F469369

General Info

Members Datasets Scaffolds Average Seq Length
614 367 614 215

Family's Representative Sequence

Representative Sequence 3300039110|Ga0400487_24701|Ga0400487_24701_506_1120
Length 204
Sequence MEEVLDVYTQPHDPKKPLVCLDESSKQLVSETRTPLPRQPQRVDYEYERNGTANMFMLFAPLEGWRHVEVTDRRTAIDYAHILKDLSDVHFPHAKKIVLVQDNLNTHVKASLYEAFPPAEARRLAERFEWHYTPKHGSWLNMAESELGLLSTQCLDRRIPDKDSLTKEVAAWQDERNTNQTKANWRFTTDDARIKLKHLYPQFE

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
96 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
97 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
98 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028010 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
183 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
184 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
185 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
186 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
187 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
188 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
191 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
194 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
195 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
196 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
213 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
214 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
215 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
216 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
224 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
229 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
230 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
231 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
232 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
233 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
238 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
239 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
240 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
241 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
242 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
249 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
262 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
263 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
264 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
265 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
266 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
267 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
268 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
269 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
272 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
273 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
276 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
277 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
278 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
279 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
280 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
281 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
285 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
286 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
287 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
290 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
291 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
292 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
293 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
294 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
297 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
298 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
303 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
306 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
307 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
308 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
309 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
315 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
316 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
317 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
318 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
319 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
320 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
321 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
322 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
323 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
326 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
338 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
339 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
344 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
345 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
346 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
347 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
348 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
349 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
352 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
359 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
360 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
361 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
362 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
363 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
364 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
365 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
366 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
367 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 5.37
Rhizosphere 91.53
Stem 0
Stem Tuber 0
Unclassified 2.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1009304 3300000546 Unclassified 1052
2 LJQas_1007314 3300000549 Bacteria 1358
3 JGI24752J21851_1009895 3300001976 Bacteria 1244
4 JGI24747J21853_1004312 3300001978 Bacteria 1270
5 JGI24740J21852_10045097 3300001979 Bacteria 1303
6 JGI24740J21852_10075945 3300001979 Bacteria 889
7 JGI24737J22298_10052276 3300001990 Bacteria 1239
8 JGI24750J21931_1009827 3300002070 Bacteria 1238
9 JGI24750J21931_1016975 3300002070 Bacteria 992
10 JGI24748J21848_1007540 3300002074 Bacteria 1276
11 JGI24749J21850_1011151 3300002076 Bacteria 1261
12 JGI24034J26672_10012414 3300002239 Bacteria 1283
13 JGI24751J29686_10024765 3300002459 Bacteria 1245
14 Ga0065712_10294727 3300005290 Bacteria 871
15 Ga0070690_100193408 3300005330 Bacteria 1412
16 Ga0070690_100217625 3300005330 Bacteria 1337
17 Ga0070670_100277965 3300005331 Bacteria 1462
18 Ga0070677_10088984 3300005333 Bacteria 1339
19 Ga0068869_100294918 3300005334 Bacteria 1308
20 Ga0070666_10217953 3300005335 Bacteria 1345
21 Ga0070682_100130815 3300005337 Bacteria 1698
22 Ga0070682_100217197 3300005337 Bacteria 1358
23 Ga0068868_100298528 3300005338 Bacteria 1368
24 Ga0068868_100672923 3300005338 Bacteria 923
25 Ga0070689_100194321 3300005340 Unclassified 1653
26 Ga0070689_100428101 3300005340 Bacteria 1123
27 Ga0070692_10024795 3300005345 Bacteria 2952
28 Ga0070692_10274236 3300005345 Bacteria 1020
29 Ga0070668_100181686 3300005347 Bacteria 1718
30 Ga0070668_100305387 3300005347 Bacteria 1335
31 Ga0070669_100161499 3300005353 Bacteria 1741
32 Ga0070669_100169988 3300005353 Bacteria 1699
33 Ga0070669_100219479 3300005353 Unclassified 1503
34 Ga0070675_100231302 3300005354 Bacteria 1613
35 Ga0070675_100261716 3300005354 Bacteria 1516
36 Ga0070671_100209000 3300005355 Bacteria 1655
37 Ga0070674_100156992 3300005356 Bacteria 1722
38 Ga0070674_100236618 3300005356 Bacteria 1428
39 Ga0070673_100234245 3300005364 Bacteria 1594
40 Ga0070688_100150405 3300005365 Bacteria 1591
41 Ga0070667_100256829 3300005367 Bacteria 1563
42 Ga0070703_10055876 3300005406 Bacteria 1276
43 Ga0070709_10163286 3300005434 Bacteria 1550
44 Ga0070714_100267764 3300005435 Bacteria 1584
45 Ga0070714_100298437 3300005435 Bacteria 1501
46 Ga0070713_100220181 3300005436 Bacteria 1721
47 Ga0070713_100245247 3300005436 Bacteria 1632
48 Ga0070713_100546207 3300005436 Bacteria 1097
49 Ga0070710_10055173 3300005437 Bacteria 2244
50 Ga0070710_10234253 3300005437 Bacteria 1173
51 Ga0070701_10228335 3300005438 Bacteria 1114
52 Ga0070711_100172050 3300005439 Bacteria 1651
53 Ga0070705_100031342 3300005440 Bacteria 2943
54 Ga0070700_100023878 3300005441 Bacteria 3582
55 Ga0070700_100188483 3300005441 Bacteria 1440
56 Ga0070700_100275602 3300005441 Bacteria 1217
57 Ga0070694_100060592 3300005444 Bacteria 2581
58 Ga0070663_100211000 3300005455 Bacteria 1520
59 Ga0070663_100240531 3300005455 Bacteria 1428
60 Ga0070678_100225253 3300005456 Bacteria 1560
61 Ga0070662_100235103 3300005457 Bacteria 1468
62 Ga0070685_10129047 3300005466 Bacteria 1579
63 Ga0070707_100313956 3300005468 Bacteria 1523
64 Ga0070698_100251229 3300005471 Bacteria 1701
65 Ga0070679_100873568 3300005530 Bacteria 843
66 Ga0070684_100405804 3300005535 Bacteria 1257
67 Ga0070684_100413724 3300005535 Bacteria 1244
68 Ga0070697_100258454 3300005536 Bacteria 1490
69 Ga0070697_100280060 3300005536 Archaea 1431
70 Ga0070697_100379988 3300005536 Bacteria 1223
71 Ga0070672_100070100 3300005543 Bacteria 2785
72 Ga0070672_100261161 3300005543 Bacteria 1460
73 Ga0070686_100159854 3300005544 Bacteria 1586
74 Ga0070695_100170794 3300005545 Bacteria 1534
75 Ga0070695_100242763 3300005545 Bacteria 1307
76 Ga0070696_100194093 3300005546 Bacteria 1512
77 Ga0070693_100167707 3300005547 Bacteria 1404
78 Ga0070693_100466283 3300005547 Bacteria 889
79 Ga0070665_100289366 3300005548 Bacteria 1641
80 Ga0070704_100155223 3300005549 Bacteria 1804
81 Ga0070704_100296973 3300005549 Bacteria 1344
82 Ga0068855_100488395 3300005563 Bacteria 1340
83 Ga0070664_100319217 3300005564 Bacteria 1407
84 Ga0068852_100393599 3300005616 Bacteria 1362
85 Ga0068852_100395882 3300005616 Bacteria 1358
86 Ga0068859_100324887 3300005617 Unclassified 1632
87 Ga0068859_100552542 3300005617 Bacteria 1246
88 Ga0068864_100208528 3300005618 Unclassified 1798
89 Ga0068866_10152531 3300005718 Bacteria 1339
90 Ga0068866_10181645 3300005718 Unclassified 1243
91 Ga0068861_100284716 3300005719 Bacteria 1425
92 Ga0068863_100191117 3300005841 Bacteria 1967
93 Ga0068858_100221104 3300005842 Bacteria 1793
94 Ga0068860_100425567 3300005843 Bacteria 1317
95 Ga0068862_100027192 3300005844 Bacteria 4814
96 Ga0068862_100253538 3300005844 Bacteria 1604
97 Ga0070717_10409791 3300006028 Bacteria 1218
98 Ga0075432_10062319 3300006058 Bacteria 1329
99 Ga0070715_10015266 3300006163 Bacteria 2860
100 Ga0070715_10019689 3300006163 Bacteria 2593
101 Ga0070716_100181104 3300006173 Bacteria 1383
102 Ga0070716_100201034 3300006173 Archaea 1325
103 Ga0070712_100062090 3300006175 Bacteria 2641
104 Ga0070712_100208698 3300006175 Bacteria 1539
105 Ga0097621_100158145 3300006237 Bacteria 1946
106 Ga0097621_100310672 3300006237 Bacteria 1394
107 Ga0075428_100415815 3300006844 Bacteria 1441
108 Ga0075433_10264528 3300006852 Bacteria 1524
109 Ga0075434_100315336 3300006871 Bacteria 1584
110 Ga0075434_100959759 3300006871 Bacteria 869
111 Ga0068865_100220841 3300006881 Bacteria 1481
112 Ga0068865_100311559 3300006881 Unclassified 1263
113 Ga0075436_100195398 3300006914 Bacteria 1432
114 Ga0097620_100324888 3300006931 Unclassified 1632
115 Ga0097620_100552583 3300006931 Bacteria 1246
116 Ga0075435_100436849 3300007076 Bacteria 1128
117 Ga0075435_100456980 3300007076 Bacteria 1101
118 Ga0105251_10098993 3300009011 Bacteria 1334
119 Ga0105250_10087988 3300009092 Bacteria 1262
120 Ga0105250_10138994 3300009092 Bacteria 1006
121 Ga0111539_10285824 3300009094 Bacteria 1919
122 Ga0105245_10322718 3300009098 Unclassified 1522
123 Ga0105245_10567452 3300009098 Bacteria 1158
124 Ga0105247_10033007 3300009101 Bacteria 3147
125 Ga0105247_10116606 3300009101 Bacteria 1725
126 Ga0114129_10565235 3300009147 Bacteria 1477
127 Ga0105243_10265603 3300009148 Bacteria 1539
128 Ga0105243_10278903 3300009148 Bacteria 1504
129 Ga0105241_10217583 3300009174 Bacteria 1604
130 Ga0105242_10240038 3300009176 Bacteria 1629
131 Ga0105248_10303889 3300009177 Bacteria 1797
132 Ga0105248_10396003 3300009177 Bacteria 1555
133 Ga0105237_10264209 3300009545 Bacteria 1724
134 Ga0105237_10396527 3300009545 Bacteria 1385
135 Ga0105249_10385989 3300009553 Bacteria 1427
136 Ga0105249_10580693 3300009553 Bacteria 1174
137 Ga0105249_10612581 3300009553 Bacteria 1144
138 Ga0099796_10012658 3300010159 Bacteria 2389
139 Ga0099796_10022297 3300010159 Bacteria 1963
140 Ga0105239_10429473 3300010375 Bacteria 1497
141 Ga0105246_10187061 3300011119 Bacteria 1600
142 Ga0105246_10187182 3300011119 Bacteria 1599
143 Ga0157320_1001347 3300012481 Bacteria 1224
144 Ga0157343_1000873 3300012488 Bacteria 1340
145 Ga0157316_1001838 3300012510 Bacteria 1376
146 Ga0157326_1010575 3300012513 Bacteria 1030
147 Ga0157374_10200761 3300013296 Bacteria 1953
148 Ga0157374_10263104 3300013296 Unclassified 1699
149 Ga0157374_10578398 3300013296 Bacteria 1132
150 Ga0157378_10563393 3300013297 Bacteria 1146
151 Ga0163162_10249083 3300013306 Bacteria 1908
152 Ga0163162_10268317 3300013306 Bacteria 1838
153 Ga0163162_10437613 3300013306 Bacteria 1440
154 Ga0163162_10658270 3300013306 Bacteria 1171
155 Ga0157372_10439307 3300013307 Bacteria 1521
156 Ga0157372_10926613 3300013307 Bacteria 1010
157 Ga0157375_10314880 3300013308 Bacteria 1729
158 Ga0163163_10128834 3300014325 Bacteria 2570
159 Ga0163163_10228568 3300014325 Bacteria 1909
160 Ga0157380_10110803 3300014326 Bacteria 2306
161 Ga0157380_10196395 3300014326 Bacteria 1786
162 Ga0157380_10516755 3300014326 Bacteria 1164
163 Ga0157380_10676164 3300014326 Bacteria 1034
164 Ga0182008_10102012 3300014497 Bacteria 1419
165 Ga0182008_10242430 3300014497 Bacteria 928
166 Ga0157377_10114385 3300014745 Bacteria 1626
167 Ga0157379_10257689 3300014968 Bacteria 1584
168 Ga0157379_10721234 3300014968 Bacteria 937
169 Ga0157376_10248628 3300014969 Bacteria 1660
170 Ga0157376_10411209 3300014969 Bacteria 1310
171 Ga0157376_11044013 3300014969 Bacteria 841
172 Ga0163161_10089097 3300017792 Bacteria 2282
173 Ga0163161_10170915 3300017792 Bacteria 1662
174 Ga0213873_10012241 3300021358 Bacteria 1856
175 Ga0213873_10022256 3300021358 Bacteria 1499
176 Ga0213873_10033300 3300021358 Bacteria 1292
177 Ga0213872_10063787 3300021361 Unclassified 1664
178 Ga0213872_10249431 3300021361 Bacteria 748
179 Ga0207713_1072129 3300025735 Bacteria 1272
180 Ga0207653_10056752 3300025885 Bacteria 1314
181 Ga0207682_10097559 3300025893 Bacteria 1281
182 Ga0207682_10104383 3300025893 Bacteria 1242
183 Ga0207692_10163331 3300025898 Bacteria 1285
184 Ga0207692_10217377 3300025898 Bacteria 1131
185 Ga0207642_10086400 3300025899 Bacteria 1537
186 Ga0207642_10140908 3300025899 Bacteria 1271
187 Ga0207710_10106923 3300025900 Bacteria 1325
188 Ga0207710_10112140 3300025900 Bacteria 1296
189 Ga0207710_10244669 3300025900 Bacteria 896
190 Ga0207647_10161445 3300025904 Bacteria 1307
191 Ga0207685_10087709 3300025905 Bacteria 1303
192 Ga0207685_10096525 3300025905 Bacteria 1256
193 Ga0207685_10103049 3300025905 Bacteria 1224
194 Ga0207699_10224717 3300025906 Unclassified 1283
195 Ga0207699_10230211 3300025906 Bacteria 1269
196 Ga0207699_10233244 3300025906 Bacteria 1261
197 Ga0207699_10389649 3300025906 Bacteria 990
198 Ga0207645_10314941 3300025907 Bacteria 1043
199 Ga0207684_10154788 3300025910 Bacteria 1973
200 Ga0207654_10193646 3300025911 Bacteria 1334
201 Ga0207654_10210502 3300025911 Bacteria 1285
202 Ga0207693_10169099 3300025915 Bacteria 1721
203 Ga0207693_10277112 3300025915 Bacteria 1314
204 Ga0207663_10082828 3300025916 Bacteria 2106
205 Ga0207663_10274476 3300025916 Bacteria 1250
206 Ga0207663_10495711 3300025916 Bacteria 948
207 Ga0207660_10260174 3300025917 Bacteria 1372
208 Ga0207662_10204676 3300025918 Bacteria 1279
209 Ga0207657_10235849 3300025919 Bacteria 1462
210 Ga0207649_10039942 3300025920 Bacteria 2848
211 Ga0207652_10163267 3300025921 Bacteria 1997
212 Ga0207646_10261174 3300025922 Unclassified 1565
213 Ga0207681_10116371 3300025923 Bacteria 1953
214 Ga0207681_10253657 3300025923 Bacteria 1374
215 Ga0207694_10233380 3300025924 Bacteria 1503
216 Ga0207694_10724396 3300025924 Bacteria 839
217 Ga0207659_10281713 3300025926 Bacteria 1359
218 Ga0207687_10355214 3300025927 Bacteria 1195
219 Ga0207700_10143121 3300025928 Bacteria 1967
220 Ga0207700_10426129 3300025928 Bacteria 1166
221 Ga0207664_10376771 3300025929 Bacteria 1259
222 Ga0207664_10510954 3300025929 Bacteria 1076
223 Ga0207644_10300427 3300025931 Bacteria 1293
224 Ga0207706_10101252 3300025933 Bacteria 2534
225 Ga0207706_10235540 3300025933 Bacteria 1601
226 Ga0207686_10182737 3300025934 Bacteria 1488
227 Ga0207709_10160434 3300025935 Bacteria 1568
228 Ga0207709_10245944 3300025935 Bacteria 1304
229 Ga0207670_10117211 3300025936 Bacteria 1929
230 Ga0207670_10679840 3300025936 Bacteria 851
231 Ga0207669_10073704 3300025937 Bacteria 2155
232 Ga0207665_10096435 3300025939 Bacteria 2057
233 Ga0207711_10397443 3300025941 Bacteria 1280
234 Ga0207689_10071181 3300025942 Bacteria 2856
235 Ga0207689_10406533 3300025942 Bacteria 1135
236 Ga0207661_10270516 3300025944 Bacteria 1516
237 Ga0207651_10301483 3300025960 Bacteria 1332
238 Ga0207712_10511526 3300025961 Bacteria 1028
239 Ga0207712_10521189 3300025961 Bacteria 1019
240 Ga0207668_10329638 3300025972 Bacteria 1269
241 Ga0207677_10268314 3300026023 Unclassified 1395
242 Ga0207703_10388540 3300026035 Bacteria 1292
243 Ga0207703_10544164 3300026035 Bacteria 1094
244 Ga0207639_10378727 3300026041 Bacteria 1270
245 Ga0207678_10235817 3300026067 Bacteria 1567
246 Ga0207678_10260133 3300026067 Bacteria 1487
247 Ga0207708_10059501 3300026075 Bacteria 2916
248 Ga0207708_10204450 3300026075 Bacteria 1576
249 Ga0207702_10429796 3300026078 Bacteria 1278
250 Ga0207641_10427368 3300026088 Bacteria 1276
251 Ga0207641_10725845 3300026088 Bacteria 980
252 Ga0207648_10206057 3300026089 Bacteria 1745
253 Ga0207676_10403808 3300026095 Bacteria 1277
254 Ga0207674_10219735 3300026116 Bacteria 1848
255 Ga0207675_100155502 3300026118 Bacteria 2179
256 Ga0207675_100247816 3300026118 Bacteria 1723
257 Ga0207675_100422079 3300026118 Bacteria 1317
258 Ga0207698_10377879 3300026142 Bacteria 1347
259 Ga0207698_10662909 3300026142 Bacteria 1035
260 Ga0209179_1005664 3300027512 Bacteria 1970
261 Ga0207428_10236502 3300027907 Bacteria 1366
262 Ga0207428_10274467 3300027907 Bacteria 1253
263 Ga0207428_10275807 3300027907 Bacteria 1249
264 Ga0265358_100363 3300028010 Bacteria 1079
265 Ga0268266_10408129 3300028379 Bacteria 1285
266 Ga0268265_10253029 3300028380 Bacteria 1561
267 Ga0268265_10544471 3300028380 Bacteria 1101
268 Ga0268265_10575630 3300028380 Bacteria 1072
269 Ga0268264_10345921 3300028381 Bacteria 1414
270 Ga0265338_10268663 3300028800 Bacteria 1250
271 Ga0265762_1011759 3300030760 Bacteria 1565
272 Ga0265763_1005294 3300030763 Bacteria 1080
273 Ga0265773_1001105 3300031018 Bacteria 1358
274 Ga0265760_10030744 3300031090 Bacteria 1582
275 Ga0265760_10047742 3300031090 Bacteria 1286
276 Ga0265332_10069819 3300031238 Bacteria 1497
277 Ga0265329_10032896 3300031242 Bacteria 1679
278 Ga0265339_10186939 3300031249 Bacteria 1029
279 Ga0265331_10092924 3300031250 Bacteria 1393
280 Ga0265327_10105138 3300031251 Unclassified 1356
281 Ga0265316_10054843 3300031344 Bacteria 3119
282 Ga0265314_10111864 3300031711 Bacteria 1734
283 Ga0316583_10024255 3300032133 Bacteria 2166
284 Ga0373930_0015479 3300034816 Bacteria 1432
285 Ga0373930_0017154 3300034816 Bacteria 1377
286 Ga0373948_0016294 3300034817 Bacteria 1372
287 Ga0373948_0018967 3300034817 Bacteria 1296
288 Ga0373950_0012908 3300034818 Bacteria 1387
289 Ga0373950_0013245 3300034818 Bacteria 1372
290 Ga0373958_0018183 3300034819 Bacteria 1271
291 Ga0373959_0010516 3300034820 Bacteria 1617
292 Ga0373938_0002013 3300034957 Bacteria 3253
293 Ga0373926_0047951 3300035083 Bacteria 1535
294 Ga0373926_0057683 3300035083 Bacteria 1410
295 Ga0373928_0015895 3300035084 Bacteria 1535
296 Ga0373929_0020446 3300035085 Bacteria 1334
297 Ga0373934_0071003 3300035086 Bacteria 1392
298 Ga0373940_0004593 3300035088 Bacteria 2928
299 Ga0373940_0041201 3300035088 Unclassified 1269
300 Ga0373944_0092442 3300035089 Bacteria 1012
301 Ga0373949_0007543 3300035090 Bacteria 2382
302 Ga0373949_0022060 3300035090 Bacteria 1465
303 Ga0373951_0030647 3300035091 Bacteria 1266
304 Ga0373952_0018771 3300035092 Bacteria 1433
305 Ga0373952_0023655 3300035092 Bacteria 1314
306 Ga0373923_0141262 3300035111 Bacteria 1088
307 Ga0373923_0175266 3300035111 Unclassified 983
308 Ga0373932_0004499 3300035112 Bacteria 3292
309 Ga0373932_0061720 3300035112 Bacteria 1141
310 Ga0373936_0091987 3300035113 Bacteria 1272
311 Ga0373936_0103750 3300035113 Bacteria 1201
312 Ga0373939_0032079 3300035114 Bacteria 1523
313 Ga0373939_0070210 3300035114 Bacteria 1138
314 Ga0373939_0163206 3300035114 Bacteria 819
315 Ga0373941_0038987 3300035115 Bacteria 1457
316 Ga0373945_0075038 3300035116 Bacteria 1286
317 Ga0373945_0106709 3300035116 Bacteria 1101
318 Ga0373953_0048086 3300035117 Bacteria 1717
319 Ga0373953_0332699 3300035117 Bacteria 664
320 Ga0373954_0016753 3300035118 Bacteria 3285
321 Ga0373954_0065360 3300035118 Bacteria 1721
322 Ga0373954_0105389 3300035118 Unclassified 1361
323 Ga0373954_0116609 3300035118 Bacteria 1294
324 Ga0373954_0151850 3300035118 Bacteria 1131
325 Ga0373956_0122396 3300035119 Bacteria 1215
326 Ga0373956_0124805 3300035119 Bacteria 1203
327 Ga0373956_0166860 3300035119 Unclassified 1038
328 Ga0373957_0082945 3300035120 Bacteria 1267
329 Ga0373957_0117767 3300035120 Bacteria 1073
330 Ga0373957_0128075 3300035120 Unclassified 1031
331 Ga0373957_0136479 3300035120 Bacteria 1001
332 Ga0373960_0029905 3300035121 Bacteria 1513
333 Ga0373960_0056940 3300035121 Bacteria 1175
334 Ga0373943_0128790 3300035170 Bacteria 1352
335 Ga0373943_0140078 3300035170 Bacteria 1302
336 Ga0373943_0197320 3300035170 Unclassified 1112
337 Ga0373943_0283310 3300035170 Bacteria 937
338 Ga0373943_0357715 3300035170 Unclassified 838
339 Ga0373943_0557723 3300035170 Bacteria 672
340 Ga0373946_0051273 3300035171 Bacteria 1726
341 Ga0373946_0115994 3300035171 Bacteria 1217
342 Ga0373955_0099827 3300035172 Bacteria 1664
343 Ga0373955_0205021 3300035172 Bacteria 1174
344 Ga0373955_0234417 3300035172 Bacteria 1098
345 Ga0373955_0344107 3300035172 Unclassified 902
346 Ga0373942_0005145 3300035207 Bacteria 3030
347 Ga0373942_0021769 3300035207 Bacteria 1620
348 Ga0373961_0035680 3300035241 Bacteria 1412
349 Ga0373962_0038023 3300035242 Bacteria 1345
350 Ga0316574_0169693 3300035398 Bacteria 1405
351 Ga0373924_0054798 3300035410 Bacteria 1658
352 Ga0373924_0055860 3300035410 Bacteria 1643
353 Ga0373931_0115407 3300035691 Bacteria 1528
354 Ga0373931_0144663 3300035691 Bacteria 1380
355 Ga0373931_0265719 3300035691 Bacteria 1048
356 Ga0373935_0344782 3300035692 Bacteria 1061
357 Ga0373935_0586405 3300035692 Bacteria 814
358 Ga0373927_0038780 3300035695 Bacteria 3092
359 Ga0373933_0057667 3300035724 Bacteria 2334
360 Ga0373933_0062968 3300035724 Bacteria 2241
361 Ga0373933_0104883 3300035724 Bacteria 1757
362 Ga0373933_0116994 3300035724 Bacteria 1666
363 Ga0373933_0201601 3300035724 Unclassified 1273
364 Ga0373933_0228993 3300035724 Bacteria 1193
365 Ga0373947_0124599 3300035725 Bacteria 1639
366 Ga0373947_0175609 3300035725 Bacteria 1392
367 Ga0373947_0240860 3300035725 Bacteria 1194
368 Ga0373947_0691831 3300035725 Bacteria 695
369 Ga0373947_0728482 3300035725 Bacteria 676
370 Ga0373937_0110242 3300036401 Bacteria 2559
371 Ga0373937_0564011 3300036401 Bacteria 1081
372 Ga0373937_0587398 3300036401 Unclassified 1057
373 Ga0373937_0902159 3300036401 Bacteria 832
374 Ga0316582_0148230 3300036647 Bacteria 1585
375 Ga0316582_0189301 3300036647 Bacteria 1401
376 Ga0316582_0481339 3300036647 Bacteria 855
377 Ga0316582_0611568 3300036647 Archaea 750
378 Ga0316584_0375074 3300036712 Bacteria 1018
379 Ga0373925_0111342 3300037068 Bacteria 2115
380 Ga0373925_0306714 3300037068 Bacteria 1282
381 Ga0373925_0312397 3300037068 Bacteria 1270
382 Ga0373925_0539941 3300037068 Bacteria 958
383 Ga0373925_0558770 3300037068 Unclassified 941
384 Ga0316581_0133591 3300037588 Bacteria 765
385 Ga0436364_0253569 3300037853 Bacteria 1291
386 Ga0436364_1428445 3300037853 Bacteria 1124
387 Ga0400488_24956 3300038741 Unclassified 1835
388 Ga0400486_26827 3300038742 Unclassified 1163
389 Ga0242420_015228 3300038996 Bacteria 1328
390 Ga0400483_093872 3300039062 Unclassified 2058
391 Ga0400489_94519 3300039093 Unclassified 1291
392 Ga0400487_24701 3300039110 Unclassified 1681
393 Ga0436365_1326345 3300039437 Bacteria 1427
394 Ga0436360_0253839 3300039438 Bacteria 1411
395 Ga0436360_0338933 3300039438 Bacteria 1644
396 Ga0436360_0565704 3300039438 Bacteria 1382
397 Ga0436360_0655878 3300039438 Bacteria 1602
398 Ga0436360_0826069 3300039438 Bacteria 2225
399 Ga0436361_0087236 3300039447 Bacteria 1553
400 Ga0436361_0831350 3300039447 Unclassified 4315
401 Ga0436363_0703516 3300039450 Bacteria 2179
402 Ga0436363_1289363 3300039450 Bacteria 970
403 Ga0436362_0035050 3300039453 Bacteria 1564
404 Ga0436362_0529634 3300039453 Bacteria 2134
405 Ga0436362_0553569 3300039453 Unclassified 4182
406 Ga0436362_1169919 3300039453 Bacteria 1913
407 Ga0436362_1201376 3300039453 Bacteria 1398
408 Ga0451787_695444 3300041441 Bacteria 923
409 Ga0451791_0237627 3300041451 Bacteria 1486
410 Ga0451807_1352859 3300041486 Bacteria 1575
411 Ga0451853_0221274 3300041512 Bacteria 933
412 Ga0466966_0268924 3300044684 Bacteria 1026
413 Ga0466957_0225653 3300044842 Bacteria 1238
414 Ga0466959_0150606 3300045049 Bacteria 1640
415 Ga0451576_0444513 3300045051 Bacteria 1361
416 Ga0466967_0229030 3300045976 Bacteria 1769
417 Ga0495617_052334 3300046452 Bacteria 1356
418 Ga0495627_041489 3300046453 Bacteria 1412
419 Ga0495592_0190922 3300046454 Unclassified 1388
420 Ga0495592_0454798 3300046454 Bacteria 801
421 Ga0495603_0176072 3300046455 Bacteria 1238
422 Ga0495629_0120514 3300046459 Bacteria 1827
423 Ga0495629_0187430 3300046459 Bacteria 1432
424 Ga0495638_0047087 3300046460 Bacteria 2705
425 Ga0495641_0086200 3300046461 Bacteria 1405
426 Ga0495641_0315995 3300046461 Bacteria 704
427 Ga0495651_0178792 3300046462 Bacteria 1503
428 Ga0495651_0455277 3300046462 Unclassified 826
429 Ga0495653_0025897 3300046463 Bacteria 4707
430 Ga0495653_0092011 3300046463 Bacteria 2215
431 Ga0495653_0339912 3300046463 Bacteria 968
432 Ga0495580_0228253 3300046472 Bacteria 1278
433 Ga0495580_0259441 3300046472 Bacteria 1188
434 Ga0495580_0375698 3300046472 Unclassified 960
435 Ga0495582_0089380 3300046473 Bacteria 1716
436 Ga0495605_0109710 3300046474 Bacteria 1260
437 Ga0495639_0121043 3300046475 Bacteria 1248
438 Ga0495639_0134233 3300046475 Bacteria 1186
439 Ga0495639_0281447 3300046475 Bacteria 826
440 Ga0495662_0118388 3300046476 Bacteria 1299
441 Ga0495662_0151643 3300046476 Bacteria 1141
442 Ga0495664_0123847 3300046477 Bacteria 1563
443 Ga0495584_0134961 3300046491 Bacteria 1252
444 Ga0495585_0101489 3300046492 Bacteria 1538
445 Ga0495585_0174709 3300046492 Bacteria 1107
446 Ga0495585_0208850 3300046492 Bacteria 990
447 Ga0495607_0113260 3300046501 Bacteria 1435
448 Ga0495607_0121125 3300046501 Bacteria 1373
449 Ga0495607_0153659 3300046501 Bacteria 1175
450 Ga0495583_0136072 3300046506 Bacteria 1025
451 Ga0495608_0157802 3300046511 Bacteria 1443
452 Ga0495608_0166946 3300046511 Unclassified 1397
453 Ga0495610_0173193 3300046512 Bacteria 903
454 Ga0495616_0127241 3300046513 Bacteria 1170
455 Ga0495618_0157177 3300046514 Bacteria 1450
456 Ga0495618_0244080 3300046514 Unclassified 1128
457 Ga0495620_0073600 3300046515 Bacteria 1392
458 Ga0495628_0246893 3300046516 Bacteria 1334
459 Ga0495628_0648935 3300046516 Bacteria 749
460 Ga0495630_0889462 3300046517 Bacteria 678
461 Ga0495631_0097927 3300046518 Bacteria 1262
462 Ga0495637_0076635 3300046520 Bacteria 1339
463 Ga0495644_0067314 3300046523 Bacteria 1345
464 Ga0495644_0073083 3300046523 Bacteria 1289
465 Ga0495644_0117559 3300046523 Bacteria 1010
466 Ga0495663_0008196 3300046525 Bacteria 2891
467 Ga0495663_0040176 3300046525 Bacteria 1419
468 Ga0495666_0158668 3300046526 Bacteria 1049
469 Ga0495652_0239407 3300046529 Bacteria 1351
470 Ga0495654_0084036 3300046530 Bacteria 1487
471 Ga0495665_0137171 3300046531 Bacteria 1279
472 Ga0495640_0044700 3300046533 Bacteria 3078
473 Ga0495640_0168011 3300046533 Bacteria 1402
474 Ga0495587_0105551 3300046536 Bacteria 1620
475 Ga0495587_0163382 3300046536 Bacteria 1266
476 Ga0495598_0004548 3300046537 Bacteria 3012
477 Ga0495609_0081665 3300046538 Bacteria 1412
478 Ga0495621_0004061 3300046539 Bacteria 4074
479 Ga0495621_0131042 3300046539 Bacteria 975
480 Ga0495597_0086496 3300046542 Bacteria 1334
481 Ga0495645_0614190 3300046543 Bacteria 667
482 Ga0495622_0061508 3300046557 Bacteria 1738
483 Ga0495622_0119892 3300046557 Bacteria 1201
484 Ga0495667_0120416 3300046559 Bacteria 1694
485 Ga0495667_0171164 3300046559 Bacteria 1395
486 Ga0495656_0092782 3300046615 Bacteria 1383
487 Ga0495656_0182862 3300046615 Bacteria 1031
488 Ga0495634_0576316 3300046642 Bacteria 654
489 Ga0495611_0142583 3300046648 Bacteria 1118
490 Ga0495625_0255675 3300046660 Bacteria 1135
491 Ga0495635_0053326 3300046663 Bacteria 2786
492 Ga0495635_0120038 3300046663 Bacteria 1793
493 Ga0495635_0182652 3300046663 Unclassified 1425
494 Ga0495635_0531062 3300046663 Bacteria 772
495 Ga0495659_0070389 3300046664 Bacteria 1309
496 Ga0495659_0140511 3300046664 Bacteria 963
497 Ga0495661_0122485 3300046665 Bacteria 1434
498 Ga0495588_0146309 3300046674 Bacteria 1249
499 Ga0495588_0171900 3300046674 Bacteria 1145
500 Ga0495657_0188526 3300046675 Bacteria 1261
501 Ga0495657_0393382 3300046675 Unclassified 816
502 Ga0495599_0008661 3300046678 Bacteria 6190
503 Ga0495599_0235047 3300046678 Bacteria 1118
504 Ga0495623_0135169 3300046679 Bacteria 1472
505 Ga0495646_0077018 3300046680 Bacteria 1951
506 Ga0495646_0236440 3300046680 Unclassified 983
507 Ga0495647_0062666 3300046681 Bacteria 1470
508 Ga0495647_0082519 3300046681 Bacteria 1305
509 Ga0495658_0059032 3300046683 Bacteria 2195
510 Ga0495658_0156755 3300046683 Bacteria 1401
511 Ga0495669_0036196 3300046684 Bacteria 2181
512 Ga0495669_0051179 3300046684 Bacteria 1853
513 Ga0495613_0234196 3300046689 Bacteria 1285
514 Ga0495670_0171576 3300046691 Bacteria 1142
515 Ga0495671_0030929 3300046692 Bacteria 2739
516 Ga0495671_0370974 3300046692 Bacteria 686
517 Ga0495649_0258789 3300046694 Bacteria 892
518 Ga0495600_0177301 3300046809 Unclassified 1374
519 Ga0495600_0199381 3300046809 Bacteria 1285
520 Ga0495581_0087187 3300047315 Bacteria 1809
521 Ga0495581_0118728 3300047315 Bacteria 1538
522 Ga0495604_0642258 3300047317 Bacteria 677
523 Ga0495674_0053893 3300047319 Bacteria 3534
524 Ga0495674_0266809 3300047319 Bacteria 1405
525 Ga0495674_0447729 3300047319 Bacteria 1038
526 Ga0495672_0196736 3300047320 Bacteria 1010
527 Ga0495676_0321392 3300047321 Bacteria 1039
528 Ga0495680_0076598 3300047322 Bacteria 2535
529 Ga0495680_0276493 3300047322 Unclassified 1184
530 Ga0495675_0097658 3300047444 Bacteria 1840
531 Ga0495675_0286350 3300047444 Bacteria 981
532 Ga0495677_0022368 3300047445 Bacteria 2293
533 Ga0495679_045536 3300047446 Bacteria 1339
534 Ga0495679_049392 3300047446 Bacteria 1269
535 Ga0495673_0108098 3300047469 Bacteria 1115
536 Ga0495681_0051735 3300047470 Bacteria 1930
537 Ga0495684_0202092 3300047471 Bacteria 1464
538 Ga0495684_0227943 3300047471 Bacteria 1363
539 Ga0495684_0245427 3300047471 Bacteria 1304
540 Ga0495684_0265144 3300047471 Bacteria 1245
541 Ga0495686_0151252 3300047472 Bacteria 1362
542 Ga0495602_0375685 3300048088 Unclassified 1019
543 Ga0495602_0550640 3300048088 Bacteria 799
544 Ga0495615_0022301 3300048090 Bacteria 1439
545 Ga0495626_0103871 3300048091 Bacteria 1236
546 Ga0496100_0025258 3300048903 Bacteria 3632
547 Ga0496100_0368820 3300048903 Bacteria 1088
548 Ga0496101_0100205 3300048904 Bacteria 2167
549 Ga0496101_0279904 3300048904 Bacteria 1303
550 Ga0496102_0229450 3300048905 Bacteria 1750
551 Ga0496102_0257075 3300048905 Bacteria 1646
552 Ga0496103_0199825 3300048906 Bacteria 1286
553 Ga0496103_0231580 3300048906 Bacteria 1188
554 Ga0496104_0251060 3300048907 Unclassified 1681
555 Ga0496104_0288489 3300048907 Bacteria 1553
556 Ga0496105_0267151 3300048908 Bacteria 1382
557 Ga0496105_0292269 3300048908 Unclassified 1311
558 Ga0496106_0295973 3300048909 Bacteria 1297
559 Ga0496107_0243031 3300048910 Bacteria 1339
560 Ga0496108_0124919 3300048911 Bacteria 2208
561 Ga0496108_0274540 3300048911 Bacteria 1467
562 Ga0496109_0380943 3300048912 Bacteria 1332
563 Ga0496110_0140961 3300048913 Bacteria 2179
564 Ga0496110_0178041 3300048913 Bacteria 1930
565 Ga0496111_0250861 3300048914 Bacteria 1313
566 Ga0496111_0254366 3300048914 Bacteria 1303
567 Ga0496112_0427714 3300048915 Bacteria 1262
568 Ga0496113_0229368 3300048916 Bacteria 1480
569 Ga0496114_0260894 3300048917 Bacteria 1525
570 Ga0496114_0360220 3300048917 Bacteria 1286
571 Ga0496114_0371639 3300048917 Bacteria 1265
572 Ga0496115_0297595 3300048918 Bacteria 1322
573 Ga0496115_0315903 3300048918 Bacteria 1278
574 Ga0496115_0316283 3300048918 Bacteria 1277
575 Ga0496115_0912715 3300048918 Bacteria 676
576 Ga0496119_0127521 3300048922 Bacteria 1390
577 Ga0496120_0103466 3300048923 Bacteria 1500
578 Ga0496121_0238355 3300048924 Bacteria 1269
579 Ga0496125_0193640 3300048928 Bacteria 1339
580 Ga0496126_0108059 3300048929 Bacteria 2426
581 Ga0496126_0308172 3300048929 Bacteria 1304
582 Ga0495678_081247 3300049459 Bacteria 1163
583 Ga0501039_0413753 3300049575 Bacteria 1059
584 Ga0501046_0246115 3300049580 Bacteria 1317
585 Ga0501072_0269385 3300049588 Bacteria 1355
586 Ga0501081_0231291 3300049743 Bacteria 1346
587 nmdc:mga05p37_1031821_c1 3300050507 Bacteria 870
588 nmdc:mga09592_381845_c1 3300050508 Bacteria 1218
589 nmdc:mga06r32_249229_c1 3300050510 Bacteria 1763
590 nmdc:mga08y16_261911_c1 3300050511 Bacteria 1786
591 nmdc:mga0n895_157690_c1 3300050512 Bacteria 2301
592 nmdc:mga0n895_338720_c1 3300050512 Bacteria 1524
593 nmdc:mga0n895_356403_c1 3300050512 Bacteria 1482
594 nmdc:mga0n895_606241_c1 3300050512 Bacteria 1097
595 nmdc:mga0n895_981656_c1 3300050512 Bacteria 827
596 nmdc:mga0rr50_236315_c1 3300050513 Bacteria 1514
597 nmdc:mga0rr50_313780_c1 3300050513 Bacteria 1314
598 nmdc:mga08x19_166146_c1 3300050514 Bacteria 1501
599 nmdc:mga08x19_239765_c1 3300050514 Bacteria 1250
600 nmdc:mga08x19_433765_c1 3300050514 Bacteria 924
601 nmdc:mga0a205_389703_c1 3300050515 Bacteria 1258
602 nmdc:mga0a205_46735_c1 3300050515 Bacteria 4175
603 Ga0495601_0162326 3300053077 Unclassified 1460
604 Ga0495601_0285206 3300053077 Bacteria 1076
605 Ga0495612_0050704 3300053078 Bacteria 1704
606 Ga0495612_0086570 3300053078 Unclassified 1321
607 Ga0495655_0025343 3300053083 Bacteria 1386
608 Ga0495595_0050532 3300053084 Bacteria 1925
609 Ga0495595_0093121 3300053084 Bacteria 1447
610 Ga0495595_0116562 3300053084 Unclassified 1298
611 Ga0495619_0093189 3300053085 Bacteria 2041
612 Ga0495619_0200182 3300053085 Unclassified 1382
613 Ga0500566_0335403 3300053094 Bacteria 698
614 Ga0500633_0075955 3300053160 Bacteria 1208

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300011119 Ga0105246_10187061 Ga0105246_101870611 179
2 3300035692 Ga0373935_0344782 Ga0373935_0344782_174_770 195
3 3300050512 nmdc:mga0n895_606241_c1 nmdc:mga0n895_606241_c1_91_687 195
4 3300005436 Ga0070713_100220181 Ga0070713_1002201813 196
5 3300006028 Ga0070717_10409791 Ga0070717_104097912 196
6 3300006175 Ga0070712_100062090 Ga0070712_1000620902 196
7 3300035117 Ga0373953_0048086 Ga0373953_0048086_178_837 196
8 3300035118 Ga0373954_0016753 Ga0373954_0016753_1522_2181 196
9 3300035724 Ga0373933_0062968 Ga0373933_0062968_874_1533 196
10 3300046463 Ga0495653_0025897 Ga0495653_0025897_3245_3904 196
11 3300046663 Ga0495635_0053326 Ga0495635_0053326_693_1352 196
12 3300047319 Ga0495674_0053893 Ga0495674_0053893_2156_2815 196
13 3300005354 Ga0070675_100231302 Ga0070675_1002313023 200
14 3300034816 Ga0373930_0015479 Ga0373930_0015479_755_1390 200
15 3300005345 Ga0070692_10274236 Ga0070692_102742361 202
16 3300005441 Ga0070700_100023878 Ga0070700_1000238786 202
17 3300005441 Ga0070700_100275602 Ga0070700_1002756022 202
18 3300005547 Ga0070693_100167707 Ga0070693_1001677071 202
19 3300005563 Ga0068855_100488395 Ga0068855_1004883951 202
20 3300025919 Ga0207657_10235849 Ga0207657_102358491 202
21 3300025924 Ga0207694_10233380 Ga0207694_102333802 202
22 3300025933 Ga0207706_10101252 Ga0207706_101012522 202
23 3300026035 Ga0207703_10544164 Ga0207703_105441641 202
24 3300026075 Ga0207708_10059501 Ga0207708_100595013 202
25 3300026116 Ga0207674_10219735 Ga0207674_102197353 202
26 3300027907 Ga0207428_10274467 Ga0207428_102744672 202
27 3300014968 Ga0157379_10721234 Ga0157379_107212342 203
28 3300014969 Ga0157376_11044013 Ga0157376_110440131 203
29 3300025915 Ga0207693_10169099 Ga0207693_101690993 203
30 3300048911 Ga0496108_0274540 Ga0496108_0274540_37_648 203
31 3300039110 Ga0400487_24701 Ga0400487_24701_506_1120 204
32 3300036712 Ga0316584_0375074 Ga0316584_0375074_219_836 205
33 3300001978 JGI24747J21853_1004312 JGI24747J21853_10043122 206
34 3300001979 JGI24740J21852_10075945 JGI24740J21852_100759451 206
35 3300002070 JGI24750J21931_1009827 JGI24750J21931_10098271 206
36 3300002070 JGI24750J21931_1016975 JGI24750J21931_10169752 206
37 3300005330 Ga0070690_100217625 Ga0070690_1002176251 206
38 3300005333 Ga0070677_10088984 Ga0070677_100889842 206
39 3300005335 Ga0070666_10217953 Ga0070666_102179531 206
40 3300005337 Ga0070682_100217197 Ga0070682_1002171972 206
41 3300005338 Ga0068868_100672923 Ga0068868_1006729231 206
42 3300005340 Ga0070689_100428101 Ga0070689_1004281012 206
43 3300005345 Ga0070692_10024795 Ga0070692_100247954 206
44 3300005347 Ga0070668_100305387 Ga0070668_1003053872 206
45 3300005353 Ga0070669_100161499 Ga0070669_1001614991 206
46 3300005353 Ga0070669_100169988 Ga0070669_1001699881 206
47 3300005353 Ga0070669_100219479 Ga0070669_1002194793 206
48 3300005356 Ga0070674_100236618 Ga0070674_1002366181 206
49 3300005367 Ga0070667_100256829 Ga0070667_1002568292 206
50 3300005437 Ga0070710_10234253 Ga0070710_102342531 206
51 3300005439 Ga0070711_100172050 Ga0070711_1001720503 206
52 3300005444 Ga0070694_100060592 Ga0070694_1000605923 206
53 3300005455 Ga0070663_100211000 Ga0070663_1002110002 206
54 3300005530 Ga0070679_100873568 Ga0070679_1008735681 206
55 3300005536 Ga0070697_100258454 Ga0070697_1002584541 206
56 3300005536 Ga0070697_100280060 Ga0070697_1002800602 206
57 3300005543 Ga0070672_100070100 Ga0070672_1000701004 206
58 3300005545 Ga0070695_100242763 Ga0070695_1002427632 206
59 3300005549 Ga0070704_100296973 Ga0070704_1002969731 206
60 3300005616 Ga0068852_100393599 Ga0068852_1003935991 206
61 3300005617 Ga0068859_100552542 Ga0068859_1005525422 206
62 3300005718 Ga0068866_10181645 Ga0068866_101816451 206
63 3300005844 Ga0068862_100027192 Ga0068862_1000271924 206
64 3300005844 Ga0068862_100253538 Ga0068862_1002535382 206
65 3300006163 Ga0070715_10019689 Ga0070715_100196892 206
66 3300006173 Ga0070716_100181104 Ga0070716_1001811042 206
67 3300006173 Ga0070716_100201034 Ga0070716_1002010341 206
68 3300006871 Ga0075434_100315336 Ga0075434_1003153362 206
69 3300006881 Ga0068865_100220841 Ga0068865_1002208413 206
70 3300006881 Ga0068865_100311559 Ga0068865_1003115592 206
71 3300006931 Ga0097620_100552583 Ga0097620_1005525832 206
72 3300007076 Ga0075435_100456980 Ga0075435_1004569801 206
73 3300009092 Ga0105250_10138994 Ga0105250_101389942 206
74 3300009094 Ga0111539_10285824 Ga0111539_102858242 206
75 3300009098 Ga0105245_10567452 Ga0105245_105674521 206
76 3300009101 Ga0105247_10116606 Ga0105247_101166062 206
77 3300009148 Ga0105243_10278903 Ga0105243_102789031 206
78 3300009177 Ga0105248_10396003 Ga0105248_103960031 206
79 3300009545 Ga0105237_10264209 Ga0105237_102642093 206
80 3300009553 Ga0105249_10580693 Ga0105249_105806931 206
81 3300009553 Ga0105249_10612581 Ga0105249_106125812 206
82 3300012481 Ga0157320_1001347 Ga0157320_10013472 206
83 3300012513 Ga0157326_1010575 Ga0157326_10105751 206
84 3300013296 Ga0157374_10200761 Ga0157374_102007613 206
85 3300013296 Ga0157374_10578398 Ga0157374_105783982 206
86 3300013297 Ga0157378_10563393 Ga0157378_105633931 206
87 3300013306 Ga0163162_10437613 Ga0163162_104376131 206
88 3300013306 Ga0163162_10658270 Ga0163162_106582703 206
89 3300013307 Ga0157372_10439307 Ga0157372_104393072 206
90 3300014325 Ga0163163_10128834 Ga0163163_101288342 206
91 3300014326 Ga0157380_10110803 Ga0157380_101108034 206
92 3300014326 Ga0157380_10196395 Ga0157380_101963953 206
93 3300014326 Ga0157380_10516755 Ga0157380_105167552 206
94 3300014326 Ga0157380_10676164 Ga0157380_106761641 206
95 3300014497 Ga0182008_10102012 Ga0182008_101020122 206
96 3300014497 Ga0182008_10242430 Ga0182008_102424302 206
97 3300014969 Ga0157376_10411209 Ga0157376_104112091 206
98 3300017792 Ga0163161_10089097 Ga0163161_100890972 206
99 3300021361 Ga0213872_10063787 Ga0213872_100637871 206
100 3300025893 Ga0207682_10097559 Ga0207682_100975591 206
101 3300025899 Ga0207642_10140908 Ga0207642_101409081 206
102 3300025900 Ga0207710_10106923 Ga0207710_101069232 206
103 3300025900 Ga0207710_10244669 Ga0207710_102446692 206
104 3300025905 Ga0207685_10103049 Ga0207685_101030492 206
105 3300025906 Ga0207699_10233244 Ga0207699_102332442 206
106 3300025907 Ga0207645_10314941 Ga0207645_103149412 206
107 3300025911 Ga0207654_10193646 Ga0207654_101936462 206
108 3300025916 Ga0207663_10082828 Ga0207663_100828284 206
109 3300025916 Ga0207663_10274476 Ga0207663_102744762 206
110 3300025918 Ga0207662_10204676 Ga0207662_102046762 206
111 3300025920 Ga0207649_10039942 Ga0207649_100399422 206
112 3300025923 Ga0207681_10116371 Ga0207681_101163711 206
113 3300025923 Ga0207681_10253657 Ga0207681_102536571 206
114 3300025924 Ga0207694_10724396 Ga0207694_107243962 206
115 3300025928 Ga0207700_10426129 Ga0207700_104261292 206
116 3300025929 Ga0207664_10510954 Ga0207664_105109542 206
117 3300025935 Ga0207709_10160434 Ga0207709_101604342 206
118 3300025936 Ga0207670_10679840 Ga0207670_106798401 206
119 3300025939 Ga0207665_10096435 Ga0207665_100964354 206
120 3300025942 Ga0207689_10406533 Ga0207689_104065332 206
121 3300025961 Ga0207712_10521189 Ga0207712_105211891 206
122 3300026067 Ga0207678_10235817 Ga0207678_102358172 206
123 3300026088 Ga0207641_10725845 Ga0207641_107258452 206
124 3300026118 Ga0207675_100155502 Ga0207675_1001555022 206
125 3300026118 Ga0207675_100422079 Ga0207675_1004220792 206
126 3300026142 Ga0207698_10662909 Ga0207698_106629091 206
127 3300028380 Ga0268265_10253029 Ga0268265_102530292 206
128 3300028380 Ga0268265_10575630 Ga0268265_105756301 206
129 3300028800 Ga0265338_10268663 Ga0265338_102686631 206
130 3300030760 Ga0265762_1011759 Ga0265762_10117592 206
131 3300031238 Ga0265332_10069819 Ga0265332_100698193 206
132 3300031249 Ga0265339_10186939 Ga0265339_101869392 206
133 3300031250 Ga0265331_10092924 Ga0265331_100929241 206
134 3300031344 Ga0265316_10054843 Ga0265316_100548434 206
135 3300034817 Ga0373948_0016294 Ga0373948_0016294_719_1339 206
136 3300034818 Ga0373950_0012908 Ga0373950_0012908_706_1326 206
137 3300035088 Ga0373940_0004593 Ga0373940_0004593_1874_2494 206
138 3300035090 Ga0373949_0007543 Ga0373949_0007543_1729_2349 206
139 3300035092 Ga0373952_0023655 Ga0373952_0023655_628_1248 206
140 3300035112 Ga0373932_0061720 Ga0373932_0061720_501_1121 206
141 3300035114 Ga0373939_0070210 Ga0373939_0070210_457_1077 206
142 3300035114 Ga0373939_0163206 Ga0373939_0163206_42_662 206
143 3300035121 Ga0373960_0056940 Ga0373960_0056940_517_1137 206
144 3300035207 Ga0373942_0005145 Ga0373942_0005145_1790_2410 206
145 3300035691 Ga0373931_0115407 Ga0373931_0115407_140_760 206
146 3300035691 Ga0373931_0265719 Ga0373931_0265719_285_905 206
147 3300035724 Ga0373933_0201601 Ga0373933_0201601_515_1135 206
148 3300036647 Ga0316582_0481339 Ga0316582_0481339_94_714 206
149 3300039438 Ga0436360_0253839 Ga0436360_0253839_184_804 206
150 3300039438 Ga0436360_0338933 Ga0436360_0338933_743_1363 206
151 3300039447 Ga0436361_0831350 Ga0436361_0831350_3560_4180 206
152 3300039450 Ga0436363_1289363 Ga0436363_1289363_50_670 206
153 3300039453 Ga0436362_0553569 Ga0436362_0553569_1420_2040 206
154 3300045976 Ga0466967_0229030 Ga0466967_0229030_750_1370 206
155 3300046492 Ga0495585_0101489 Ga0495585_0101489_27_647 206
156 3300046523 Ga0495644_0067314 Ga0495644_0067314_708_1328 206
157 3300046525 Ga0495663_0008196 Ga0495663_0008196_1653_2273 206
158 3300046537 Ga0495598_0004548 Ga0495598_0004548_136_756 206
159 3300046539 Ga0495621_0004061 Ga0495621_0004061_2769_3389 206
160 3300046615 Ga0495656_0182862 Ga0495656_0182862_300_920 206
161 3300046692 Ga0495671_0030929 Ga0495671_0030929_1654_2274 206
162 3300047471 Ga0495684_0265144 Ga0495684_0265144_413_1033 206
163 3300048090 Ga0495615_0022301 Ga0495615_0022301_198_818 206
164 3300048903 Ga0496100_0368820 Ga0496100_0368820_38_658 206
165 3300048904 Ga0496101_0100205 Ga0496101_0100205_871_1491 206
166 3300048906 Ga0496103_0231580 Ga0496103_0231580_463_1083 206
167 3300048907 Ga0496104_0288489 Ga0496104_0288489_684_1304 206
168 3300048908 Ga0496105_0267151 Ga0496105_0267151_662_1282 206
169 3300048913 Ga0496110_0140961 Ga0496110_0140961_994_1614 206
170 3300048914 Ga0496111_0254366 Ga0496111_0254366_611_1231 206
171 3300048917 Ga0496114_0360220 Ga0496114_0360220_40_660 206
172 3300048918 Ga0496115_0315903 Ga0496115_0315903_36_656 206
173 3300048929 Ga0496126_0308172 Ga0496126_0308172_620_1240 206
174 3300050511 nmdc:mga08y16_261911_c1 nmdc:mga08y16_261911_c1_554_1174 206
175 3300050512 nmdc:mga0n895_157690_c1 nmdc:mga0n895_157690_c1_664_1284 206
176 3300050512 nmdc:mga0n895_338720_c1 nmdc:mga0n895_338720_c1_304_924 206
177 3300050513 nmdc:mga0rr50_313780_c1 nmdc:mga0rr50_313780_c1_627_1247 206
178 3300050514 nmdc:mga08x19_239765_c1 nmdc:mga08x19_239765_c1_616_1236 206
179 3300050515 nmdc:mga0a205_389703_c1 nmdc:mga0a205_389703_c1_35_655 206
180 3300005547 Ga0070693_100466283 Ga0070693_1004662832 207
181 3300010159 Ga0099796_10022297 Ga0099796_100222974 207
182 3300021361 Ga0213872_10249431 Ga0213872_102494311 207
183 3300027512 Ga0209179_1005664 Ga0209179_10056642 207
184 3300031242 Ga0265329_10032896 Ga0265329_100328962 207
185 3300035086 Ga0373934_0071003 Ga0373934_0071003_750_1373 207
186 3300035117 Ga0373953_0332699 Ga0373953_0332699_13_636 207
187 3300035170 Ga0373943_0197320 Ga0373943_0197320_461_1084 207
188 3300035170 Ga0373943_0557723 Ga0373943_0557723_37_660 207
189 3300035725 Ga0373947_0728482 Ga0373947_0728482_41_664 207
190 3300037853 Ga0436364_0253569 Ga0436364_0253569_480_1103 207
191 3300038741 Ga0400488_24956 Ga0400488_24956_762_1385 207
192 3300038742 Ga0400486_26827 Ga0400486_26827_109_732 207
193 3300039062 Ga0400483_093872 Ga0400483_093872_182_805 207
194 3300039093 Ga0400489_94519 Ga0400489_94519_413_1036 207
195 3300039453 Ga0436362_0529634 Ga0436362_0529634_1027_1650 207
196 3300045049 Ga0466959_0150606 Ga0466959_0150606_964_1587 207
197 3300046461 Ga0495641_0315995 Ga0495641_0315995_69_692 207
198 3300046475 Ga0495639_0281447 Ga0495639_0281447_21_644 207
199 3300046477 Ga0495664_0123847 Ga0495664_0123847_928_1551 207
200 3300046517 Ga0495630_0889462 Ga0495630_0889462_43_666 207
201 3300046529 Ga0495652_0239407 Ga0495652_0239407_716_1339 207
202 3300046543 Ga0495645_0614190 Ga0495645_0614190_32_655 207
203 3300046642 Ga0495634_0576316 Ga0495634_0576316_13_636 207
204 3300046663 Ga0495635_0531062 Ga0495635_0531062_137_760 207
205 3300046692 Ga0495671_0370974 Ga0495671_0370974_11_634 207
206 3300047317 Ga0495604_0642258 Ga0495604_0642258_42_665 207
207 3300048918 Ga0496115_0912715 Ga0496115_0912715_16_639 207
208 3300053094 Ga0500566_0335403 Ga0500566_0335403_56_679 207
209 3300000549 LJQas_1007314 LJQas_10073141 208
210 3300005436 Ga0070713_100546207 Ga0070713_1005462072 208
211 3300006175 Ga0070712_100208698 Ga0070712_1002086983 208
212 3300006871 Ga0075434_100959759 Ga0075434_1009597592 208
213 3300007076 Ga0075435_100436849 Ga0075435_1004368492 208
214 3300036647 Ga0316582_0148230 Ga0316582_0148230_586_1212 208
215 3300036647 Ga0316582_0189301 Ga0316582_0189301_134_760 208
216 3300036647 Ga0316582_0611568 Ga0316582_0611568_27_653 208
217 3300037588 Ga0316581_0133591 Ga0316581_0133591_53_679 208
218 3300037853 Ga0436364_1428445 Ga0436364_1428445_192_818 208
219 3300039438 Ga0436360_0565704 Ga0436360_0565704_644_1270 208
220 3300041451 Ga0451791_0237627 Ga0451791_0237627_689_1315 208
221 3300044684 Ga0466966_0268924 Ga0466966_0268924_226_852 208
222 3300044842 Ga0466957_0225653 Ga0466957_0225653_383_1009 208
223 3300050512 nmdc:mga0n895_981656_c1 nmdc:mga0n895_981656_c1_60_686 208
224 3300050514 nmdc:mga08x19_433765_c1 nmdc:mga08x19_433765_c1_22_648 208
225 3300021358 Ga0213873_10012241 Ga0213873_100122413 210
226 3300032133 Ga0316583_10024255 Ga0316583_100242554 211
227 3300035120 Ga0373957_0136479 Ga0373957_0136479_43_705 212
228 3300037068 Ga0373925_0111342 Ga0373925_0111342_1262_1906 214
229 3300030763 Ga0265763_1005294 Ga0265763_10052942 215
230 3300041486 Ga0451807_1352859 Ga0451807_1352859_225_878 217
231 3300001990 JGI24737J22298_10052276 JGI24737J22298_100522761 219
232 3300025906 Ga0207699_10224717 Ga0207699_102247172 219
233 3300031251 Ga0265327_10105138 Ga0265327_101051381 219
234 3300035170 Ga0373943_0357715 Ga0373943_0357715_32_691 219
235 3300039438 Ga0436360_0826069 Ga0436360_0826069_701_1360 219
236 3300039453 Ga0436362_1169919 Ga0436362_1169919_144_803 219
237 3300047319 Ga0495674_0447729 Ga0495674_0447729_20_913 219
238 3300049575 Ga0501039_0413753 Ga0501039_0413753_38_697 219
239 3300049580 Ga0501046_0246115 Ga0501046_0246115_88_747 219
240 3300049588 Ga0501072_0269385 Ga0501072_0269385_99_758 219
241 3300049743 Ga0501081_0231291 Ga0501081_0231291_604_1263 219
242 3300053160 Ga0500633_0075955 Ga0500633_0075955_108_767 219
243 3300001976 JGI24752J21851_1009895 JGI24752J21851_10098952 220
244 3300001979 JGI24740J21852_10045097 JGI24740J21852_100450971 220
245 3300002074 JGI24748J21848_1007540 JGI24748J21848_10075402 220
246 3300002076 JGI24749J21850_1011151 JGI24749J21850_10111512 220
247 3300002239 JGI24034J26672_10012414 JGI24034J26672_100124142 220
248 3300002459 JGI24751J29686_10024765 JGI24751J29686_100247651 220
249 3300005290 Ga0065712_10294727 Ga0065712_102947271 220
250 3300005330 Ga0070690_100193408 Ga0070690_1001934081 220
251 3300005331 Ga0070670_100277965 Ga0070670_1002779653 220
252 3300005334 Ga0068869_100294918 Ga0068869_1002949181 220
253 3300005337 Ga0070682_100130815 Ga0070682_1001308151 220
254 3300005338 Ga0068868_100298528 Ga0068868_1002985282 220
255 3300005340 Ga0070689_100194321 Ga0070689_1001943213 220
256 3300005347 Ga0070668_100181686 Ga0070668_1001816862 220
257 3300005354 Ga0070675_100261716 Ga0070675_1002617162 220
258 3300005355 Ga0070671_100209000 Ga0070671_1002090003 220
259 3300005356 Ga0070674_100156992 Ga0070674_1001569923 220
260 3300005364 Ga0070673_100234245 Ga0070673_1002342452 220
261 3300005365 Ga0070688_100150405 Ga0070688_1001504052 220
262 3300005406 Ga0070703_10055876 Ga0070703_100558761 220
263 3300005434 Ga0070709_10163286 Ga0070709_101632861 220
264 3300005435 Ga0070714_100267764 Ga0070714_1002677642 220
265 3300005435 Ga0070714_100298437 Ga0070714_1002984372 220
266 3300005436 Ga0070713_100245247 Ga0070713_1002452471 220
267 3300005437 Ga0070710_10055173 Ga0070710_100551732 220
268 3300005438 Ga0070701_10228335 Ga0070701_102283352 220
269 3300005440 Ga0070705_100031342 Ga0070705_1000313421 220
270 3300005441 Ga0070700_100188483 Ga0070700_1001884832 220
271 3300005455 Ga0070663_100240531 Ga0070663_1002405312 220
272 3300005456 Ga0070678_100225253 Ga0070678_1002252532 220
273 3300005457 Ga0070662_100235103 Ga0070662_1002351031 220
274 3300005466 Ga0070685_10129047 Ga0070685_101290473 220
275 3300005468 Ga0070707_100313956 Ga0070707_1003139562 220
276 3300005471 Ga0070698_100251229 Ga0070698_1002512291 220
277 3300005535 Ga0070684_100413724 Ga0070684_1004137241 220
278 3300005536 Ga0070697_100379988 Ga0070697_1003799882 220
279 3300005543 Ga0070672_100261161 Ga0070672_1002611612 220
280 3300005544 Ga0070686_100159854 Ga0070686_1001598542 220
281 3300005545 Ga0070695_100170794 Ga0070695_1001707943 220
282 3300005546 Ga0070696_100194093 Ga0070696_1001940932 220
283 3300005548 Ga0070665_100289366 Ga0070665_1002893662 220
284 3300005549 Ga0070704_100155223 Ga0070704_1001552233 220
285 3300005564 Ga0070664_100319217 Ga0070664_1003192171 220
286 3300005616 Ga0068852_100395882 Ga0068852_1003958821 220
287 3300005617 Ga0068859_100324887 Ga0068859_1003248872 220
288 3300005618 Ga0068864_100208528 Ga0068864_1002085282 220
289 3300005718 Ga0068866_10152531 Ga0068866_101525312 220
290 3300005719 Ga0068861_100284716 Ga0068861_1002847161 220
291 3300005841 Ga0068863_100191117 Ga0068863_1001911172 220
292 3300005842 Ga0068858_100221104 Ga0068858_1002211042 220
293 3300005843 Ga0068860_100425567 Ga0068860_1004255673 220
294 3300006058 Ga0075432_10062319 Ga0075432_100623192 220
295 3300006163 Ga0070715_10015266 Ga0070715_100152663 220
296 3300006237 Ga0097621_100158145 Ga0097621_1001581452 220
297 3300006237 Ga0097621_100310672 Ga0097621_1003106722 220
298 3300006844 Ga0075428_100415815 Ga0075428_1004158152 220
299 3300006852 Ga0075433_10264528 Ga0075433_102645282 220
300 3300006914 Ga0075436_100195398 Ga0075436_1001953982 220
301 3300006931 Ga0097620_100324888 Ga0097620_1003248882 220
302 3300009011 Ga0105251_10098993 Ga0105251_100989933 220
303 3300009092 Ga0105250_10087988 Ga0105250_100879882 220
304 3300009098 Ga0105245_10322718 Ga0105245_103227182 220
305 3300009101 Ga0105247_10033007 Ga0105247_100330072 220
306 3300009147 Ga0114129_10565235 Ga0114129_105652353 220
307 3300009148 Ga0105243_10265603 Ga0105243_102656032 220
308 3300009174 Ga0105241_10217583 Ga0105241_102175831 220
309 3300009176 Ga0105242_10240038 Ga0105242_102400381 220
310 3300009177 Ga0105248_10303889 Ga0105248_103038892 220
311 3300009545 Ga0105237_10396527 Ga0105237_103965271 220
312 3300009553 Ga0105249_10385989 Ga0105249_103859892 220
313 3300010159 Ga0099796_10012658 Ga0099796_100126583 220
314 3300010375 Ga0105239_10429473 Ga0105239_104294733 220
315 3300011119 Ga0105246_10187182 Ga0105246_101871822 220
316 3300012488 Ga0157343_1000873 Ga0157343_10008731 220
317 3300012510 Ga0157316_1001838 Ga0157316_10018381 220
318 3300013296 Ga0157374_10263104 Ga0157374_102631042 220
319 3300013306 Ga0163162_10249083 Ga0163162_102490833 220
320 3300013306 Ga0163162_10268317 Ga0163162_102683173 220
321 3300013307 Ga0157372_10926613 Ga0157372_109266132 220
322 3300013308 Ga0157375_10314880 Ga0157375_103148802 220
323 3300014325 Ga0163163_10228568 Ga0163163_102285683 220
324 3300014745 Ga0157377_10114385 Ga0157377_101143853 220
325 3300014968 Ga0157379_10257689 Ga0157379_102576892 220
326 3300014969 Ga0157376_10248628 Ga0157376_102486283 220
327 3300017792 Ga0163161_10170915 Ga0163161_101709153 220
328 3300021358 Ga0213873_10022256 Ga0213873_100222562 220
329 3300021358 Ga0213873_10033300 Ga0213873_100333001 220
330 3300025735 Ga0207713_1072129 Ga0207713_10721291 220
331 3300025885 Ga0207653_10056752 Ga0207653_100567521 220
332 3300025893 Ga0207682_10104383 Ga0207682_101043832 220
333 3300025898 Ga0207692_10163331 Ga0207692_101633311 220
334 3300025898 Ga0207692_10217377 Ga0207692_102173772 220
335 3300025899 Ga0207642_10086400 Ga0207642_100864003 220
336 3300025900 Ga0207710_10112140 Ga0207710_101121402 220
337 3300025904 Ga0207647_10161445 Ga0207647_101614452 220
338 3300025905 Ga0207685_10087709 Ga0207685_100877092 220
339 3300025905 Ga0207685_10096525 Ga0207685_100965252 220
340 3300025906 Ga0207699_10230211 Ga0207699_102302111 220
341 3300025906 Ga0207699_10389649 Ga0207699_103896491 220
342 3300025910 Ga0207684_10154788 Ga0207684_101547883 220
343 3300025911 Ga0207654_10210502 Ga0207654_102105022 220
344 3300025915 Ga0207693_10277112 Ga0207693_102771121 220
345 3300025916 Ga0207663_10495711 Ga0207663_104957111 220
346 3300025917 Ga0207660_10260174 Ga0207660_102601742 220
347 3300025921 Ga0207652_10163267 Ga0207652_101632672 220
348 3300025922 Ga0207646_10261174 Ga0207646_102611742 220
349 3300025926 Ga0207659_10281713 Ga0207659_102817132 220
350 3300025927 Ga0207687_10355214 Ga0207687_103552141 220
351 3300025928 Ga0207700_10143121 Ga0207700_101431214 220
352 3300025929 Ga0207664_10376771 Ga0207664_103767712 220
353 3300025931 Ga0207644_10300427 Ga0207644_103004272 220
354 3300025933 Ga0207706_10235540 Ga0207706_102355401 220
355 3300025934 Ga0207686_10182737 Ga0207686_101827371 220
356 3300025935 Ga0207709_10245944 Ga0207709_102459442 220
357 3300025936 Ga0207670_10117211 Ga0207670_101172112 220
358 3300025937 Ga0207669_10073704 Ga0207669_100737043 220
359 3300025941 Ga0207711_10397443 Ga0207711_103974431 220
360 3300025942 Ga0207689_10071181 Ga0207689_100711812 220
361 3300025944 Ga0207661_10270516 Ga0207661_102705162 220
362 3300025960 Ga0207651_10301483 Ga0207651_103014832 220
363 3300025961 Ga0207712_10511526 Ga0207712_105115262 220
364 3300025972 Ga0207668_10329638 Ga0207668_103296381 220
365 3300026023 Ga0207677_10268314 Ga0207677_102683142 220
366 3300026035 Ga0207703_10388540 Ga0207703_103885401 220
367 3300026041 Ga0207639_10378727 Ga0207639_103787271 220
368 3300026067 Ga0207678_10260133 Ga0207678_102601333 220
369 3300026075 Ga0207708_10204450 Ga0207708_102044503 220
370 3300026078 Ga0207702_10429796 Ga0207702_104297961 220
371 3300026088 Ga0207641_10427368 Ga0207641_104273682 220
372 3300026089 Ga0207648_10206057 Ga0207648_102060571 220
373 3300026095 Ga0207676_10403808 Ga0207676_104038082 220
374 3300026118 Ga0207675_100247816 Ga0207675_1002478163 220
375 3300026142 Ga0207698_10377879 Ga0207698_103778791 220
376 3300027907 Ga0207428_10236502 Ga0207428_102365022 220
377 3300027907 Ga0207428_10275807 Ga0207428_102758072 220
378 3300028010 Ga0265358_100363 Ga0265358_1003632 220
379 3300028379 Ga0268266_10408129 Ga0268266_104081292 220
380 3300028380 Ga0268265_10544471 Ga0268265_105444711 220
381 3300028381 Ga0268264_10345921 Ga0268264_103459213 220
382 3300031018 Ga0265773_1001105 Ga0265773_10011052 220
383 3300031090 Ga0265760_10030744 Ga0265760_100307443 220
384 3300031090 Ga0265760_10047742 Ga0265760_100477421 220
385 3300031711 Ga0265314_10111864 Ga0265314_101118642 220
386 3300034816 Ga0373930_0017154 Ga0373930_0017154_50_712 220
387 3300034817 Ga0373948_0018967 Ga0373948_0018967_26_688 220
388 3300034818 Ga0373950_0013245 Ga0373950_0013245_132_794 220
389 3300034819 Ga0373958_0018183 Ga0373958_0018183_32_694 220
390 3300034820 Ga0373959_0010516 Ga0373959_0010516_131_793 220
391 3300034957 Ga0373938_0002013 Ga0373938_0002013_1905_2567 220
392 3300035083 Ga0373926_0047951 Ga0373926_0047951_434_1096 220
393 3300035083 Ga0373926_0057683 Ga0373926_0057683_61_723 220
394 3300035084 Ga0373928_0015895 Ga0373928_0015895_728_1390 220
395 3300035085 Ga0373929_0020446 Ga0373929_0020446_648_1310 220
396 3300035088 Ga0373940_0041201 Ga0373940_0041201_572_1234 220
397 3300035089 Ga0373944_0092442 Ga0373944_0092442_18_680 220
398 3300035090 Ga0373949_0022060 Ga0373949_0022060_211_873 220
399 3300035091 Ga0373951_0030647 Ga0373951_0030647_580_1242 220
400 3300035092 Ga0373952_0018771 Ga0373952_0018771_202_864 220
401 3300035111 Ga0373923_0141262 Ga0373923_0141262_34_696 220
402 3300035111 Ga0373923_0175266 Ga0373923_0175266_209_871 220
403 3300035112 Ga0373932_0004499 Ga0373932_0004499_683_1345 220
404 3300035113 Ga0373936_0091987 Ga0373936_0091987_33_695 220
405 3300035113 Ga0373936_0103750 Ga0373936_0103750_451_1113 220
406 3300035114 Ga0373939_0032079 Ga0373939_0032079_280_942 220
407 3300035115 Ga0373941_0038987 Ga0373941_0038987_31_693 220
408 3300035116 Ga0373945_0075038 Ga0373945_0075038_37_699 220
409 3300035116 Ga0373945_0106709 Ga0373945_0106709_17_679 220
410 3300035118 Ga0373954_0065360 Ga0373954_0065360_709_1371 220
411 3300035118 Ga0373954_0105389 Ga0373954_0105389_632_1294 220
412 3300035118 Ga0373954_0116609 Ga0373954_0116609_575_1237 220
413 3300035118 Ga0373954_0151850 Ga0373954_0151850_447_1109 220
414 3300035119 Ga0373956_0122396 Ga0373956_0122396_28_720 220
415 3300035119 Ga0373956_0124805 Ga0373956_0124805_84_746 220
416 3300035119 Ga0373956_0166860 Ga0373956_0166860_349_1011 220
417 3300035120 Ga0373957_0082945 Ga0373957_0082945_568_1230 220
418 3300035120 Ga0373957_0117767 Ga0373957_0117767_70_732 220
419 3300035120 Ga0373957_0128075 Ga0373957_0128075_37_699 220
420 3300035121 Ga0373960_0029905 Ga0373960_0029905_88_750 220
421 3300035170 Ga0373943_0128790 Ga0373943_0128790_566_1228 220
422 3300035170 Ga0373943_0140078 Ga0373943_0140078_17_679 220
423 3300035170 Ga0373943_0283310 Ga0373943_0283310_24_686 220
424 3300035171 Ga0373946_0051273 Ga0373946_0051273_915_1577 220
425 3300035171 Ga0373946_0115994 Ga0373946_0115994_493_1155 220
426 3300035172 Ga0373955_0099827 Ga0373955_0099827_105_767 220
427 3300035172 Ga0373955_0205021 Ga0373955_0205021_17_679 220
428 3300035172 Ga0373955_0234417 Ga0373955_0234417_331_1023 220
429 3300035172 Ga0373955_0344107 Ga0373955_0344107_225_887 220
430 3300035207 Ga0373942_0021769 Ga0373942_0021769_864_1526 220
431 3300035241 Ga0373961_0035680 Ga0373961_0035680_114_776 220
432 3300035242 Ga0373962_0038023 Ga0373962_0038023_667_1329 220
433 3300035410 Ga0373924_0054798 Ga0373924_0054798_425_1087 220
434 3300035410 Ga0373924_0055860 Ga0373924_0055860_948_1610 220
435 3300035691 Ga0373931_0144663 Ga0373931_0144663_139_801 220
436 3300035692 Ga0373935_0586405 Ga0373935_0586405_37_699 220
437 3300035695 Ga0373927_0038780 Ga0373927_0038780_581_1243 220
438 3300035724 Ga0373933_0057667 Ga0373933_0057667_1596_2258 220
439 3300035724 Ga0373933_0104883 Ga0373933_0104883_579_1241 220
440 3300035724 Ga0373933_0116994 Ga0373933_0116994_862_1524 220
441 3300035724 Ga0373933_0228993 Ga0373933_0228993_457_1149 220
442 3300035725 Ga0373947_0124599 Ga0373947_0124599_673_1335 220
443 3300035725 Ga0373947_0175609 Ga0373947_0175609_354_1016 220
444 3300035725 Ga0373947_0691831 Ga0373947_0691831_14_676 220
445 3300036401 Ga0373937_0110242 Ga0373937_0110242_641_1303 220
446 3300036401 Ga0373937_0564011 Ga0373937_0564011_59_721 220
447 3300036401 Ga0373937_0587398 Ga0373937_0587398_35_697 220
448 3300036401 Ga0373937_0902159 Ga0373937_0902159_134_796 220
449 3300037068 Ga0373925_0306714 Ga0373925_0306714_567_1229 220
450 3300037068 Ga0373925_0312397 Ga0373925_0312397_24_686 220
451 3300037068 Ga0373925_0539941 Ga0373925_0539941_31_693 220
452 3300037068 Ga0373925_0558770 Ga0373925_0558770_30_692 220
453 3300038996 Ga0242420_015228 Ga0242420_015228_84_746 220
454 3300039437 Ga0436365_1326345 Ga0436365_1326345_603_1265 220
455 3300039438 Ga0436360_0655878 Ga0436360_0655878_229_891 220
456 3300039447 Ga0436361_0087236 Ga0436361_0087236_705_1367 220
457 3300039450 Ga0436363_0703516 Ga0436363_0703516_753_1415 220
458 3300039453 Ga0436362_0035050 Ga0436362_0035050_144_806 220
459 3300039453 Ga0436362_1201376 Ga0436362_1201376_666_1328 220
460 3300041441 Ga0451787_695444 Ga0451787_695444_221_883 220
461 3300041512 Ga0451853_0221274 Ga0451853_0221274_14_676 220
462 3300045051 Ga0451576_0444513 Ga0451576_0444513_688_1350 220
463 3300046452 Ga0495617_052334 Ga0495617_052334_332_994 220
464 3300046453 Ga0495627_041489 Ga0495627_041489_727_1389 220
465 3300046454 Ga0495592_0190922 Ga0495592_0190922_581_1243 220
466 3300046454 Ga0495592_0454798 Ga0495592_0454798_38_700 220
467 3300046455 Ga0495603_0176072 Ga0495603_0176072_42_704 220
468 3300046459 Ga0495629_0120514 Ga0495629_0120514_747_1409 220
469 3300046459 Ga0495629_0187430 Ga0495629_0187430_607_1269 220
470 3300046460 Ga0495638_0047087 Ga0495638_0047087_1856_2518 220
471 3300046461 Ga0495641_0086200 Ga0495641_0086200_581_1243 220
472 3300046462 Ga0495651_0178792 Ga0495651_0178792_818_1480 220
473 3300046462 Ga0495651_0455277 Ga0495651_0455277_91_753 220
474 3300046463 Ga0495653_0092011 Ga0495653_0092011_32_694 220
475 3300046463 Ga0495653_0339912 Ga0495653_0339912_197_859 220
476 3300046472 Ga0495580_0228253 Ga0495580_0228253_591_1253 220
477 3300046472 Ga0495580_0259441 Ga0495580_0259441_134_796 220
478 3300046472 Ga0495580_0375698 Ga0495580_0375698_27_689 220
479 3300046473 Ga0495582_0089380 Ga0495582_0089380_702_1364 220
480 3300046474 Ga0495605_0109710 Ga0495605_0109710_566_1228 220
481 3300046475 Ga0495639_0121043 Ga0495639_0121043_20_682 220
482 3300046475 Ga0495639_0134233 Ga0495639_0134233_30_692 220
483 3300046476 Ga0495662_0118388 Ga0495662_0118388_513_1175 220
484 3300046476 Ga0495662_0151643 Ga0495662_0151643_57_719 220
485 3300046491 Ga0495584_0134961 Ga0495584_0134961_31_693 220
486 3300046492 Ga0495585_0174709 Ga0495585_0174709_382_1044 220
487 3300046492 Ga0495585_0208850 Ga0495585_0208850_47_709 220
488 3300046501 Ga0495607_0113260 Ga0495607_0113260_122_784 220
489 3300046501 Ga0495607_0121125 Ga0495607_0121125_613_1275 220
490 3300046501 Ga0495607_0153659 Ga0495607_0153659_459_1121 220
491 3300046506 Ga0495583_0136072 Ga0495583_0136072_82_744 220
492 3300046511 Ga0495608_0157802 Ga0495608_0157802_736_1398 220
493 3300046511 Ga0495608_0166946 Ga0495608_0166946_85_747 220
494 3300046512 Ga0495610_0173193 Ga0495610_0173193_74_736 220
495 3300046513 Ga0495616_0127241 Ga0495616_0127241_31_693 220
496 3300046514 Ga0495618_0157177 Ga0495618_0157177_37_699 220
497 3300046514 Ga0495618_0244080 Ga0495618_0244080_78_740 220
498 3300046515 Ga0495620_0073600 Ga0495620_0073600_591_1253 220
499 3300046516 Ga0495628_0246893 Ga0495628_0246893_603_1265 220
500 3300046516 Ga0495628_0648935 Ga0495628_0648935_53_715 220
501 3300046518 Ga0495631_0097927 Ga0495631_0097927_543_1205 220
502 3300046520 Ga0495637_0076635 Ga0495637_0076635_56_718 220
503 3300046523 Ga0495644_0073083 Ga0495644_0073083_567_1229 220
504 3300046523 Ga0495644_0117559 Ga0495644_0117559_281_943 220
505 3300046525 Ga0495663_0040176 Ga0495663_0040176_566_1228 220
506 3300046526 Ga0495666_0158668 Ga0495666_0158668_31_693 220
507 3300046530 Ga0495654_0084036 Ga0495654_0084036_789_1451 220
508 3300046531 Ga0495665_0137171 Ga0495665_0137171_195_857 220
509 3300046533 Ga0495640_0044700 Ga0495640_0044700_2230_2892 220
510 3300046533 Ga0495640_0168011 Ga0495640_0168011_712_1374 220
511 3300046536 Ga0495587_0105551 Ga0495587_0105551_200_862 220
512 3300046536 Ga0495587_0163382 Ga0495587_0163382_582_1244 220
513 3300046538 Ga0495609_0081665 Ga0495609_0081665_677_1339 220
514 3300046539 Ga0495621_0131042 Ga0495621_0131042_32_694 220
515 3300046542 Ga0495597_0086496 Ga0495597_0086496_649_1311 220
516 3300046557 Ga0495622_0061508 Ga0495622_0061508_73_735 220
517 3300046557 Ga0495622_0119892 Ga0495622_0119892_27_689 220
518 3300046559 Ga0495667_0120416 Ga0495667_0120416_802_1464 220
519 3300046559 Ga0495667_0171164 Ga0495667_0171164_36_698 220
520 3300046615 Ga0495656_0092782 Ga0495656_0092782_622_1284 220
521 3300046648 Ga0495611_0142583 Ga0495611_0142583_431_1093 220
522 3300046660 Ga0495625_0255675 Ga0495625_0255675_437_1099 220
523 3300046663 Ga0495635_0120038 Ga0495635_0120038_700_1362 220
524 3300046663 Ga0495635_0182652 Ga0495635_0182652_119_781 220
525 3300046664 Ga0495659_0070389 Ga0495659_0070389_61_723 220
526 3300046664 Ga0495659_0140511 Ga0495659_0140511_20_682 220
527 3300046665 Ga0495661_0122485 Ga0495661_0122485_747_1409 220
528 3300046674 Ga0495588_0171900 Ga0495588_0171900_45_707 220
529 3300046675 Ga0495657_0188526 Ga0495657_0188526_30_692 220
530 3300046675 Ga0495657_0393382 Ga0495657_0393382_46_708 220
531 3300046678 Ga0495599_0008661 Ga0495599_0008661_3344_4006 220
532 3300046678 Ga0495599_0235047 Ga0495599_0235047_355_1017 220
533 3300046679 Ga0495623_0135169 Ga0495623_0135169_576_1268 220
534 3300046680 Ga0495646_0077018 Ga0495646_0077018_1198_1860 220
535 3300046680 Ga0495646_0236440 Ga0495646_0236440_191_853 220
536 3300046681 Ga0495647_0062666 Ga0495647_0062666_663_1325 220
537 3300046681 Ga0495647_0082519 Ga0495647_0082519_287_949 220
538 3300046683 Ga0495658_0059032 Ga0495658_0059032_1218_1880 220
539 3300046683 Ga0495658_0156755 Ga0495658_0156755_587_1249 220
540 3300046684 Ga0495669_0036196 Ga0495669_0036196_1040_1702 220
541 3300046684 Ga0495669_0051179 Ga0495669_0051179_567_1229 220
542 3300046689 Ga0495613_0234196 Ga0495613_0234196_31_693 220
543 3300046691 Ga0495670_0171576 Ga0495670_0171576_65_727 220
544 3300046694 Ga0495649_0258789 Ga0495649_0258789_72_734 220
545 3300046809 Ga0495600_0177301 Ga0495600_0177301_72_734 220
546 3300046809 Ga0495600_0199381 Ga0495600_0199381_586_1248 220
547 3300047315 Ga0495581_0087187 Ga0495581_0087187_36_698 220
548 3300047315 Ga0495581_0118728 Ga0495581_0118728_589_1251 220
549 3300047319 Ga0495674_0266809 Ga0495674_0266809_588_1250 220
550 3300047320 Ga0495672_0196736 Ga0495672_0196736_86_748 220
551 3300047321 Ga0495676_0321392 Ga0495676_0321392_21_683 220
552 3300047322 Ga0495680_0076598 Ga0495680_0076598_1262_1924 220
553 3300047322 Ga0495680_0276493 Ga0495680_0276493_423_1085 220
554 3300047444 Ga0495675_0097658 Ga0495675_0097658_596_1258 220
555 3300047444 Ga0495675_0286350 Ga0495675_0286350_181_843 220
556 3300047445 Ga0495677_0022368 Ga0495677_0022368_1574_2236 220
557 3300047446 Ga0495679_045536 Ga0495679_045536_59_721 220
558 3300047446 Ga0495679_049392 Ga0495679_049392_576_1238 220
559 3300047469 Ga0495673_0108098 Ga0495673_0108098_392_1054 220
560 3300047470 Ga0495681_0051735 Ga0495681_0051735_627_1289 220
561 3300047471 Ga0495684_0202092 Ga0495684_0202092_699_1361 220
562 3300047471 Ga0495684_0227943 Ga0495684_0227943_279_941 220
563 3300047471 Ga0495684_0245427 Ga0495684_0245427_39_701 220
564 3300047472 Ga0495686_0151252 Ga0495686_0151252_136_798 220
565 3300048088 Ga0495602_0375685 Ga0495602_0375685_25_687 220
566 3300048088 Ga0495602_0550640 Ga0495602_0550640_36_698 220
567 3300048091 Ga0495626_0103871 Ga0495626_0103871_118_780 220
568 3300048903 Ga0496100_0025258 Ga0496100_0025258_40_702 220
569 3300048904 Ga0496101_0279904 Ga0496101_0279904_36_698 220
570 3300048905 Ga0496102_0229450 Ga0496102_0229450_32_694 220
571 3300048905 Ga0496102_0257075 Ga0496102_0257075_391_1053 220
572 3300048906 Ga0496103_0199825 Ga0496103_0199825_589_1251 220
573 3300048907 Ga0496104_0251060 Ga0496104_0251060_605_1267 220
574 3300048908 Ga0496105_0292269 Ga0496105_0292269_606_1268 220
575 3300048909 Ga0496106_0295973 Ga0496106_0295973_38_700 220
576 3300048910 Ga0496107_0243031 Ga0496107_0243031_40_702 220
577 3300048911 Ga0496108_0124919 Ga0496108_0124919_895_1557 220
578 3300048912 Ga0496109_0380943 Ga0496109_0380943_609_1271 220
579 3300048913 Ga0496110_0178041 Ga0496110_0178041_588_1250 220
580 3300048914 Ga0496111_0250861 Ga0496111_0250861_66_728 220
581 3300048915 Ga0496112_0427714 Ga0496112_0427714_567_1229 220
582 3300048916 Ga0496113_0229368 Ga0496113_0229368_770_1432 220
583 3300048917 Ga0496114_0260894 Ga0496114_0260894_827_1489 220
584 3300048917 Ga0496114_0371639 Ga0496114_0371639_576_1238 220
585 3300048918 Ga0496115_0297595 Ga0496115_0297595_21_683 220
586 3300048918 Ga0496115_0316283 Ga0496115_0316283_602_1264 220
587 3300048922 Ga0496119_0127521 Ga0496119_0127521_651_1313 220
588 3300048923 Ga0496120_0103466 Ga0496120_0103466_738_1400 220
589 3300048924 Ga0496121_0238355 Ga0496121_0238355_111_773 220
590 3300048928 Ga0496125_0193640 Ga0496125_0193640_100_762 220
591 3300048929 Ga0496126_0108059 Ga0496126_0108059_166_828 220
592 3300049459 Ga0495678_081247 Ga0495678_081247_30_692 220
593 3300050507 nmdc:mga05p37_1031821_c1 nmdc:mga05p37_1031821_c1_155_817 220
594 3300050508 nmdc:mga09592_381845_c1 nmdc:mga09592_381845_c1_167_829 220
595 3300050510 nmdc:mga06r32_249229_c1 nmdc:mga06r32_249229_c1_85_747 220
596 3300050512 nmdc:mga0n895_356403_c1 nmdc:mga0n895_356403_c1_578_1240 220
597 3300050513 nmdc:mga0rr50_236315_c1 nmdc:mga0rr50_236315_c1_715_1377 220
598 3300050514 nmdc:mga08x19_166146_c1 nmdc:mga08x19_166146_c1_252_914 220
599 3300050515 nmdc:mga0a205_46735_c1 nmdc:mga0a205_46735_c1_850_1512 220
600 3300053077 Ga0495601_0162326 Ga0495601_0162326_557_1219 220
601 3300053077 Ga0495601_0285206 Ga0495601_0285206_366_1028 220
602 3300053078 Ga0495612_0050704 Ga0495612_0050704_33_695 220
603 3300053078 Ga0495612_0086570 Ga0495612_0086570_584_1246 220
604 3300053083 Ga0495655_0025343 Ga0495655_0025343_665_1327 220
605 3300053084 Ga0495595_0050532 Ga0495595_0050532_662_1324 220
606 3300053084 Ga0495595_0093121 Ga0495595_0093121_613_1275 220
607 3300053084 Ga0495595_0116562 Ga0495595_0116562_583_1245 220
608 3300053085 Ga0495619_0093189 Ga0495619_0093189_54_716 220
609 3300053085 Ga0495619_0200182 Ga0495619_0200182_585_1247 220
610 3300005535 Ga0070684_100405804 Ga0070684_1004058041 221
611 3300035398 Ga0316574_0169693 Ga0316574_0169693_653_1333 221
612 3300035725 Ga0373947_0240860 Ga0373947_0240860_58_738 221
613 3300046674 Ga0495588_0146309 Ga0495588_0146309_130_822 221
614 3300000546 LJNas_1009304 LJNas_10093042 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13358

DDE_3

DDE superfamily endonuclease

17

166

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1itg-assembly1.cif.gz_A-2 crystal structure of the catalytic domain of hiv-1 integrase: similarity to other polynucleotidyl transferases 0.7369 24 147
7ouf-assembly1.cif.gz_D structure of the stlv intasome:b56 complex bound to the strand-transfer inhibitor xz450 0.7244 22 147
6qbv-assembly2.cif.gz_D structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form) 0.7192 23 168
6u8q-assembly1.cif.gz_J cryoem structure of hiv-1 cleaved synaptic complex (csc) intasome 0.712 25 169
6u8q-assembly1.cif.gz_L cryoem structure of hiv-1 cleaved synaptic complex (csc) intasome 0.6839 25 168
ID Description Score Start End Superfamily
af_P35443_731_958_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7834 64 88 2.60.120.200
af_I6YC39_133_303_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7359 30 188 3.30.420.10
af_Q8T132_51_168_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6975 52 168 3.30.420.10
af_Q559S3_126_326_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6957 9 193 3.30.420.10
af_Q8IZF6_28_218_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.6843 62 87 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A6B3MX84-F1-model_v4 IS630 family transposase 0.9841 64 190
AF-A0A2G2KKG6-F1-model_v4 deleted 0.9807 75 184
AF-A0A535VRX6-F1-model_v4 Tc1-like transposase DDE domain-containing protein 0.9778 77 193
AF-A0A840DCK1-F1-model_v4 deleted 0.9744 87 188
AF-A0A326U8B3-F1-model_v4 DDE superfamily endonuclease 0.9705 69 148 GO:0004519

Feature Viewer

pLDDT pTM Quality
83.48 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map