953 3300005564 Bacteria 5148
76 Ga0068857_100301108 3300005577 Bacteria 1478
77 Ga0068856_100304668 3300005614 Bacteria 1611
78 Ga0068852_100656126 3300005616 Bacteria 1057
79 Ga0068851_10011150 3300005834 Bacteria 4209
80 Ga0068862_100061578 3300005844 Bacteria 3226
81 Ga0075365_10005809 3300006038 Bacteria 6703
82 Ga0075365_10010349 3300006038 Bacteria 5425
83 Ga0075365_10011460 3300006038 Bacteria 5214
84 Ga0075365_10049650 3300006038 Bacteria 2765
85 Ga0075368_10013672 3300006042 Bacteria 2983
86 Ga0075363_100020368 3300006048 Bacteria 3325
87 Ga0075363_100022739 3300006048 Bacteria 3172
88 Ga0075363_100051673 3300006048 Bacteria 2193
89 Ga0075364_10026540 3300006051 Bacteria 3696
90 Ga0075364_10228262 3300006051 Bacteria 1264
91 Ga0075432_10005605 3300006058 Bacteria 4275
92 Ga0075432_10024745 3300006058 Bacteria 2059
93 Ga0075362_10010894 3300006177 Bacteria 3567
94 Ga0075362_10034935 3300006177 Bacteria 2193
95 Ga0075367_10019976 3300006178 Bacteria 3724
96 Ga0075367_10067328 3300006178 Bacteria 2147
97 Ga0075367_10174426 3300006178 Bacteria 1340
98 Ga0075366_10014570 3300006195 Bacteria 4492
99 Ga0075366_10024597 3300006195 Bacteria 3512
100 Ga0075366_10034592 3300006195 Bacteria 2976
101 Ga0075366_10051655 3300006195 Bacteria 2442
102 Ga0075366_10060953 3300006195 Bacteria 2241
103 Ga0075366_10063532 3300006195 Bacteria 2194
104 Ga0075366_10220490 3300006195 Bacteria 1155
105 Ga0075366_10274177 3300006195 Bacteria 1030
106 Ga0075370_10002696 3300006353 Bacteria 8310
107 Ga0075370_10004420 3300006353 Bacteria 6824
108 Ga0075370_10005973 3300006353 Bacteria 6094
109 Ga0075370_10017588 3300006353 Bacteria 3865
110 Ga0075370_10022199 3300006353 Bacteria 3483
111 Ga0075370_10037311 3300006353 Bacteria 2732
112 Ga0075370_10165328 3300006353 Bacteria 1299
113 Ga0075370_10192710 3300006353 Bacteria 1201
114 Ga0075370_10265472 3300006353 Bacteria 1018
115 Ga0068871_100160650 3300006358 Bacteria 1922
116 Ga0099826_10000055 3300006948 Bacteria 70119
117 Ga0099826_10037924 3300006948 Bacteria 3391
118 Ga0099826_10114990 3300006948 Bacteria 1595
119 Ga0105244_10005004 3300009036 Bacteria 8932
120 Ga0105244_10211363 3300009036 Bacteria 912
121 Ga0105245_10157696 3300009098 Bacteria 2151
122 Ga0105243_10002013 3300009148 Bacteria 17274
123 Ga0105243_10007917 3300009148 Bacteria 8161
124 Ga0105243_10043161 3300009148 Bacteria 3534
125 Ga0105241_10027439 3300009174 Bacteria 4241
126 Ga0105238_10068299 3300009551 Bacteria 3555
127 Ga0105238_10493072 3300009551 Bacteria 1225
128 Ga0105239_10112239 3300010375 Bacteria 3022
129 Ga0105239_10326802 3300010375 Bacteria 1730
130 Ga0157373_10040655 3300013100 Bacteria 3326
131 Ga0157373_10057206 3300013100 Bacteria 2767
132 Ga0157373_10116183 3300013100 Bacteria 1880
133 Ga0157370_10175048 3300013104 Bacteria 1994
134 Ga0182008_10000402 3300014497 Bacteria 33508
135 Ga0182008_10009182 3300014497 Bacteria 5346
136 Ga0182008_10017647 3300014497 Bacteria 3701
137 Ga0182008_10022584 3300014497 Bacteria 3221
138 Ga0182008_10054161 3300014497 Bacteria 1985
139 Ga0157376_10002064 3300014969 Bacteria 13483
140 Ga0182006_1005788 3300015261 Bacteria 5826
141 Ga0182006_1017099 3300015261 Bacteria 3087
142 Ga0182006_1043408 3300015261 Bacteria 1757
143 Ga0182007_10001457 3300015262 Bacteria 12697
144 Ga0182007_10042573 3300015262 Bacteria 1511
145 Ga0182005_1037957 3300015265 Bacteria 1310
146 Ga0163161_10000128 3300017792 Bacteria 70965
147 Ga0163161_10009175 3300017792 Bacteria 6837
148 Ga0163161_10009688 3300017792 Bacteria 6668
149 Ga0209436_100670 3300025208 Bacteria 14567
150 Ga0209436_101842 3300025208 Bacteria 6876
151 Ga0209672_100228 3300025228 Bacteria 42777
152 Ga0209147_100951 3300025229 Bacteria 12743
153 Ga0209258_100089 3300025242 Bacteria 234040
154 Ga0207425_1000103 3300025245 Bacteria 79975
155 Ga0207425_1002258 3300025245 Bacteria 6969
156 Ga0209148_1000097 3300025254 Bacteria 234049
157 Ga0209129_1000033 3300025258 Bacteria 336894
158 Ga0209129_1001321 3300025258 Bacteria 14017
159 Ga0209129_1003501 3300025258 Bacteria 6783
160 Ga0209565_1000120 3300025263 Bacteria 111458
161 Ga0209565_1000828 3300025263 Bacteria 17495
162 Ga0209565_1000980 3300025263 Bacteria 14694
163 Ga0209673_1000099 3300025273 Bacteria 193248
164 Ga0209673_1000372 3300025273 Bacteria 80748
165 Ga0209673_1000899 3300025273 Bacteria 38238
166 Ga0209673_1003387 3300025273 Bacteria 9476
167 Ga0209673_1004640 3300025273 Bacteria 7271
168 Ga0209673_1061417 3300025273 Bacteria 936
169 Ga0209130_1000105 3300025284 Bacteria 135199
170 Ga0209130_1000615 3300025284 Bacteria 34069
171 Ga0209130_1014320 3300025284 Bacteria 1996
172 Ga0209675_1000054 3300025291 Bacteria 193248
173 Ga0209675_1001018 3300025291 Bacteria 17523
174 Ga0209675_1001356 3300025291 Bacteria 14417
175 Ga0209675_1001425 3300025291 Bacteria 13815
176 Ga0209675_1001574 3300025291 Bacteria 12930
177 Ga0209676_1000179 3300025292 Bacteria 150096
178 Ga0209676_1000260 3300025292 Bacteria 111683
179 Ga0209676_1000624 3300025292 Bacteria 51430
180 Ga0209676_1004929 3300025292 Bacteria 7183
181 Ga0209676_1013211 3300025292 Bacteria 3189
182 Ga0209025_1000221 3300025294 Bacteria 135793
183 Ga0209025_1001070 3300025294 Bacteria 39701
184 Ga0209564_1000151 3300025295 Bacteria 168783
185 Ga0209564_1000246 3300025295 Bacteria 117096
186 Ga0209758_1000027 3300025297 Bacteria 549650
187 Ga0209050_1000172 3300025298 Bacteria 150096
188 Ga0209050_1002032 3300025298 Bacteria 18757
189 Ga0209050_1033034 3300025298 Bacteria 1577
190 Ga0209256_1000069 3300025299 Bacteria 245640
191 Ga0209256_1000161 3300025299 Bacteria 138270
192 Ga0209256_1016707 3300025299 Bacteria 2483
193 Ga0207426_1000027 3300025302 Bacteria 513176
194 Ga0207426_1000115 3300025302 Bacteria 227423
195 Ga0209051_1000046 3300025303 Bacteria 296424
196 Ga0209051_1000510 3300025303 Bacteria 49177
197 Ga0209051_1000583 3300025303 Bacteria 43428
198 Ga0209051_1000971 3300025303 Bacteria 27947
199 Ga0209051_1001434 3300025303 Bacteria 20365
200 Ga0209051_1035370 3300025303 Bacteria 1859
201 Ga0209257_1000281 3300025304 Bacteria 114413
202 Ga0209257_1000866 3300025304 Bacteria 43105
203 Ga0209257_1001146 3300025304 Bacteria 33810
204 Ga0209257_1002049 3300025304 Bacteria 21423
205 Ga0209257_1005096 3300025304 Bacteria 9534
206 Ga0209257_1009498 3300025304 Bacteria 5185
207 Ga0209257_1010979 3300025304 Bacteria 4452
208 Ga0207655_1000566 3300025728 Bacteria 45937
209 Ga0207705_10108019 3300025909 Bacteria 2053
210 Ga0207654_10067089 3300025911 Bacteria 2118
211 Ga0207695_10038220 3300025913 Bacteria 5170
212 Ga0207695_10148608 3300025913 Bacteria 2284
213 Ga0207652_10311484 3300025921 Bacteria 1421
214 Ga0207652_10637211 3300025921 Bacteria 954
215 Ga0207681_10006076 3300025923 Bacteria 7405
216 Ga0207694_10130070 3300025924 Bacteria 2017
217 Ga0207694_10458459 3300025924 Bacteria 1065
218 Ga0207687_10023802 3300025927 Bacteria 4085
219 Ga0207709_10000230 3300025935 Bacteria 70768
220 Ga0207709_10000240 3300025935 Bacteria 68308
221 Ga0207709_10026881 3300025935 Bacteria 3309
222 Ga0207691_10116329 3300025940 Bacteria 2373
223 Ga0207689_10034543 3300025942 Bacteria 4200
224 Ga0207679_10020913 3300025945 Bacteria 4426
225 Ga0207667_10030437 3300025949 Bacteria 5840
226 Ga0207667_10247887 3300025949 Bacteria 1822
227 Ga0207677_10002837 3300026023 Bacteria 9133
228 Ga0207639_10263829 3300026041 Bacteria 1508
229 Ga0207648_10168389 3300026089 Bacteria 1936
230 Ga0207674_10240658 3300026116 Bacteria 1756
231 Ga0207674_10277115 3300026116 Bacteria 1625
232 Ga0207683_10174422 3300026121 Bacteria 1948
233 Ga0209970_1000170 3300027614 Bacteria 10178
234 Ga0209282_1000363 3300027666 Bacteria 22201
235 Ga0209282_1072160 3300027666 Bacteria 1875
236 Ga0209974_10001830 3300027876 Bacteria 7754
237 Ga0209974_10031135 3300027876 Bacteria 1766
238 Ga0207428_10059883 3300027907 Bacteria 3017
239 Ga0207428_10187346 3300027907 Bacteria 1561
240 Ga0268265_10031295 3300028380 Bacteria 3842
241 Ga0307515_10000090 3300028794 Bacteria 215043
242 Ga0307515_10000873 3300028794 Bacteria 69237
243 Ga0307515_10017471 3300028794 Bacteria 13059
244 Ga0307515_10065505 3300028794 Bacteria 5053
245 Ga0307515_10391259 3300028794 Bacteria 1019
246 Ga0307512_10066757 3300030522 Bacteria 2714
247 Ga0316177_1034265 3300030731 Bacteria 5901
248 Ga0316176_1042615 3300030732 Bacteria 5779
249 Ga0314311_1116647 3300030733 Bacteria 19723
250 Ga0316178_1000640 3300030735 Bacteria 3923
251 Ga0316183_1031412 3300030742 Bacteria 9920
252 Ga0316181_1174844 3300030744 Bacteria 12394
253 Ga0316182_1030208 3300030745 Bacteria 5997
254 Ga0316182_1275715 3300030745 Bacteria 3068
255 Ga0265329_10027200 3300031242 Bacteria 1881
256 Ga0265327_10022834 3300031251 Bacteria 3724
257 Ga0307513_10016535 3300031456 Bacteria 8892
258 Ga0307513_10220399 3300031456 Bacteria 1718
259 Ga0307513_10373314 3300031456 Bacteria 1168
260 Ga0307509_10128580 3300031507 Bacteria 2494
261 Ga0307408_100045670 3300031548 Bacteria 3129
262 Ga0307408_100133327 3300031548 Bacteria 1940
263 Ga0307408_100242291 3300031548 Bacteria 1482
264 Ga0307508_10003846 3300031616 Bacteria 14955
265 Ga0307514_10020361 3300031649 Bacteria 5413
266 Ga0307514_10024218 3300031649 Bacteria 4918
267 Ga0307514_10081127 3300031649 Bacteria 2398
268 Ga0307514_10253106 3300031649 Bacteria 1040
269 Ga0265314_10005115 3300031711 Bacteria 11940
270 Ga0265342_10042133 3300031712 Bacteria 2760
271 Ga0307516_10006588 3300031730 Bacteria 13576
272 Ga0307405_10126957 3300031731 Bacteria 1755
273 Ga0307405_10572919 3300031731 Bacteria 917
274 Ga0307413_10188936 3300031824 Bacteria 1477
275 Ga0307410_10350223 3300031852 Bacteria 1180
276 Ga0307406_10000879 3300031901 Bacteria 16916
277 Ga0307406_10087786 3300031901 Bacteria 2085
278 Ga0307412_10015706 3300031911 Bacteria 4494
279 Ga0307412_10026737 3300031911 Bacteria 3590
280 Ga0307412_10027258 3300031911 Bacteria 3560
281 Ga0307412_10040151 3300031911 Bacteria 3026
282 Ga0307412_10046588 3300031911 Bacteria 2841
283 Ga0307412_10098937 3300031911 Bacteria 2058
284 Ga0307412_10198940 3300031911 Bacteria 1520
285 Ga0307409_100301056 3300031995 Bacteria 1492
286 Ga0307409_100746536 3300031995 Bacteria 982
287 Ga0307416_100617087 3300032002 Bacteria 1166
288 Ga0307416_100714687 3300032002 Bacteria 1092
289 Ga0307414_10033284 3300032004 Bacteria 3405
290 Ga0307411_10013693 3300032005 Bacteria 4486
291 Ga0307411_10123898 3300032005 Bacteria 1875
292 Ga0307411_10249485 3300032005 Bacteria 1394
293 Ga0307411_10285033 3300032005 Bacteria 1317
294 Ga0307411_10533604 3300032005 Bacteria 998
295 Ga0373931_0492283 3300035691 Bacteria 790
296 Ga0373937_0177269 3300036401 Bacteria 2001
297 Ga0395899_0009458 3300037312 Bacteria 7481
298 Ga0395900_0017340 3300037418 Bacteria 7351
299 Ga0395900_0032317 3300037418 Bacteria 5381
300 Ga0395900_0177675 3300037418 Bacteria 2165
301 Ga0395898_0031119 3300037466 Bacteria 5336
302 Ga0395898_0085650 3300037466 Bacteria 3037
303 Ga0395898_0535736 3300037466 Bacteria 1113
304 Ga0395905_0000430 3300037471 Bacteria 58720
305 Ga0395905_0002286 3300037471 Bacteria 21499
306 Ga0395905_0025577 3300037471 Bacteria 5566
307 Ga0395905_0056038 3300037471 Bacteria 3689
308 Ga0395905_0073636 3300037471 Bacteria 3202
309 Ga0395905_0078621 3300037471 Bacteria 3091
310 Ga0395905_0094877 3300037471 Bacteria 2799
311 Ga0395905_0178529 3300037471 Bacteria 1993
312 Ga0395905_0219909 3300037471 Bacteria 1777
313 Ga0395901_0055083 3300038443 Bacteria 4134
314 Ga0395901_0115097 3300038443 Bacteria 2825
315 Ga0395901_0125540 3300038443 Bacteria 2697
316 Ga0395901_0802870 3300038443 Bacteria 930
317 Ga0395901_1112292 3300038443 Bacteria 760
318 Ga0439436_0000149 3300041404 Bacteria 16201
319 Ga0439436_0011562 3300041404 Bacteria 2681
320 Ga0439436_0075464 3300041404 Bacteria 939
321 Ga0439438_018586 3300041405 Bacteria 1977
322 Ga0439439_0003522 3300041406 Bacteria 3459
323 Ga0439439_0035663 3300041406 Bacteria 1278
324 Ga0439447_028917 3300041407 Bacteria 1406
325 Ga0439447_040751 3300041407 Bacteria 1132
326 Ga0439453_0024269 3300041408 Bacteria 1111
327 Ga0439461_0071745 3300041410 Bacteria 804
328 Ga0439466_0001330 3300041411 Bacteria 9632
329 Ga0439466_0014241 3300041411 Bacteria 2899
330 Ga0439465_0001529 3300041413 Bacteria 7518
331 Ga0439465_0040635 3300041413 Bacteria 1504
332 Ga0451791_0240322 3300041451 Bacteria 1106
333 Ga0451793_1633290 3300041452 Bacteria 1377
334 Ga0451795_0254997 3300041456 Bacteria 1507
335 Ga0451802_0290810 3300041460 Bacteria 1054
336 Ga0451833_0213065 3300041491 Bacteria 2283
337 Ga0451841_0947861 3300041498 Bacteria 2040
338 Ga0451843_0490162 3300041509 Bacteria 1362
339 Ga0451853_0243564 3300041512 Bacteria 882
340 Ga0451853_1974279 3300041512 Bacteria 819
341 Ga0439431_0005212 3300041997 Bacteria 2864
342 Ga0439433_0000311 3300041999 Bacteria 8445
343 Ga0439433_0004840 3300041999 Bacteria 2893
344 Ga0439433_0005036 3300041999 Bacteria 2834
345 Ga0439433_0061312 3300041999 Bacteria 897
346 Ga0439433_0099139 3300041999 Bacteria 722
347 Ga0439442_001752 3300042002 Bacteria 4248
348 Ga0439442_004720 3300042002 Bacteria 2710
349 Ga0439442_008852 3300042002 Bacteria 2034
350 Ga0439445_0000796 3300042004 Bacteria 6628
351 Ga0439432_000358 3300042006 Bacteria 16718
352 Ga0439432_019701 3300042006 Bacteria 2246
353 Ga0439449_0000747 3300042007 Bacteria 12487
354 Ga0439449_0002278 3300042007 Bacteria 7532
355 Ga0439449_0003803 3300042007 Bacteria 5841
356 Ga0439449_0015498 3300042007 Bacteria 2865
357 Ga0439449_0016216 3300042007 Bacteria 2801
358 Ga0439449_0018677 3300042007 Bacteria 2601
359 Ga0439452_001926 3300042010 Bacteria 7955
360 Ga0439452_050866 3300042010 Bacteria 949
361 Ga0439455_0118285 3300042012 Bacteria 741
362 Ga0439457_008390 3300042014 Bacteria 2439
363 Ga0439462_0003432 3300042015 Bacteria 3806
364 Ga0439462_0026016 3300042015 Bacteria 1541
365 Ga0439462_0032418 3300042015 Bacteria 1385
366 Ga0439462_0066250 3300042015 Bacteria 979
367 Ga0450923_002236 3300042125 Bacteria 2741
368 Ga0450897_001328 3300042128 Bacteria 1665
369 Ga0450894_006623 3300042131 Bacteria 1493
370 Ga0450894_013302 3300042131 Bacteria 1080
371 Ga0450898_010497 3300042134 Bacteria 1501
372 Ga0450899_008023 3300042135 Bacteria 1153
373 Ga0450904_009207 3300042139 Bacteria 972
374 Ga0450889_016422 3300042144 Bacteria 799
375 Ga0450907_013564 3300042146 Bacteria 1358
376 Ga0439446_0036038 3300042156 Bacteria 1444
377 Ga0439446_0044925 3300042156 Bacteria 1308
378 Ga0439458_0012259 3300042157 Bacteria 1922
379 Ga0450908_001061 3300042184 Bacteria 5337
380 Ga0450908_016540 3300042184 Bacteria 1315
381 Ga0450909_034520 3300042185 Bacteria 771
382 Ga0439434_0000586 3300042435 Bacteria 10519
383 Ga0439434_0001272 3300042435 Bacteria 7258
384 Ga0439434_0007156 3300042435 Bacteria 3266
385 Ga0450918_004239 3300042531 Bacteria 2626
386 Ga0450893_0000608 3300042532 Bacteria 5108
387 Ga0450893_0003843 3300042532 Bacteria 2380
388 Ga0451577_0640666 3300042876 Bacteria 964
389 Ga0466969_0009887 3300044656 Bacteria 5056
390 Ga0466969_0021244 3300044656 Bacteria 3357
391 Ga0466969_0237148 3300044656 Bacteria 828
392 Ga0453683_0000971 3300044673 Bacteria 27149
393 Ga0453683_0163543 3300044673 Bacteria 1409
394 Ga0466965_0491724 3300044683 Bacteria 687
395 Ga0466966_0014755 3300044684 Bacteria 5168
396 Ga0466966_0272229 3300044684 Bacteria 1019
397 Ga0466961_0007001 3300044693 Bacteria 7175
398 Ga0466961_0255231 3300044693 Bacteria 1076
399 Ga0453684_0020557 3300044712 Bacteria 9945
400 Ga0453684_0107868 3300044712 Bacteria 3390
401 Ga0453684_0177640 3300044712 Bacteria 2502
402 Ga0466971_0177617 3300044719 Bacteria 1000
403 Ga0466970_0020036 3300044765 Bacteria 3471
404 Ga0466957_0082413 3300044842 Bacteria 2005
405 Ga0466957_0142892 3300044842 Bacteria 1543
406 Ga0466959_0093592 3300045049 Bacteria 2156
407 Ga0466959_0263956 3300045049 Bacteria 1185
408 Ga0451576_0006552 3300045051 Bacteria 14247
409 Ga0451576_0009839 3300045051 Bacteria 11049
410 Ga0451576_0221606 3300045051 Bacteria 1975
411 Ga0451576_0614395 3300045051 Bacteria 1142
412 Ga0466958_0040043 3300045836 Bacteria 2817
413 Ga0466967_0319059 3300045976 Bacteria 1498
414 Ga0495627_023612 3300046453 Bacteria 2012
415 Ga0495638_0019806 3300046460 Bacteria 4448
416 Ga0495653_0424466 3300046463 Bacteria 841
417 Ga0495639_0010958 3300046475 Bacteria 3903
418 Ga0495610_0016871 3300046512 Bacteria 4184
419 Ga0495616_0016577 3300046513 Bacteria 4075
420 Ga0495620_0012903 3300046515 Bacteria 4295
421 Ga0495620_0055802 3300046515 Bacteria 1664
422 Ga0495628_0529050 3300046516 Bacteria 848
423 Ga0495631_0000148 3300046518 Bacteria 47923
424 Ga0495632_0056441 3300046519 Bacteria 1919
425 Ga0495637_0028183 3300046520 Bacteria 2509
426 Ga0495643_0019069 3300046522 Bacteria 3972
427 Ga0495642_0037633 3300046528 Bacteria 1958
428 Ga0495654_0005078 3300046530 Bacteria 7701
429 Ga0495609_0028927 3300046538 Bacteria 2526
430 Ga0495633_0042827 3300046558 Bacteria 2149
431 Ga0495633_0292165 3300046558 Bacteria 741
432 Ga0495656_0002670 3300046615 Bacteria 5953
433 Ga0495656_0013005 3300046615 Bacteria 3086
434 Ga0495656_0047197 3300046615 Bacteria 1825
435 Ga0495625_0000903 3300046660 Bacteria 39973
436 Ga0495625_0013208 3300046660 Bacteria 6648
437 Ga0495625_0022259 3300046660 Bacteria 4863
438 Ga0495625_0225057 3300046660 Bacteria 1227
439 Ga0495635_0095027 3300046663 Bacteria 2038
440 Ga0495635_0251157 3300046663 Bacteria 1192
441 Ga0495659_0138693 3300046664 Bacteria 969
442 Ga0495588_0002276 3300046674 Bacteria 8218
443 Ga0495588_0036864 3300046674 Bacteria 2482
444 Ga0495588_0120337 3300046674 Bacteria 1384
445 Ga0495588_0195156 3300046674 Bacteria 1069
446 Ga0495658_0037066 3300046683 Bacteria 2694
447 Ga0495658_0149781 3300046683 Bacteria 1432
448 Ga0495669_0062852 3300046684 Bacteria 1683
449 Ga0495613_0509117 3300046689 Bacteria 810
450 Ga0495670_0229998 3300046691 Bacteria 986
451 Ga0495670_0267401 3300046691 Bacteria 913
452 Ga0495671_0001383 3300046692 Bacteria 16422
453 Ga0495636_0024407 3300047318 Bacteria 2452
454 Ga0495676_0001292 3300047321 Bacteria 21470
455 Ga0495677_0021558 3300047445 Bacteria 2335
456 Ga0495686_0084913 3300047472 Bacteria 1929
457 Ga0495593_0000578 3300047673 Bacteria 20838
458 Ga0495602_0141253 3300048088 Bacteria 1906
459 Ga0495614_0001794 3300048089 Bacteria 9392
460 Ga0495615_0004160 3300048090 Bacteria 2498
461 Ga0495615_0028371 3300048090 Bacteria 1321
462 Ga0496101_0023790 3300048904 Bacteria 4235
463 Ga0496102_0155753 3300048905 Bacteria 2148
464 Ga0496102_0270273 3300048905 Bacteria 1603
465 Ga0496107_0150347 3300048910 Bacteria 1722
466 Ga0496108_0170086 3300048911 Bacteria 1885
467 Ga0496110_0082431 3300048913 Bacteria 2868
468 Ga0496114_0039195 3300048917 Bacteria 3920
469 Ga0496116_0039170 3300048919 Bacteria 3280
470 Ga0496117_0012358 3300048920 Bacteria 7536
471 Ga0496117_0112717 3300048920 Bacteria 1690
472 Ga0496117_0117653 3300048920 Bacteria 1640
473 Ga0496118_0002760 3300048921 Bacteria 23052
474 Ga0496118_0161890 3300048921 Bacteria 1382
475 Ga0496121_0028535 3300048924 Bacteria 5191
476 Ga0496121_0058405 3300048924 Bacteria 3189
477 Ga0496122_0001128 3300048925 Bacteria 45936
478 Ga0496122_0044805 3300048925 Bacteria 3448
479 Ga0496122_0160716 3300048925 Bacteria 1370
480 Ga0496122_0239576 3300048925 Bacteria 1024
481 Ga0496123_0000181 3300048926 Bacteria 127092
482 Ga0496123_0041868 3300048926 Bacteria 3169
483 Ga0496123_0154222 3300048926 Bacteria 1234
484 Ga0496124_0022862 3300048927 Bacteria 5724
485 Ga0496124_0093615 3300048927 Bacteria 2445
486 Ga0496124_0125894 3300048927 Bacteria 2041
487 Ga0496124_0217019 3300048927 Bacteria 1442
488 Ga0496125_0017195 3300048928 Bacteria 6912
489 Ga0496125_0028367 3300048928 Bacteria 5058
490 Ga0496125_0152447 3300048928 Bacteria 1585
491 Ga0501033_0251385 3300049570 Bacteria 1253
492 Ga0501036_0220769 3300049572 Bacteria 1592
493 Ga0501038_0296968 3300049574 Bacteria 1268
494 Ga0501038_0560839 3300049574 Bacteria 868
495 Ga0501039_0508447 3300049575 Bacteria 946
496 Ga0501046_0031629 3300049580 Bacteria 4288
497 Ga0501046_0179070 3300049580 Bacteria 1586
498 Ga0501047_0078520 3300049581 Bacteria 3174
499 Ga0501238_016804 3300049671 Bacteria 1016
500 Ga0501249_001551 3300049679 Bacteria 4711
501 Ga0501225_0008697 3300049705 Bacteria 2907
502 Ga0501080_0394057 3300049742 Bacteria 1246
503 Ga0501262_000112 3300049759 Bacteria 9999
504 Ga0501263_011845 3300049760 Bacteria 1087
505 Ga0501035_0123318 3300049822 Bacteria 2263
506 Ga0501044_0074784 3300049823 Bacteria 3441
507 Ga0501044_0211722 3300049823 Bacteria 1892
508 Ga0501044_0380218 3300049823 Bacteria 1327
509 nmdc:mga03683_33652_c1 3300050489 Bacteria 2070
510 nmdc:mga03683_45930_c1 3300050489 Bacteria 1809
511 nmdc:mga03683_70124_c1 3300050489 Bacteria 1497
512 nmdc:mga03683_752_c1 3300050489 Bacteria 9302
513 nmdc:mga03n38_1379_c1 3300050490 Bacteria 6409
514 nmdc:mga03n38_30849_c1 3300050490 Bacteria 2257
515 nmdc:mga03n38_9578_c1 3300050490 Bacteria 3530
516 nmdc:mga00v17_2845_c1 3300050491 Bacteria 8881
517 nmdc:mga0yw44_31788_c1 3300050492 Bacteria 3072
518 nmdc:mga0yw44_3367_c2 3300050492 Bacteria 6107
519 nmdc:mga0yw44_461395_c1 3300050492 Bacteria 861
520 nmdc:mga0yw44_74287_c1 3300050492 Bacteria 2118
521 nmdc:mga0k408_135006_c1 3300050493 Bacteria 1466
522 nmdc:mga0k408_150544_c1 3300050493 Bacteria 1385
523 nmdc:mga0k408_2591_c1 3300050493 Bacteria 5101
524 nmdc:mga0k408_28362_c1 3300050493 Bacteria 3182
525 nmdc:mga0k408_40743_c1 3300050493 Bacteria 2674
526 nmdc:mga0k408_50706_c1 3300050493 Bacteria 2403
527 nmdc:mga0k408_6140_c1 3300050493 Bacteria 6407
528 nmdc:mga0k408_72840_c1 3300050493 Bacteria 2006
529 nmdc:mga0k408_7671_c1 3300050493 Bacteria 5765
530 nmdc:mga06z11_13020_c1 3300050494 Bacteria 3637
531 nmdc:mga06z11_62348_c1 3300050494 Bacteria 1947
532 nmdc:mga06z11_96204_c1 3300050494 Bacteria 1617
533 nmdc:mga07m45_12572_c1 3300050496 Bacteria 4477
534 nmdc:mga07m45_2915_c1 3300050496 Bacteria 8112
535 nmdc:mga07m45_3013_c1 3300050496 Bacteria 4223
536 nmdc:mga07m45_342566_c1 3300050496 Bacteria 869
537 nmdc:mga07m45_498_c1 3300050496 Bacteria 16631
538 nmdc:mga07m45_53795_c1 3300050496 Bacteria 2275
539 nmdc:mga07m45_7161_c1 3300050496 Bacteria 5684
540 Ga0495612_0170558 3300053078 Bacteria 953
541 Ga0500610_0000149 3300053079 Bacteria 20779
542 Ga0500610_0005255 3300053079 Bacteria 5279
543 Ga0500610_0135146 3300053079 Bacteria 1250
544 Ga0500643_004014 3300053087 Bacteria 6797
545 Ga0500644_0113342 3300053088 Bacteria 1047
546 Ga0500646_0016751 3300053090 Bacteria 1916
547 Ga0500651_0000024 3300053093 Bacteria 129450
548 Ga0500566_0047185 3300053094 Bacteria 2473
549 Ga0500562_017634 3300053108 Bacteria 1842
550 Ga0500571_000051 3300053110 Bacteria 35723
551 Ga0500597_053869 3300053120 Bacteria 1718
552 Ga0500607_002042 3300053121 Bacteria 17000
553 Ga0500607_017152 3300053121 Bacteria 4137
554 Ga0500608_003424 3300053122 Bacteria 5945
555 Ga0500608_009837 3300053122 Bacteria 4077
556 Ga0500608_067123 3300053122 Bacteria 1709
557 Ga0500655_003408 3300053133 Bacteria 2876
558 Ga0500658_0005611 3300053134 Bacteria 4671
559 Ga0500658_0013366 3300053134 Bacteria 3032
560 Ga0500559_0004532 3300053136 Bacteria 6573
561 Ga0500559_0006010 3300053136 Bacteria 5512
562 Ga0500564_013046 3300053138 Bacteria 3711
563 Ga0500568_0001905 3300053139 Bacteria 12829
564 Ga0500573_0148125 3300053140 Bacteria 1287
565 Ga0500574_000143 3300053141 Bacteria 8159
566 Ga0500616_0016282 3300053153 Bacteria 4235
567 Ga0500627_0011457 3300053158 Bacteria 3277
568 Ga0500633_0029813 3300053160 Bacteria 1749
569 Ga0500634_0039947 3300053161 Bacteria 2550
570 Ga0500570_138595 3300053724 Bacteria 901
571 Ga0500565_004108 3300053734 Bacteria 1208
572 Ga0500596_012331 3300053735 Bacteria 1298
573 Ga0590075_013652 3300059424 Bacteria 1981

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_342566_c1 nmdc:mga07m45_342566_c1_122_793 212
2 3300031911 Ga0307412_10198940 Ga0307412_101989402 216
3 3300031649 Ga0307514_10020361 Ga0307514_100203617 217
4 3300032002 Ga0307416_100714687 Ga0307416_1007146871 218
5 3300044656 Ga0466969_0009887 Ga0466969_0009887_2178_2834 218
6 3300044683 Ga0466965_0491724 Ga0466965_0491724_18_674 218
7 3300044684 Ga0466966_0014755 Ga0466966_0014755_2889_3545 218
8 3300044693 Ga0466961_0007001 Ga0466961_0007001_141_797 218
9 3300044693 Ga0466961_0255231 Ga0466961_0255231_215_871 218
10 3300044765 Ga0466970_0020036 Ga0466970_0020036_1889_2545 218
11 3300045049 Ga0466959_0093592 Ga0466959_0093592_1451_2107 218
12 3300045976 Ga0466967_0319059 Ga0466967_0319059_46_702 218
13 iso_pu_bacteria 2585428062 2587756261 219
14 iso_pu_bacteria 2881101125 2881102160 219
15 iso_pu_bacteria 2513020051 2513227933 220
16 iso_pu_bacteria 2599185214 2599624189 220
17 iso_pu_bacteria 2599185226 2599672201 220
18 iso_pu_bacteria 2599185227 2599681715 220
19 iso_pu_bacteria 2599185229 2599693729 220
20 iso_pu_bacteria 2643221628 2644162666 220
21 iso_pu_bacteria 2643221658 2644328862 220
22 iso_pu_bacteria 2643221672 2644397919 220
23 iso_pu_bacteria 2643221683 2644469086 220
24 iso_pu_bacteria 2738541277 2738719863 220
25 iso_pu_bacteria 2738541307 2738879724 220
26 iso_pu_bacteria 2738543019 2739279062 220
27 iso_pu_bacteria 2818991446 2819596557 220
28 iso_pu_bacteria 2831265667 2831267972 220
29 iso_pu_bacteria 2838054893 2838060086 220
30 iso_pu_bacteria 2842677519 2842677860 220
31 iso_pu_bacteria 2842733646 2842737373 220
32 iso_pu_bacteria 2842747753 2842749896 220
33 iso_pu_bacteria 2885192300 2885194926 220
34 iso_pu_bacteria 2885198086 2885199273 220
35 iso_pu_bacteria 2885211737 2885212924 220
36 iso_pu_bacteria 2899924645 2899931275 220
37 iso_pu_bacteria 2904449895 2904450135 220
38 iso_pu_bacteria 2904456579 2904457042 220
39 iso_pu_bacteria 2904541872 2904543991 220
40 iso_pu_bacteria 2919462493 2919464852 220
41 iso_pu_bacteria 2928037797 2928037952 220
42 iso_pu_bacteria 2928044640 2928046442 220
43 iso_pu_bacteria 2928051484 2928054138 220
44 iso_pu_bacteria 2928064002 2928065891 220
45 iso_pu_bacteria 2928070936 2928076796 220
46 iso_pu_bacteria 2928084124 2928090454 220
47 iso_pu_bacteria 2928115317 2928120616 220
48 iso_pu_bacteria 2929160207 2929162450 220
49 iso_pu_bacteria 2929520902 2929525420 220
50 iso_pu_bacteria 2945909444 2945913175 220
51 iso_pu_bacteria 2945945610 2945948796 220
52 iso_pu_bacteria 2945972063 2945972915 220
53 iso_pu_bacteria 2945984333 2945984551 220
54 iso_pu_bacteria 2954767861 2954772933 220
55 3300036401 Ga0373937_0177269 Ga0373937_0177269_473_1141 222
56 3300042876 Ga0451577_0640666 Ga0451577_0640666_161_829 222
57 3300044712 Ga0453684_0177640 Ga0453684_0177640_1638_2306 222
58 3300045051 Ga0451576_0614395 Ga0451576_0614395_356_1024 222
59 3300003792 Ga0055540_1007457 Ga0055540_10074573 223
60 3300003794 Ga0055531_10000397 Ga0055531_1000039714 223
61 3300005327 Ga0070658_10119958 Ga0070658_101199583 223
62 3300005334 Ga0068869_100088786 Ga0068869_1000887862 223
63 3300005530 Ga0070679_100002524 Ga0070679_1000025247 223
64 3300005530 Ga0070679_100041372 Ga0070679_1000413724 223
65 3300005530 Ga0070679_100367289 Ga0070679_1003672892 223
66 3300005563 Ga0068855_100041744 Ga0068855_1000417446 223
67 3300005563 Ga0068855_100221599 Ga0068855_1002215992 223
68 3300005563 Ga0068855_101031114 Ga0068855_1010311142 223
69 3300005614 Ga0068856_100304668 Ga0068856_1003046682 223
70 3300005616 Ga0068852_100656126 Ga0068852_1006561262 223
71 3300006038 Ga0075365_10005809 Ga0075365_100058094 223
72 3300006038 Ga0075365_10011460 Ga0075365_100114602 223
73 3300006038 Ga0075365_10049650 Ga0075365_100496503 223
74 3300006042 Ga0075368_10013672 Ga0075368_100136723 223
75 3300006051 Ga0075364_10228262 Ga0075364_102282622 223
76 3300006195 Ga0075366_10063532 Ga0075366_100635323 223
77 3300006195 Ga0075366_10220490 Ga0075366_102204902 223
78 3300006195 Ga0075366_10274177 Ga0075366_102741772 223
79 3300006353 Ga0075370_10265472 Ga0075370_102654722 223
80 3300009174 Ga0105241_10027439 Ga0105241_100274392 223
81 3300009551 Ga0105238_10068299 Ga0105238_100682995 223
82 3300010375 Ga0105239_10326802 Ga0105239_103268022 223
83 3300014969 Ga0157376_10002064 Ga0157376_1000206410 223
84 3300025273 Ga0209673_1004640 Ga0209673_10046405 223
85 3300025303 Ga0209051_1000583 Ga0209051_100058330 223
86 3300025304 Ga0209257_1000866 Ga0209257_100086630 223
87 3300025909 Ga0207705_10108019 Ga0207705_101080192 223
88 3300025911 Ga0207654_10067089 Ga0207654_100670892 223
89 3300025913 Ga0207695_10038220 Ga0207695_100382203 223
90 3300025921 Ga0207652_10311484 Ga0207652_103114842 223
91 3300025921 Ga0207652_10637211 Ga0207652_106372112 223
92 3300025924 Ga0207694_10130070 Ga0207694_101300704 223
93 3300025924 Ga0207694_10458459 Ga0207694_104584592 223
94 3300025927 Ga0207687_10023802 Ga0207687_100238022 223
95 3300025942 Ga0207689_10034543 Ga0207689_100345437 223
96 3300025949 Ga0207667_10030437 Ga0207667_100304379 223
97 3300025949 Ga0207667_10247887 Ga0207667_102478872 223
98 3300026023 Ga0207677_10002837 Ga0207677_100028373 223
99 3300026116 Ga0207674_10277115 Ga0207674_102771152 223
100 3300027614 Ga0209970_1000170 Ga0209970_10001704 223
101 3300027876 Ga0209974_10001830 Ga0209974_100018303 223
102 3300027876 Ga0209974_10031135 Ga0209974_100311352 223
103 3300028794 Ga0307515_10000090 Ga0307515_10000090169 223
104 3300028794 Ga0307515_10017471 Ga0307515_100174719 223
105 3300028794 Ga0307515_10065505 Ga0307515_100655052 223
106 3300028794 Ga0307515_10391259 Ga0307515_103912592 223
107 3300030522 Ga0307512_10066757 Ga0307512_100667572 223
108 3300031242 Ga0265329_10027200 Ga0265329_100272003 223
109 3300031456 Ga0307513_10016535 Ga0307513_100165357 223
110 3300031456 Ga0307513_10220399 Ga0307513_102203992 223
111 3300031507 Ga0307509_10128580 Ga0307509_101285803 223
112 3300031616 Ga0307508_10003846 Ga0307508_100038467 223
113 3300031649 Ga0307514_10253106 Ga0307514_102531062 223
114 3300031711 Ga0265314_10005115 Ga0265314_100051155 223
115 3300031712 Ga0265342_10042133 Ga0265342_100421333 223
116 3300031730 Ga0307516_10006588 Ga0307516_1000658810 223
117 3300031731 Ga0307405_10572919 Ga0307405_105729191 223
118 3300032002 Ga0307416_100617087 Ga0307416_1006170872 223
119 3300035691 Ga0373931_0492283 Ga0373931_0492283_38_709 223
120 3300037312 Ga0395899_0009458 Ga0395899_0009458_3696_4367 223
121 3300037418 Ga0395900_0017340 Ga0395900_0017340_2877_3548 223
122 3300037418 Ga0395900_0032317 Ga0395900_0032317_4615_5286 223
123 3300037418 Ga0395900_0177675 Ga0395900_0177675_409_1080 223
124 3300037466 Ga0395898_0031119 Ga0395898_0031119_870_1541 223
125 3300037466 Ga0395898_0085650 Ga0395898_0085650_622_1293 223
126 3300037466 Ga0395898_0535736 Ga0395898_0535736_35_706 223
127 3300037471 Ga0395905_0000430 Ga0395905_0000430_43421_44092 223
128 3300037471 Ga0395905_0002286 Ga0395905_0002286_15044_15715 223
129 3300037471 Ga0395905_0025577 Ga0395905_0025577_805_1476 223
130 3300037471 Ga0395905_0056038 Ga0395905_0056038_112_783 223
131 3300037471 Ga0395905_0073636 Ga0395905_0073636_724_1395 223
132 3300037471 Ga0395905_0078621 Ga0395905_0078621_916_1596 223
133 3300037471 Ga0395905_0094877 Ga0395905_0094877_1337_2008 223
134 3300037471 Ga0395905_0178529 Ga0395905_0178529_814_1485 223
135 3300037471 Ga0395905_0219909 Ga0395905_0219909_872_1543 223
136 3300038443 Ga0395901_0055083 Ga0395901_0055083_1111_1782 223
137 3300038443 Ga0395901_0115097 Ga0395901_0115097_928_1599 223
138 3300038443 Ga0395901_0125540 Ga0395901_0125540_334_1005 223
139 3300038443 Ga0395901_0802870 Ga0395901_0802870_79_750 223
140 3300038443 Ga0395901_1112292 Ga0395901_1112292_66_737 223
141 3300041404 Ga0439436_0075464 Ga0439436_0075464_77_802 223
142 3300041408 Ga0439453_0024269 Ga0439453_0024269_293_964 223
143 3300041451 Ga0451791_0240322 Ga0451791_0240322_107_778 223
144 3300041452 Ga0451793_1633290 Ga0451793_1633290_380_1051 223
145 3300041456 Ga0451795_0254997 Ga0451795_0254997_93_764 223
146 3300041460 Ga0451802_0290810 Ga0451802_0290810_11_682 223
147 3300041491 Ga0451833_0213065 Ga0451833_0213065_1414_2085 223
148 3300041509 Ga0451843_0490162 Ga0451843_0490162_479_1228 223
149 3300041512 Ga0451853_0243564 Ga0451853_0243564_134_805 223
150 3300041999 Ga0439433_0004840 Ga0439433_0004840_1740_2411 223
151 3300041999 Ga0439433_0061312 Ga0439433_0061312_30_701 223
152 3300041999 Ga0439433_0099139 Ga0439433_0099139_33_704 223
153 3300042007 Ga0439449_0015498 Ga0439449_0015498_328_999 223
154 3300042007 Ga0439449_0016216 Ga0439449_0016216_1917_2588 223
155 3300042012 Ga0439455_0118285 Ga0439455_0118285_31_702 223
156 3300042015 Ga0439462_0003432 Ga0439462_0003432_2079_2750 223
157 3300042015 Ga0439462_0066250 Ga0439462_0066250_243_914 223
158 3300042128 Ga0450897_001328 Ga0450897_001328_676_1347 223
159 3300042131 Ga0450894_013302 Ga0450894_013302_101_772 223
160 3300042134 Ga0450898_010497 Ga0450898_010497_119_790 223
161 3300042139 Ga0450904_009207 Ga0450904_009207_130_801 223
162 3300042144 Ga0450889_016422 Ga0450889_016422_19_690 223
163 3300042156 Ga0439446_0036038 Ga0439446_0036038_384_1055 223
164 3300042157 Ga0439458_0012259 Ga0439458_0012259_883_1554 223
165 3300042185 Ga0450909_034520 Ga0450909_034520_79_750 223
166 3300042435 Ga0439434_0007156 Ga0439434_0007156_511_1182 223
167 3300042532 Ga0450893_0000608 Ga0450893_0000608_1978_2649 223
168 3300044656 Ga0466969_0021244 Ga0466969_0021244_31_702 223
169 3300044656 Ga0466969_0237148 Ga0466969_0237148_130_801 223
170 3300044673 Ga0453683_0000971 Ga0453683_0000971_8755_9426 223
171 3300044673 Ga0453683_0163543 Ga0453683_0163543_48_719 223
172 3300044684 Ga0466966_0272229 Ga0466966_0272229_146_817 223
173 3300044712 Ga0453684_0020557 Ga0453684_0020557_8802_9476 223
174 3300044712 Ga0453684_0107868 Ga0453684_0107868_867_1538 223
175 3300044719 Ga0466971_0177617 Ga0466971_0177617_42_713 223
176 3300044842 Ga0466957_0082413 Ga0466957_0082413_1079_1750 223
177 3300044842 Ga0466957_0142892 Ga0466957_0142892_294_965 223
178 3300045049 Ga0466959_0263956 Ga0466959_0263956_37_708 223
179 3300045051 Ga0451576_0006552 Ga0451576_0006552_5324_5995 223
180 3300045051 Ga0451576_0009839 Ga0451576_0009839_6473_7144 223
181 3300045051 Ga0451576_0221606 Ga0451576_0221606_748_1419 223
182 3300045836 Ga0466958_0040043 Ga0466958_0040043_1254_1925 223
183 3300046512 Ga0495610_0016871 Ga0495610_0016871_1517_2188 223
184 3300046515 Ga0495620_0055802 Ga0495620_0055802_514_1185 223
185 3300046519 Ga0495632_0056441 Ga0495632_0056441_46_717 223
186 3300046522 Ga0495643_0019069 Ga0495643_0019069_2787_3458 223
187 3300046558 Ga0495633_0042827 Ga0495633_0042827_1146_1817 223
188 3300046615 Ga0495656_0013005 Ga0495656_0013005_1423_2202 223
189 3300046615 Ga0495656_0047197 Ga0495656_0047197_729_1400 223
190 3300046660 Ga0495625_0013208 Ga0495625_0013208_3682_4353 223
191 3300046674 Ga0495588_0120337 Ga0495588_0120337_301_972 223
192 3300046683 Ga0495658_0149781 Ga0495658_0149781_61_732 223
193 3300046684 Ga0495669_0062852 Ga0495669_0062852_800_1471 223
194 3300047318 Ga0495636_0024407 Ga0495636_0024407_498_1169 223
195 3300047445 Ga0495677_0021558 Ga0495677_0021558_1511_2182 223
196 3300047472 Ga0495686_0084913 Ga0495686_0084913_823_1494 223
197 3300048090 Ga0495615_0004160 Ga0495615_0004160_1122_1793 223
198 3300048090 Ga0495615_0028371 Ga0495615_0028371_194_865 223
199 3300049570 Ga0501033_0251385 Ga0501033_0251385_496_1167 223
200 3300049572 Ga0501036_0220769 Ga0501036_0220769_595_1266 223
201 3300049574 Ga0501038_0296968 Ga0501038_0296968_160_831 223
202 3300049574 Ga0501038_0560839 Ga0501038_0560839_22_693 223
203 3300049575 Ga0501039_0508447 Ga0501039_0508447_215_886 223
204 3300049580 Ga0501046_0179070 Ga0501046_0179070_115_786 223
205 3300049581 Ga0501047_0078520 Ga0501047_0078520_157_828 223
206 3300049742 Ga0501080_0394057 Ga0501080_0394057_432_1103 223
207 3300049760 Ga0501263_011845 Ga0501263_011845_210_881 223
208 3300049822 Ga0501035_0123318 Ga0501035_0123318_287_958 223
209 3300049823 Ga0501044_0074784 Ga0501044_0074784_56_727 223
210 3300049823 Ga0501044_0211722 Ga0501044_0211722_685_1356 223
211 3300049823 Ga0501044_0380218 Ga0501044_0380218_222_893 223
212 3300050489 nmdc:mga03683_45930_c1 nmdc:mga03683_45930_c1_778_1449 223
213 3300050492 nmdc:mga0yw44_31788_c1 nmdc:mga0yw44_31788_c1_2361_3032 223
214 3300050492 nmdc:mga0yw44_3367_c2 nmdc:mga0yw44_3367_c2_5084_5755 223
215 3300050492 nmdc:mga0yw44_461395_c1 nmdc:mga0yw44_461395_c1_101_772 223
216 3300050493 nmdc:mga0k408_150544_c1 nmdc:mga0k408_150544_c1_391_1062 223
217 3300050493 nmdc:mga0k408_40743_c1 nmdc:mga0k408_40743_c1_1653_2324 223
218 3300050493 nmdc:mga0k408_50706_c1 nmdc:mga0k408_50706_c1_873_1547 223
219 3300050494 nmdc:mga06z11_96204_c1 nmdc:mga06z11_96204_c1_162_833 223
220 3300053088 Ga0500644_0113342 Ga0500644_0113342_160_831 223
221 3300053724 Ga0500570_138595 Ga0500570_138595_150_821 223
222 3300059424 Ga0590075_013652 Ga0590075_013652_912_1592 223
223 2162886007 SwRhRL2b_contig_3254866 SwRhRL2b_0768.00001150 224
224 3300001979 JGI24740J21852_10024963 JGI24740J21852_100249632 224
225 3300002739 JGI25158J39367_1006113 JGI25158J39367_10061131 224
226 3300002773 JGI25152J39213_1000055 JGI25152J39213_10000555 224
227 3300002773 JGI25152J39213_1001621 JGI25152J39213_10016215 224
228 3300002774 JGI25150J39212_1000806 JGI25150J39212_10008063 224
229 3300002774 JGI25150J39212_1004342 JGI25150J39212_10043422 224
230 3300002774 JGI25150J39212_1005297 JGI25150J39212_10052975 224
231 3300002774 JGI25150J39212_1006788 JGI25150J39212_10067882 224
232 3300002987 JGI25159J45721_1000456 JGI25159J45721_10004563 224
233 3300002987 JGI25159J45721_1002157 JGI25159J45721_10021577 224
234 3300003187 JGI25151J46595_10000194 JGI25151J46595_1000019478 224
235 3300003187 JGI25151J46595_10005584 JGI25151J46595_100055843 224
236 3300003187 JGI25151J46595_10009646 JGI25151J46595_100096465 224
237 3300003215 JGI25153J46596_10000139 JGI25153J46596_1000013978 224
238 3300003215 JGI25153J46596_10011766 JGI25153J46596_100117663 224
239 3300003316 rootH1_10000545 rootH1_100005453 224
240 3300003320 rootH2_10029231 rootH2_100292313 224
241 3300003323 rootH1_10046084 rootH1_100460842 224
242 3300003323 rootH1_10065452 rootH1_100654523 224
243 3300003354 JGI25160J50197_1000137 JGI25160J50197_100013770 224
244 3300003354 JGI25160J50197_1009602 JGI25160J50197_10096021 224
245 3300003374 JGI25161J50226_1001231 JGI25161J50226_10012311 224
246 3300003761 Ga0055535_1000084 Ga0055535_100008465 224
247 3300003762 Ga0055542_1000033 Ga0055542_1000033124 224
248 3300003771 Ga0055526_1000103 Ga0055526_100010378 224
249 3300003771 Ga0055526_1004793 Ga0055526_10047933 224
250 3300003773 Ga0055537_1001576 Ga0055537_100157611 224
251 3300003773 Ga0055537_1002475 Ga0055537_10024755 224
252 3300003775 Ga0055524_1003218 Ga0055524_10032183 224
253 3300003775 Ga0055524_1003539 Ga0055524_100353910 224
254 3300003781 Ga0055536_1003831 Ga0055536_10038319 224
255 3300003781 Ga0055536_1005161 Ga0055536_10051617 224
256 3300003781 Ga0055536_1005431 Ga0055536_10054312 224
257 3300003781 Ga0055536_1016438 Ga0055536_10164384 224
258 3300003781 Ga0055536_1025041 Ga0055536_10250411 224
259 3300003784 Ga0055534_1000150 Ga0055534_100015028 224
260 3300003784 Ga0055534_1001420 Ga0055534_100142012 224
261 3300003784 Ga0055534_1001600 Ga0055534_100160010 224
262 3300003784 Ga0055534_1004137 Ga0055534_10041372 224
263 3300003790 Ga0055528_1002757 Ga0055528_10027575 224
264 3300003790 Ga0055528_1008110 Ga0055528_10081103 224
265 3300003790 Ga0055528_1009764 Ga0055528_10097644 224
266 3300003791 Ga0055530_10001926 Ga0055530_1000192612 224
267 3300003791 Ga0055530_10027308 Ga0055530_100273082 224
268 3300003792 Ga0055540_1002120 Ga0055540_10021209 224
269 3300003792 Ga0055540_1002332 Ga0055540_10023325 224
270 3300003792 Ga0055540_1003273 Ga0055540_10032739 224
271 3300003792 Ga0055540_1004027 Ga0055540_10040272 224
272 3300003794 Ga0055531_10003306 Ga0055531_100033065 224
273 3300003794 Ga0055531_10004060 Ga0055531_1000406011 224
274 3300003794 Ga0055531_10004862 Ga0055531_100048629 224
275 3300004625 Ga0055543_1002294 Ga0055543_10022949 224
276 3300004625 Ga0055543_1005036 Ga0055543_10050364 224
277 3300005262 Ga0065165_1001987 Ga0065165_100198732 224
278 3300005262 Ga0065165_1009315 Ga0065165_10093152 224
279 3300005262 Ga0065165_1024789 Ga0065165_10247891 224
280 3300005288 Ga0065714_10066000 Ga0065714_100660005 224
281 3300005335 Ga0070666_10151988 Ga0070666_101519881 224
282 3300005344 Ga0070661_100035577 Ga0070661_1000355775 224
283 3300005353 Ga0070669_100006647 Ga0070669_1000066472 224
284 3300005456 Ga0070678_100301915 Ga0070678_1003019151 224
285 3300005459 Ga0068867_100203801 Ga0068867_1002038011 224
286 3300005539 Ga0068853_100007702 Ga0068853_1000077029 224
287 3300005564 Ga0070664_100022953 Ga0070664_1000229536 224
288 3300005577 Ga0068857_100301108 Ga0068857_1003011083 224
289 3300005834 Ga0068851_10011150 Ga0068851_100111504 224
290 3300005844 Ga0068862_100061578 Ga0068862_1000615783 224
291 3300006038 Ga0075365_10010349 Ga0075365_100103493 224
292 3300006048 Ga0075363_100020368 Ga0075363_1000203684 224
293 3300006048 Ga0075363_100022739 Ga0075363_1000227396 224
294 3300006048 Ga0075363_100051673 Ga0075363_1000516731 224
295 3300006051 Ga0075364_10026540 Ga0075364_100265402 224
296 3300006058 Ga0075432_10005605 Ga0075432_100056051 224
297 3300006058 Ga0075432_10024745 Ga0075432_100247453 224
298 3300006177 Ga0075362_10010894 Ga0075362_100108943 224
299 3300006177 Ga0075362_10034935 Ga0075362_100349353 224
300 3300006178 Ga0075367_10019976 Ga0075367_100199763 224
301 3300006178 Ga0075367_10067328 Ga0075367_100673283 224
302 3300006178 Ga0075367_10174426 Ga0075367_101744261 224
303 3300006195 Ga0075366_10014570 Ga0075366_100145702 224
304 3300006195 Ga0075366_10024597 Ga0075366_100245972 224
305 3300006195 Ga0075366_10034592 Ga0075366_100345923 224
306 3300006195 Ga0075366_10051655 Ga0075366_100516555 224
307 3300006195 Ga0075366_10060953 Ga0075366_100609532 224
308 3300006353 Ga0075370_10002696 Ga0075370_100026964 224
309 3300006353 Ga0075370_10004420 Ga0075370_100044206 224
310 3300006353 Ga0075370_10005973 Ga0075370_100059738 224
311 3300006353 Ga0075370_10017588 Ga0075370_100175884 224
312 3300006353 Ga0075370_10022199 Ga0075370_100221992 224
313 3300006353 Ga0075370_10037311 Ga0075370_100373112 224
314 3300006353 Ga0075370_10165328 Ga0075370_101653281 224
315 3300006353 Ga0075370_10192710 Ga0075370_101927102 224
316 3300006358 Ga0068871_100160650 Ga0068871_1001606502 224
317 3300006948 Ga0099826_10000055 Ga0099826_1000005526 224
318 3300006948 Ga0099826_10037924 Ga0099826_100379245 224
319 3300006948 Ga0099826_10114990 Ga0099826_101149902 224
320 3300009036 Ga0105244_10005004 Ga0105244_100050042 224
321 3300009036 Ga0105244_10211363 Ga0105244_102113631 224
322 3300009098 Ga0105245_10157696 Ga0105245_101576962 224
323 3300009148 Ga0105243_10002013 Ga0105243_1000201310 224
324 3300009148 Ga0105243_10007917 Ga0105243_100079179 224
325 3300009148 Ga0105243_10043161 Ga0105243_100431613 224
326 3300009551 Ga0105238_10493072 Ga0105238_104930721 224
327 3300010375 Ga0105239_10112239 Ga0105239_101122394 224
328 3300013100 Ga0157373_10040655 Ga0157373_100406552 224
329 3300013100 Ga0157373_10057206 Ga0157373_100572062 224
330 3300013100 Ga0157373_10116183 Ga0157373_101161832 224
331 3300013104 Ga0157370_10175048 Ga0157370_101750482 224
332 3300014497 Ga0182008_10000402 Ga0182008_1000040213 224
333 3300014497 Ga0182008_10009182 Ga0182008_100091829 224
334 3300014497 Ga0182008_10017647 Ga0182008_100176474 224
335 3300014497 Ga0182008_10022584 Ga0182008_100225843 224
336 3300014497 Ga0182008_10054161 Ga0182008_100541612 224
337 3300015261 Ga0182006_1005788 Ga0182006_10057885 224
338 3300015261 Ga0182006_1017099 Ga0182006_10170992 224
339 3300015261 Ga0182006_1043408 Ga0182006_10434082 224
340 3300015262 Ga0182007_10001457 Ga0182007_100014574 224
341 3300015262 Ga0182007_10042573 Ga0182007_100425732 224
342 3300015265 Ga0182005_1037957 Ga0182005_10379571 224
343 3300017792 Ga0163161_10000128 Ga0163161_1000012858 224
344 3300017792 Ga0163161_10009175 Ga0163161_100091759 224
345 3300017792 Ga0163161_10009688 Ga0163161_100096882 224
346 3300025208 Ga0209436_100670 Ga0209436_10067026 224
347 3300025208 Ga0209436_101842 Ga0209436_1018422 224
348 3300025228 Ga0209672_100228 Ga0209672_10022811 224
349 3300025229 Ga0209147_100951 Ga0209147_1009512 224
350 3300025242 Ga0209258_100089 Ga0209258_100089123 224
351 3300025245 Ga0207425_1000103 Ga0207425_100010379 224
352 3300025245 Ga0207425_1002258 Ga0207425_10022588 224
353 3300025254 Ga0209148_1000097 Ga0209148_1000097123 224
354 3300025258 Ga0209129_1000033 Ga0209129_1000033209 224
355 3300025258 Ga0209129_1001321 Ga0209129_100132110 224
356 3300025258 Ga0209129_1003501 Ga0209129_10035016 224
357 3300025263 Ga0209565_1000120 Ga0209565_100012060 224
358 3300025263 Ga0209565_1000828 Ga0209565_100082811 224
359 3300025263 Ga0209565_1000980 Ga0209565_10009804 224
360 3300025273 Ga0209673_1000099 Ga0209673_1000099140 224
361 3300025273 Ga0209673_1000372 Ga0209673_100037279 224
362 3300025273 Ga0209673_1000899 Ga0209673_10008994 224
363 3300025273 Ga0209673_1003387 Ga0209673_10033876 224
364 3300025273 Ga0209673_1061417 Ga0209673_10614171 224
365 3300025284 Ga0209130_1000105 Ga0209130_100010528 224
366 3300025284 Ga0209130_1000615 Ga0209130_100061514 224
367 3300025284 Ga0209130_1014320 Ga0209130_10143202 224
368 3300025291 Ga0209675_1000054 Ga0209675_1000054140 224
369 3300025291 Ga0209675_1001018 Ga0209675_100101811 224
370 3300025291 Ga0209675_1001356 Ga0209675_100135611 224
371 3300025291 Ga0209675_1001425 Ga0209675_100142510 224
372 3300025291 Ga0209675_1001574 Ga0209675_10015749 224
373 3300025292 Ga0209676_1000179 Ga0209676_1000179138 224
374 3300025292 Ga0209676_1000260 Ga0209676_100026033 224
375 3300025292 Ga0209676_1000624 Ga0209676_100062459 224
376 3300025292 Ga0209676_1004929 Ga0209676_10049298 224
377 3300025292 Ga0209676_1013211 Ga0209676_10132111 224
378 3300025294 Ga0209025_1000221 Ga0209025_100022128 224
379 3300025294 Ga0209025_1001070 Ga0209025_100107031 224
380 3300025295 Ga0209564_1000151 Ga0209564_100015157 224
381 3300025295 Ga0209564_1000246 Ga0209564_100024647 224
382 3300025297 Ga0209758_1000027 Ga0209758_1000027209 224
383 3300025298 Ga0209050_1000172 Ga0209050_100017213 224
384 3300025298 Ga0209050_1002032 Ga0209050_10020325 224
385 3300025298 Ga0209050_1033034 Ga0209050_10330343 224
386 3300025299 Ga0209256_1000069 Ga0209256_1000069174 224
387 3300025299 Ga0209256_1000161 Ga0209256_100016195 224
388 3300025299 Ga0209256_1016707 Ga0209256_10167072 224
389 3300025302 Ga0207426_1000027 Ga0207426_1000027169 224
390 3300025302 Ga0207426_1000115 Ga0207426_100011512 224
391 3300025303 Ga0209051_1000046 Ga0209051_100004613 224
392 3300025303 Ga0209051_1000510 Ga0209051_100051036 224
393 3300025303 Ga0209051_1000971 Ga0209051_100097115 224
394 3300025303 Ga0209051_1001434 Ga0209051_100143414 224
395 3300025303 Ga0209051_1035370 Ga0209051_10353702 224
396 3300025304 Ga0209257_1000281 Ga0209257_100028194 224
397 3300025304 Ga0209257_1001146 Ga0209257_100114639 224
398 3300025304 Ga0209257_1002049 Ga0209257_100204914 224
399 3300025304 Ga0209257_1005096 Ga0209257_10050964 224
400 3300025304 Ga0209257_1009498 Ga0209257_10094982 224
401 3300025304 Ga0209257_1010979 Ga0209257_10109792 224
402 3300025728 Ga0207655_1000566 Ga0207655_100056620 224
403 3300025913 Ga0207695_10148608 Ga0207695_101486084 224
404 3300025923 Ga0207681_10006076 Ga0207681_100060762 224
405 3300025935 Ga0207709_10000230 Ga0207709_1000023020 224
406 3300025935 Ga0207709_10000240 Ga0207709_1000024033 224
407 3300025935 Ga0207709_10026881 Ga0207709_100268813 224
408 3300025940 Ga0207691_10116329 Ga0207691_101163293 224
409 3300025945 Ga0207679_10020913 Ga0207679_100209132 224
410 3300026041 Ga0207639_10263829 Ga0207639_102638292 224
411 3300026089 Ga0207648_10168389 Ga0207648_101683892 224
412 3300026116 Ga0207674_10240658 Ga0207674_102406583 224
413 3300026121 Ga0207683_10174422 Ga0207683_101744223 224
414 3300027666 Ga0209282_1000363 Ga0209282_100036322 224
415 3300027666 Ga0209282_1072160 Ga0209282_10721603 224
416 3300027907 Ga0207428_10059883 Ga0207428_100598836 224
417 3300027907 Ga0207428_10187346 Ga0207428_101873462 224
418 3300028380 Ga0268265_10031295 Ga0268265_100312953 224
419 3300028794 Ga0307515_10000873 Ga0307515_1000087345 224
420 3300030731 Ga0316177_1034265 Ga0316177_10342657 224
421 3300030732 Ga0316176_1042615 Ga0316176_10426152 224
422 3300030733 Ga0314311_1116647 Ga0314311_111664712 224
423 3300030735 Ga0316178_1000640 Ga0316178_10006405 224
424 3300030742 Ga0316183_1031412 Ga0316183_10314124 224
425 3300030744 Ga0316181_1174844 Ga0316181_11748447 224
426 3300030745 Ga0316182_1030208 Ga0316182_10302084 224
427 3300030745 Ga0316182_1275715 Ga0316182_12757152 224
428 3300031251 Ga0265327_10022834 Ga0265327_100228344 224
429 3300031456 Ga0307513_10373314 Ga0307513_103733141 224
430 3300031548 Ga0307408_100045670 Ga0307408_1000456702 224
431 3300031548 Ga0307408_100133327 Ga0307408_1001333274 224
432 3300031548 Ga0307408_100242291 Ga0307408_1002422912 224
433 3300031649 Ga0307514_10024218 Ga0307514_100242183 224
434 3300031649 Ga0307514_10081127 Ga0307514_100811274 224
435 3300031731 Ga0307405_10126957 Ga0307405_101269574 224
436 3300031824 Ga0307413_10188936 Ga0307413_101889362 224
437 3300031852 Ga0307410_10350223 Ga0307410_103502232 224
438 3300031901 Ga0307406_10000879 Ga0307406_1000087913 224
439 3300031901 Ga0307406_10087786 Ga0307406_100877864 224
440 3300031911 Ga0307412_10015706 Ga0307412_100157067 224
441 3300031911 Ga0307412_10026737 Ga0307412_100267374 224
442 3300031911 Ga0307412_10027258 Ga0307412_100272585 224
443 3300031911 Ga0307412_10040151 Ga0307412_100401513 224
444 3300031911 Ga0307412_10046588 Ga0307412_100465881 224
445 3300031911 Ga0307412_10098937 Ga0307412_100989372 224
446 3300031995 Ga0307409_100301056 Ga0307409_1003010561 224
447 3300031995 Ga0307409_100746536 Ga0307409_1007465361 224
448 3300032004 Ga0307414_10033284 Ga0307414_100332843 224
449 3300032005 Ga0307411_10013693 Ga0307411_100136934 224
450 3300032005 Ga0307411_10123898 Ga0307411_101238983 224
451 3300032005 Ga0307411_10249485 Ga0307411_102494852 224
452 3300032005 Ga0307411_10285033 Ga0307411_102850332 224
453 3300032005 Ga0307411_10533604 Ga0307411_105336042 224
454 3300041404 Ga0439436_0000149 Ga0439436_0000149_10796_11470 224
455 3300041404 Ga0439436_0011562 Ga0439436_0011562_1499_2173 224
456 3300041405 Ga0439438_018586 Ga0439438_018586_816_1490 224
457 3300041406 Ga0439439_0003522 Ga0439439_0003522_896_1570 224
458 3300041406 Ga0439439_0035663 Ga0439439_0035663_390_1064 224
459 3300041407 Ga0439447_028917 Ga0439447_028917_76_750 224
460 3300041407 Ga0439447_040751 Ga0439447_040751_390_1064 224
461 3300041410 Ga0439461_0071745 Ga0439461_0071745_13_687 224
462 3300041411 Ga0439466_0001330 Ga0439466_0001330_8900_9574 224
463 3300041411 Ga0439466_0014241 Ga0439466_0014241_296_970 224
464 3300041413 Ga0439465_0001529 Ga0439465_0001529_424_1098 224
465 3300041413 Ga0439465_0040635 Ga0439465_0040635_64_738 224
466 3300041498 Ga0451841_0947861 Ga0451841_0947861_426_1100 224
467 3300041512 Ga0451853_1974279 Ga0451853_1974279_28_702 224
468 3300041997 Ga0439431_0005212 Ga0439431_0005212_1805_2479 224
469 3300041999 Ga0439433_0000311 Ga0439433_0000311_3176_3850 224
470 3300041999 Ga0439433_0005036 Ga0439433_0005036_2072_2746 224
471 3300042002 Ga0439442_001752 Ga0439442_001752_2852_3526 224
472 3300042002 Ga0439442_004720 Ga0439442_004720_404_1078 224
473 3300042002 Ga0439442_008852 Ga0439442_008852_873_1547 224
474 3300042004 Ga0439445_0000796 Ga0439445_0000796_547_1221 224
475 3300042006 Ga0439432_000358 Ga0439432_000358_5447_6121 224
476 3300042006 Ga0439432_019701 Ga0439432_019701_1253_1927 224
477 3300042007 Ga0439449_0000747 Ga0439449_0000747_4078_4752 224
478 3300042007 Ga0439449_0002278 Ga0439449_0002278_957_1631 224
479 3300042007 Ga0439449_0003803 Ga0439449_0003803_2052_2726 224
480 3300042007 Ga0439449_0018677 Ga0439449_0018677_412_1086 224
481 3300042010 Ga0439452_001926 Ga0439452_001926_4795_5469 224
482 3300042010 Ga0439452_050866 Ga0439452_050866_197_871 224
483 3300042014 Ga0439457_008390 Ga0439457_008390_102_776 224
484 3300042015 Ga0439462_0026016 Ga0439462_0026016_52_726 224
485 3300042015 Ga0439462_0032418 Ga0439462_0032418_264_938 224
486 3300042125 Ga0450923_002236 Ga0450923_002236_1613_2287 224
487 3300042131 Ga0450894_006623 Ga0450894_006623_773_1447 224
488 3300042135 Ga0450899_008023 Ga0450899_008023_88_762 224
489 3300042146 Ga0450907_013564 Ga0450907_013564_644_1318 224
490 3300042156 Ga0439446_0044925 Ga0439446_0044925_33_707 224
491 3300042184 Ga0450908_001061 Ga0450908_001061_1733_2407 224
492 3300042184 Ga0450908_016540 Ga0450908_016540_419_1093 224
493 3300042435 Ga0439434_0000586 Ga0439434_0000586_5178_5852 224
494 3300042435 Ga0439434_0001272 Ga0439434_0001272_1921_2595 224
495 3300042531 Ga0450918_004239 Ga0450918_004239_1919_2593 224
496 3300042532 Ga0450893_0003843 Ga0450893_0003843_918_1592 224
497 3300046453 Ga0495627_023612 Ga0495627_023612_881_1555 224
498 3300046460 Ga0495638_0019806 Ga0495638_0019806_1230_1904 224
499 3300046463 Ga0495653_0424466 Ga0495653_0424466_80_754 224
500 3300046475 Ga0495639_0010958 Ga0495639_0010958_1646_2320 224
501 3300046513 Ga0495616_0016577 Ga0495616_0016577_2933_3607 224
502 3300046515 Ga0495620_0012903 Ga0495620_0012903_3088_3762 224
503 3300046516 Ga0495628_0529050 Ga0495628_0529050_46_720 224
504 3300046518 Ga0495631_0000148 Ga0495631_0000148_44725_45399 224
505 3300046520 Ga0495637_0028183 Ga0495637_0028183_210_884 224
506 3300046528 Ga0495642_0037633 Ga0495642_0037633_1173_1847 224
507 3300046530 Ga0495654_0005078 Ga0495654_0005078_2397_3071 224
508 3300046538 Ga0495609_0028927 Ga0495609_0028927_306_980 224
509 3300046558 Ga0495633_0292165 Ga0495633_0292165_55_729 224
510 3300046615 Ga0495656_0002670 Ga0495656_0002670_3014_3688 224
511 3300046660 Ga0495625_0000903 Ga0495625_0000903_17510_18184 224
512 3300046660 Ga0495625_0022259 Ga0495625_0022259_3487_4161 224
513 3300046660 Ga0495625_0225057 Ga0495625_0225057_314_1057 224
514 3300046663 Ga0495635_0095027 Ga0495635_0095027_637_1311 224
515 3300046663 Ga0495635_0251157 Ga0495635_0251157_429_1103 224
516 3300046664 Ga0495659_0138693 Ga0495659_0138693_139_813 224
517 3300046674 Ga0495588_0002276 Ga0495588_0002276_5712_6386 224
518 3300046674 Ga0495588_0036864 Ga0495588_0036864_801_1544 224
519 3300046674 Ga0495588_0195156 Ga0495588_0195156_334_1008 224
520 3300046683 Ga0495658_0037066 Ga0495658_0037066_1642_2316 224
521 3300046689 Ga0495613_0509117 Ga0495613_0509117_18_692 224
522 3300046691 Ga0495670_0229998 Ga0495670_0229998_210_884 224
523 3300046691 Ga0495670_0267401 Ga0495670_0267401_66_740 224
524 3300046692 Ga0495671_0001383 Ga0495671_0001383_9792_10535 224
525 3300047321 Ga0495676_0001292 Ga0495676_0001292_3409_4083 224
526 3300047673 Ga0495593_0000578 Ga0495593_0000578_11877_12551 224
527 3300048088 Ga0495602_0141253 Ga0495602_0141253_1047_1721 224
528 3300048089 Ga0495614_0001794 Ga0495614_0001794_3030_3704 224
529 3300048904 Ga0496101_0023790 Ga0496101_0023790_3385_4059 224
530 3300048905 Ga0496102_0155753 Ga0496102_0155753_983_1666 224
531 3300048905 Ga0496102_0270273 Ga0496102_0270273_287_961 224
532 3300048910 Ga0496107_0150347 Ga0496107_0150347_1017_1691 224
533 3300048911 Ga0496108_0170086 Ga0496108_0170086_331_1005 224
534 3300048913 Ga0496110_0082431 Ga0496110_0082431_2142_2816 224
535 3300048917 Ga0496114_0039195 Ga0496114_0039195_1463_2389 224
536 3300048919 Ga0496116_0039170 Ga0496116_0039170_404_1078 224
537 3300048920 Ga0496117_0012358 Ga0496117_0012358_2930_3604 224
538 3300048920 Ga0496117_0112717 Ga0496117_0112717_459_1133 224
539 3300048920 Ga0496117_0117653 Ga0496117_0117653_37_711 224
540 3300048921 Ga0496118_0002760 Ga0496118_0002760_19274_19948 224
541 3300048921 Ga0496118_0161890 Ga0496118_0161890_383_1057 224
542 3300048924 Ga0496121_0028535 Ga0496121_0028535_2932_3606 224
543 3300048924 Ga0496121_0058405 Ga0496121_0058405_1339_2013 224
544 3300048925 Ga0496122_0001128 Ga0496122_0001128_269_943 224
545 3300048925 Ga0496122_0044805 Ga0496122_0044805_2051_2725 224
546 3300048925 Ga0496122_0160716 Ga0496122_0160716_22_696 224
547 3300048925 Ga0496122_0239576 Ga0496122_0239576_269_943 224
548 3300048926 Ga0496123_0000181 Ga0496123_0000181_81526_82200 224
549 3300048926 Ga0496123_0041868 Ga0496123_0041868_864_1538 224
550 3300048926 Ga0496123_0154222 Ga0496123_0154222_240_1007 224
551 3300048927 Ga0496124_0022862 Ga0496124_0022862_959_1633 224
552 3300048927 Ga0496124_0093615 Ga0496124_0093615_1637_2311 224
553 3300048927 Ga0496124_0125894 Ga0496124_0125894_1124_1798 224
554 3300048927 Ga0496124_0217019 Ga0496124_0217019_544_1218 224
555 3300048928 Ga0496125_0017195 Ga0496125_0017195_1923_2597 224
556 3300048928 Ga0496125_0028367 Ga0496125_0028367_230_904 224
557 3300048928 Ga0496125_0152447 Ga0496125_0152447_865_1539 224
558 3300049580 Ga0501046_0031629 Ga0501046_0031629_2930_3607 224
559 3300049671 Ga0501238_016804 Ga0501238_016804_130_804 224
560 3300049679 Ga0501249_001551 Ga0501249_001551_2972_3646 224
561 3300049705 Ga0501225_0008697 Ga0501225_0008697_2172_2846 224
562 3300049759 Ga0501262_000112 Ga0501262_000112_7131_7805 224
563 3300050489 nmdc:mga03683_33652_c1 nmdc:mga03683_33652_c1_1288_1962 224
564 3300050489 nmdc:mga03683_70124_c1 nmdc:mga03683_70124_c1_260_934 224
565 3300050489 nmdc:mga03683_752_c1 nmdc:mga03683_752_c1_6160_6834 224
566 3300050490 nmdc:mga03n38_1379_c1 nmdc:mga03n38_1379_c1_5183_5857 224
567 3300050490 nmdc:mga03n38_30849_c1 nmdc:mga03n38_30849_c1_1370_2044 224
568 3300050490 nmdc:mga03n38_9578_c1 nmdc:mga03n38_9578_c1_1976_2650 224
569 3300050491 nmdc:mga00v17_2845_c1 nmdc:mga00v17_2845_c1_4975_5649 224
570 3300050492 nmdc:mga0yw44_74287_c1 nmdc:mga0yw44_74287_c1_738_1412 224
571 3300050493 nmdc:mga0k408_135006_c1 nmdc:mga0k408_135006_c1_115_789 224
572 3300050493 nmdc:mga0k408_2591_c1 nmdc:mga0k408_2591_c1_2338_3012 224
573 3300050493 nmdc:mga0k408_28362_c1 nmdc:mga0k408_28362_c1_1422_2096 224
574 3300050493 nmdc:mga0k408_6140_c1 nmdc:mga0k408_6140_c1_2871_3545 224
575 3300050493 nmdc:mga0k408_72840_c1 nmdc:mga0k408_72840_c1_570_1244 224
576 3300050493 nmdc:mga0k408_7671_c1 nmdc:mga0k408_7671_c1_3897_4571 224
577 3300050494 nmdc:mga06z11_13020_c1 nmdc:mga06z11_13020_c1_581_1255 224
578 3300050494 nmdc:mga06z11_62348_c1 nmdc:mga06z11_62348_c1_173_847 224
579 3300050496 nmdc:mga07m45_12572_c1 nmdc:mga07m45_12572_c1_1963_2637 224
580 3300050496 nmdc:mga07m45_2915_c1 nmdc:mga07m45_2915_c1_4184_4858 224
581 3300050496 nmdc:mga07m45_3013_c1 nmdc:mga07m45_3013_c1_10_684 224
582 3300050496 nmdc:mga07m45_498_c1 nmdc:mga07m45_498_c1_9651_10325 224
583 3300050496 nmdc:mga07m45_53795_c1 nmdc:mga07m45_53795_c1_1513_2187 224
584 3300050496 nmdc:mga07m45_7161_c1 nmdc:mga07m45_7161_c1_3011_3685 224
585 3300053078 Ga0495612_0170558 Ga0495612_0170558_45_719 224
586 3300053079 Ga0500610_0000149 Ga0500610_0000149_17934_18608 224
587 3300053079 Ga0500610_0005255 Ga0500610_0005255_2551_3294 224
588 3300053079 Ga0500610_0135146 Ga0500610_0135146_381_1055 224
589 3300053087 Ga0500643_004014 Ga0500643_004014_2447_3121 224
590 3300053090 Ga0500646_0016751 Ga0500646_0016751_930_1604 224
591 3300053093 Ga0500651_0000024 Ga0500651_0000024_30655_31329 224
592 3300053094 Ga0500566_0047185 Ga0500566_0047185_356_1030 224
593 3300053108 Ga0500562_017634 Ga0500562_017634_156_830 224
594 3300053110 Ga0500571_000051 Ga0500571_000051_13236_13910 224
595 3300053120 Ga0500597_053869 Ga0500597_053869_626_1300 224
596 3300053121 Ga0500607_002042 Ga0500607_002042_14137_14880 224
597 3300053121 Ga0500607_017152 Ga0500607_017152_2094_2768 224
598 3300053122 Ga0500608_003424 Ga0500608_003424_2110_2784 224
599 3300053122 Ga0500608_009837 Ga0500608_009837_1664_2338 224
600 3300053122 Ga0500608_067123 Ga0500608_067123_537_1211 224
601 3300053133 Ga0500655_003408 Ga0500655_003408_1685_2359 224
602 3300053134 Ga0500658_0005611 Ga0500658_0005611_2062_2736 224
603 3300053134 Ga0500658_0013366 Ga0500658_0013366_2059_2733 224
604 3300053136 Ga0500559_0004532 Ga0500559_0004532_2644_3318 224
605 3300053136 Ga0500559_0006010 Ga0500559_0006010_4636_5310 224
606 3300053138 Ga0500564_013046 Ga0500564_013046_540_1214 224
607 3300053139 Ga0500568_0001905 Ga0500568_0001905_3179_3853 224
608 3300053140 Ga0500573_0148125 Ga0500573_0148125_336_1010 224
609 3300053141 Ga0500574_000143 Ga0500574_000143_539_1213 224
610 3300053153 Ga0500616_0016282 Ga0500616_0016282_732_1406 224
611 3300053158 Ga0500627_0011457 Ga0500627_0011457_2251_2994 224
612 3300053160 Ga0500633_0029813 Ga0500633_0029813_1047_1721 224
613 3300053161 Ga0500634_0039947 Ga0500634_0039947_1028_1702 224
614 3300053734 Ga0500565_004108 Ga0500565_004108_489_1163 224
615 3300053735 Ga0500596_012331 Ga0500596_012331_344_1018 224
616 iso_pu_bacteria 2738543013 2739249802 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

50

255

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.8081 3 213
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.7993 3 213
6cni-assembly1.cif.gz_B crystal structure of h105a pgam5 dimer 0.7986 2 224
6cni-assembly1.cif.gz_A crystal structure of h105a pgam5 dimer 0.7734 2 224
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.7732 1 213
ID Description Score Start End Superfamily
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8109 3 210 3.40.50.1240
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.7829 3 210 3.40.50.1240
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.7823 1 213 3.40.50.1240
af_F4KI56_14_225_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.7821 2 212 3.40.50.1240
af_P45565_56_188_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.7743 5 175 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A5C7N5W8-F1-model_v4 deleted 0.9792 1 198
AF-A0A1M3JUM3-F1-model_v4 deleted 0.9775 45 224
AF-A0A5C7N5W8-F1-model_v4 deleted 0.9743 1 198
AF-A0A1M3JUM3-F1-model_v4 deleted 0.9722 45 224
AF-A0A2M8EAY5-F1-model_v4 Histidine phosphatase family protein 0.9702 1 224

Feature Viewer

pLDDT pTM Quality
92.23 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map