F469369
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 614 | 367 | 614 | 215 |
Family's Representative Sequence
| Representative Sequence | 3300039110|Ga0400487_24701|Ga0400487_24701_506_1120 |
| Length | 204 |
| Sequence | MEEVLDVYTQPHDPKKPLVCLDESSKQLVSETRTPLPRQPQRVDYEYERNGTANMFMLFAPLEGWRHVEVTDRRTAIDYAHILKDLSDVHFPHAKKIVLVQDNLNTHVKASLYEAFPPAEARRLAERFEWHYTPKHGSWLNMAESELGLLSTQCLDRRIPDKDSLTKEVAAWQDERNTNQTKANWRFTTDDARIKLKHLYPQFE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 96 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 97 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 98 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 112 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 113 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028010 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 183 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 184 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 185 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 186 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 187 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 188 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 189 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 190 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 192 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 198 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 202 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 208 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 216 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 220 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 224 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 227 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 228 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 229 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 230 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 231 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 232 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 233 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 234 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 235 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 236 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 237 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 238 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 239 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 243 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 244 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 245 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 246 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 330 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 331 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 332 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 333 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 334 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 335 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 338 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 339 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 340 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 341 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 342 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 343 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 344 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 345 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 346 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 347 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 348 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 367 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.19 |
| Metatranscriptomes | 0.81 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.33 |
| Nodule | 0 |
| Rhizoplane | 5.37 |
| Rhizosphere | 91.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1009304 | 3300000546 | Unclassified | 1052 |
| 2 | LJQas_1007314 | 3300000549 | Bacteria | 1358 |
| 3 | JGI24752J21851_1009895 | 3300001976 | Bacteria | 1244 |
| 4 | JGI24747J21853_1004312 | 3300001978 | Bacteria | 1270 |
| 5 | JGI24740J21852_10045097 | 3300001979 | Bacteria | 1303 |
| 6 | JGI24740J21852_10075945 | 3300001979 | Bacteria | 889 |
| 7 | JGI24737J22298_10052276 | 3300001990 | Bacteria | 1239 |
| 8 | JGI24750J21931_1009827 | 3300002070 | Bacteria | 1238 |
| 9 | JGI24750J21931_1016975 | 3300002070 | Bacteria | 992 |
| 10 | JGI24748J21848_1007540 | 3300002074 | Bacteria | 1276 |
| 11 | JGI24749J21850_1011151 | 3300002076 | Bacteria | 1261 |
| 12 | JGI24034J26672_10012414 | 3300002239 | Bacteria | 1283 |
| 13 | JGI24751J29686_10024765 | 3300002459 | Bacteria | 1245 |
| 14 | Ga0065712_10294727 | 3300005290 | Bacteria | 871 |
| 15 | Ga0070690_100193408 | 3300005330 | Bacteria | 1412 |
| 16 | Ga0070690_100217625 | 3300005330 | Bacteria | 1337 |
| 17 | Ga0070670_100277965 | 3300005331 | Bacteria | 1462 |
| 18 | Ga0070677_10088984 | 3300005333 | Bacteria | 1339 |
| 19 | Ga0068869_100294918 | 3300005334 | Bacteria | 1308 |
| 20 | Ga0070666_10217953 | 3300005335 | Bacteria | 1345 |
| 21 | Ga0070682_100130815 | 3300005337 | Bacteria | 1698 |
| 22 | Ga0070682_100217197 | 3300005337 | Bacteria | 1358 |
| 23 | Ga0068868_100298528 | 3300005338 | Bacteria | 1368 |
| 24 | Ga0068868_100672923 | 3300005338 | Bacteria | 923 |
| 25 | Ga0070689_100194321 | 3300005340 | Unclassified | 1653 |
| 26 | Ga0070689_100428101 | 3300005340 | Bacteria | 1123 |
| 27 | Ga0070692_10024795 | 3300005345 | Bacteria | 2952 |
| 28 | Ga0070692_10274236 | 3300005345 | Bacteria | 1020 |
| 29 | Ga0070668_100181686 | 3300005347 | Bacteria | 1718 |
| 30 | Ga0070668_100305387 | 3300005347 | Bacteria | 1335 |
| 31 | Ga0070669_100161499 | 3300005353 | Bacteria | 1741 |
| 32 | Ga0070669_100169988 | 3300005353 | Bacteria | 1699 |
| 33 | Ga0070669_100219479 | 3300005353 | Unclassified | 1503 |
| 34 | Ga0070675_100231302 | 3300005354 | Bacteria | 1613 |
| 35 | Ga0070675_100261716 | 3300005354 | Bacteria | 1516 |
| 36 | Ga0070671_100209000 | 3300005355 | Bacteria | 1655 |
| 37 | Ga0070674_100156992 | 3300005356 | Bacteria | 1722 |
| 38 | Ga0070674_100236618 | 3300005356 | Bacteria | 1428 |
| 39 | Ga0070673_100234245 | 3300005364 | Bacteria | 1594 |
| 40 | Ga0070688_100150405 | 3300005365 | Bacteria | 1591 |
| 41 | Ga0070667_100256829 | 3300005367 | Bacteria | 1563 |
| 42 | Ga0070703_10055876 | 3300005406 | Bacteria | 1276 |
| 43 | Ga0070709_10163286 | 3300005434 | Bacteria | 1550 |
| 44 | Ga0070714_100267764 | 3300005435 | Bacteria | 1584 |
| 45 | Ga0070714_100298437 | 3300005435 | Bacteria | 1501 |
| 46 | Ga0070713_100220181 | 3300005436 | Bacteria | 1721 |
| 47 | Ga0070713_100245247 | 3300005436 | Bacteria | 1632 |
| 48 | Ga0070713_100546207 | 3300005436 | Bacteria | 1097 |
| 49 | Ga0070710_10055173 | 3300005437 | Bacteria | 2244 |
| 50 | Ga0070710_10234253 | 3300005437 | Bacteria | 1173 |
| 51 | Ga0070701_10228335 | 3300005438 | Bacteria | 1114 |
| 52 | Ga0070711_100172050 | 3300005439 | Bacteria | 1651 |
| 53 | Ga0070705_100031342 | 3300005440 | Bacteria | 2943 |
| 54 | Ga0070700_100023878 | 3300005441 | Bacteria | 3582 |
| 55 | Ga0070700_100188483 | 3300005441 | Bacteria | 1440 |
| 56 | Ga0070700_100275602 | 3300005441 | Bacteria | 1217 |
| 57 | Ga0070694_100060592 | 3300005444 | Bacteria | 2581 |
| 58 | Ga0070663_100211000 | 3300005455 | Bacteria | 1520 |
| 59 | Ga0070663_100240531 | 3300005455 | Bacteria | 1428 |
| 60 | Ga0070678_100225253 | 3300005456 | Bacteria | 1560 |
| 61 | Ga0070662_100235103 | 3300005457 | Bacteria | 1468 |
| 62 | Ga0070685_10129047 | 3300005466 | Bacteria | 1579 |
| 63 | Ga0070707_100313956 | 3300005468 | Bacteria | 1523 |
| 64 | Ga0070698_100251229 | 3300005471 | Bacteria | 1701 |
| 65 | Ga0070679_100873568 | 3300005530 | Bacteria | 843 |
| 66 | Ga0070684_100405804 | 3300005535 | Bacteria | 1257 |
| 67 | Ga0070684_100413724 | 3300005535 | Bacteria | 1244 |
| 68 | Ga0070697_100258454 | 3300005536 | Bacteria | 1490 |
| 69 | Ga0070697_100280060 | 3300005536 | Archaea | 1431 |
| 70 | Ga0070697_100379988 | 3300005536 | Bacteria | 1223 |
| 71 | Ga0070672_100070100 | 3300005543 | Bacteria | 2785 |
| 72 | Ga0070672_100261161 | 3300005543 | Bacteria | 1460 |
| 73 | Ga0070686_100159854 | 3300005544 | Bacteria | 1586 |
| 74 | Ga0070695_100170794 | 3300005545 | Bacteria | 1534 |
| 75 | Ga0070695_100242763 | 3300005545 | Bacteria | 1307 |
| 76 | Ga0070696_100194093 | 3300005546 | Bacteria | 1512 |
| 77 | Ga0070693_100167707 | 3300005547 | Bacteria | 1404 |
| 78 | Ga0070693_100466283 | 3300005547 | Bacteria | 889 |
| 79 | Ga0070665_100289366 | 3300005548 | Bacteria | 1641 |
| 80 | Ga0070704_100155223 | 3300005549 | Bacteria | 1804 |
| 81 | Ga0070704_100296973 | 3300005549 | Bacteria | 1344 |
| 82 | Ga0068855_100488395 | 3300005563 | Bacteria | 1340 |
| 83 | Ga0070664_100319217 | 3300005564 | Bacteria | 1407 |
| 84 | Ga0068852_100393599 | 3300005616 | Bacteria | 1362 |
| 85 | Ga0068852_100395882 | 3300005616 | Bacteria | 1358 |
| 86 | Ga0068859_100324887 | 3300005617 | Unclassified | 1632 |
| 87 | Ga0068859_100552542 | 3300005617 | Bacteria | 1246 |
| 88 | Ga0068864_100208528 | 3300005618 | Unclassified | 1798 |
| 89 | Ga0068866_10152531 | 3300005718 | Bacteria | 1339 |
| 90 | Ga0068866_10181645 | 3300005718 | Unclassified | 1243 |
| 91 | Ga0068861_100284716 | 3300005719 | Bacteria | 1425 |
| 92 | Ga0068863_100191117 | 3300005841 | Bacteria | 1967 |
| 93 | Ga0068858_100221104 | 3300005842 | Bacteria | 1793 |
| 94 | Ga0068860_100425567 | 3300005843 | Bacteria | 1317 |
| 95 | Ga0068862_100027192 | 3300005844 | Bacteria | 4814 |
| 96 | Ga0068862_100253538 | 3300005844 | Bacteria | 1604 |
| 97 | Ga0070717_10409791 | 3300006028 | Bacteria | 1218 |
| 98 | Ga0075432_10062319 | 3300006058 | Bacteria | 1329 |
| 99 | Ga0070715_10015266 | 3300006163 | Bacteria | 2860 |
| 100 | Ga0070715_10019689 | 3300006163 | Bacteria | 2593 |
| 101 | Ga0070716_100181104 | 3300006173 | Bacteria | 1383 |
| 102 | Ga0070716_100201034 | 3300006173 | Archaea | 1325 |
| 103 | Ga0070712_100062090 | 3300006175 | Bacteria | 2641 |
| 104 | Ga0070712_100208698 | 3300006175 | Bacteria | 1539 |
| 105 | Ga0097621_100158145 | 3300006237 | Bacteria | 1946 |
| 106 | Ga0097621_100310672 | 3300006237 | Bacteria | 1394 |
| 107 | Ga0075428_100415815 | 3300006844 | Bacteria | 1441 |
| 108 | Ga0075433_10264528 | 3300006852 | Bacteria | 1524 |
| 109 | Ga0075434_100315336 | 3300006871 | Bacteria | 1584 |
| 110 | Ga0075434_100959759 | 3300006871 | Bacteria | 869 |
| 111 | Ga0068865_100220841 | 3300006881 | Bacteria | 1481 |
| 112 | Ga0068865_100311559 | 3300006881 | Unclassified | 1263 |
| 113 | Ga0075436_100195398 | 3300006914 | Bacteria | 1432 |
| 114 | Ga0097620_100324888 | 3300006931 | Unclassified | 1632 |
| 115 | Ga0097620_100552583 | 3300006931 | Bacteria | 1246 |
| 116 | Ga0075435_100436849 | 3300007076 | Bacteria | 1128 |
| 117 | Ga0075435_100456980 | 3300007076 | Bacteria | 1101 |
| 118 | Ga0105251_10098993 | 3300009011 | Bacteria | 1334 |
| 119 | Ga0105250_10087988 | 3300009092 | Bacteria | 1262 |
| 120 | Ga0105250_10138994 | 3300009092 | Bacteria | 1006 |
| 121 | Ga0111539_10285824 | 3300009094 | Bacteria | 1919 |
| 122 | Ga0105245_10322718 | 3300009098 | Unclassified | 1522 |
| 123 | Ga0105245_10567452 | 3300009098 | Bacteria | 1158 |
| 124 | Ga0105247_10033007 | 3300009101 | Bacteria | 3147 |
| 125 | Ga0105247_10116606 | 3300009101 | Bacteria | 1725 |
| 126 | Ga0114129_10565235 | 3300009147 | Bacteria | 1477 |
| 127 | Ga0105243_10265603 | 3300009148 | Bacteria | 1539 |
| 128 | Ga0105243_10278903 | 3300009148 | Bacteria | 1504 |
| 129 | Ga0105241_10217583 | 3300009174 | Bacteria | 1604 |
| 130 | Ga0105242_10240038 | 3300009176 | Bacteria | 1629 |
| 131 | Ga0105248_10303889 | 3300009177 | Bacteria | 1797 |
| 132 | Ga0105248_10396003 | 3300009177 | Bacteria | 1555 |
| 133 | Ga0105237_10264209 | 3300009545 | Bacteria | 1724 |
| 134 | Ga0105237_10396527 | 3300009545 | Bacteria | 1385 |
| 135 | Ga0105249_10385989 | 3300009553 | Bacteria | 1427 |
| 136 | Ga0105249_10580693 | 3300009553 | Bacteria | 1174 |
| 137 | Ga0105249_10612581 | 3300009553 | Bacteria | 1144 |
| 138 | Ga0099796_10012658 | 3300010159 | Bacteria | 2389 |
| 139 | Ga0099796_10022297 | 3300010159 | Bacteria | 1963 |
| 140 | Ga0105239_10429473 | 3300010375 | Bacteria | 1497 |
| 141 | Ga0105246_10187061 | 3300011119 | Bacteria | 1600 |
| 142 | Ga0105246_10187182 | 3300011119 | Bacteria | 1599 |
| 143 | Ga0157320_1001347 | 3300012481 | Bacteria | 1224 |
| 144 | Ga0157343_1000873 | 3300012488 | Bacteria | 1340 |
| 145 | Ga0157316_1001838 | 3300012510 | Bacteria | 1376 |
| 146 | Ga0157326_1010575 | 3300012513 | Bacteria | 1030 |
| 147 | Ga0157374_10200761 | 3300013296 | Bacteria | 1953 |
| 148 | Ga0157374_10263104 | 3300013296 | Unclassified | 1699 |
| 149 | Ga0157374_10578398 | 3300013296 | Bacteria | 1132 |
| 150 | Ga0157378_10563393 | 3300013297 | Bacteria | 1146 |
| 151 | Ga0163162_10249083 | 3300013306 | Bacteria | 1908 |
| 152 | Ga0163162_10268317 | 3300013306 | Bacteria | 1838 |
| 153 | Ga0163162_10437613 | 3300013306 | Bacteria | 1440 |
| 154 | Ga0163162_10658270 | 3300013306 | Bacteria | 1171 |
| 155 | Ga0157372_10439307 | 3300013307 | Bacteria | 1521 |
| 156 | Ga0157372_10926613 | 3300013307 | Bacteria | 1010 |
| 157 | Ga0157375_10314880 | 3300013308 | Bacteria | 1729 |
| 158 | Ga0163163_10128834 | 3300014325 | Bacteria | 2570 |
| 159 | Ga0163163_10228568 | 3300014325 | Bacteria | 1909 |
| 160 | Ga0157380_10110803 | 3300014326 | Bacteria | 2306 |
| 161 | Ga0157380_10196395 | 3300014326 | Bacteria | 1786 |
| 162 | Ga0157380_10516755 | 3300014326 | Bacteria | 1164 |
| 163 | Ga0157380_10676164 | 3300014326 | Bacteria | 1034 |
| 164 | Ga0182008_10102012 | 3300014497 | Bacteria | 1419 |
| 165 | Ga0182008_10242430 | 3300014497 | Bacteria | 928 |
| 166 | Ga0157377_10114385 | 3300014745 | Bacteria | 1626 |
| 167 | Ga0157379_10257689 | 3300014968 | Bacteria | 1584 |
| 168 | Ga0157379_10721234 | 3300014968 | Bacteria | 937 |
| 169 | Ga0157376_10248628 | 3300014969 | Bacteria | 1660 |
| 170 | Ga0157376_10411209 | 3300014969 | Bacteria | 1310 |
| 171 | Ga0157376_11044013 | 3300014969 | Bacteria | 841 |
| 172 | Ga0163161_10089097 | 3300017792 | Bacteria | 2282 |
| 173 | Ga0163161_10170915 | 3300017792 | Bacteria | 1662 |
| 174 | Ga0213873_10012241 | 3300021358 | Bacteria | 1856 |
| 175 | Ga0213873_10022256 | 3300021358 | Bacteria | 1499 |
| 176 | Ga0213873_10033300 | 3300021358 | Bacteria | 1292 |
| 177 | Ga0213872_10063787 | 3300021361 | Unclassified | 1664 |
| 178 | Ga0213872_10249431 | 3300021361 | Bacteria | 748 |
| 179 | Ga0207713_1072129 | 3300025735 | Bacteria | 1272 |
| 180 | Ga0207653_10056752 | 3300025885 | Bacteria | 1314 |
| 181 | Ga0207682_10097559 | 3300025893 | Bacteria | 1281 |
| 182 | Ga0207682_10104383 | 3300025893 | Bacteria | 1242 |
| 183 | Ga0207692_10163331 | 3300025898 | Bacteria | 1285 |
| 184 | Ga0207692_10217377 | 3300025898 | Bacteria | 1131 |
| 185 | Ga0207642_10086400 | 3300025899 | Bacteria | 1537 |
| 186 | Ga0207642_10140908 | 3300025899 | Bacteria | 1271 |
| 187 | Ga0207710_10106923 | 3300025900 | Bacteria | 1325 |
| 188 | Ga0207710_10112140 | 3300025900 | Bacteria | 1296 |
| 189 | Ga0207710_10244669 | 3300025900 | Bacteria | 896 |
| 190 | Ga0207647_10161445 | 3300025904 | Bacteria | 1307 |
| 191 | Ga0207685_10087709 | 3300025905 | Bacteria | 1303 |
| 192 | Ga0207685_10096525 | 3300025905 | Bacteria | 1256 |
| 193 | Ga0207685_10103049 | 3300025905 | Bacteria | 1224 |
| 194 | Ga0207699_10224717 | 3300025906 | Unclassified | 1283 |
| 195 | Ga0207699_10230211 | 3300025906 | Bacteria | 1269 |
| 196 | Ga0207699_10233244 | 3300025906 | Bacteria | 1261 |
| 197 | Ga0207699_10389649 | 3300025906 | Bacteria | 990 |
| 198 | Ga0207645_10314941 | 3300025907 | Bacteria | 1043 |
| 199 | Ga0207684_10154788 | 3300025910 | Bacteria | 1973 |
| 200 | Ga0207654_10193646 | 3300025911 | Bacteria | 1334 |
| 201 | Ga0207654_10210502 | 3300025911 | Bacteria | 1285 |
| 202 | Ga0207693_10169099 | 3300025915 | Bacteria | 1721 |
| 203 | Ga0207693_10277112 | 3300025915 | Bacteria | 1314 |
| 204 | Ga0207663_10082828 | 3300025916 | Bacteria | 2106 |
| 205 | Ga0207663_10274476 | 3300025916 | Bacteria | 1250 |
| 206 | Ga0207663_10495711 | 3300025916 | Bacteria | 948 |
| 207 | Ga0207660_10260174 | 3300025917 | Bacteria | 1372 |
| 208 | Ga0207662_10204676 | 3300025918 | Bacteria | 1279 |
| 209 | Ga0207657_10235849 | 3300025919 | Bacteria | 1462 |
| 210 | Ga0207649_10039942 | 3300025920 | Bacteria | 2848 |
| 211 | Ga0207652_10163267 | 3300025921 | Bacteria | 1997 |
| 212 | Ga0207646_10261174 | 3300025922 | Unclassified | 1565 |
| 213 | Ga0207681_10116371 | 3300025923 | Bacteria | 1953 |
| 214 | Ga0207681_10253657 | 3300025923 | Bacteria | 1374 |
| 215 | Ga0207694_10233380 | 3300025924 | Bacteria | 1503 |
| 216 | Ga0207694_10724396 | 3300025924 | Bacteria | 839 |
| 217 | Ga0207659_10281713 | 3300025926 | Bacteria | 1359 |
| 218 | Ga0207687_10355214 | 3300025927 | Bacteria | 1195 |
| 219 | Ga0207700_10143121 | 3300025928 | Bacteria | 1967 |
| 220 | Ga0207700_10426129 | 3300025928 | Bacteria | 1166 |
| 221 | Ga0207664_10376771 | 3300025929 | Bacteria | 1259 |
| 222 | Ga0207664_10510954 | 3300025929 | Bacteria | 1076 |
| 223 | Ga0207644_10300427 | 3300025931 | Bacteria | 1293 |
| 224 | Ga0207706_10101252 | 3300025933 | Bacteria | 2534 |
| 225 | Ga0207706_10235540 | 3300025933 | Bacteria | 1601 |
| 226 | Ga0207686_10182737 | 3300025934 | Bacteria | 1488 |
| 227 | Ga0207709_10160434 | 3300025935 | Bacteria | 1568 |
| 228 | Ga0207709_10245944 | 3300025935 | Bacteria | 1304 |
| 229 | Ga0207670_10117211 | 3300025936 | Bacteria | 1929 |
| 230 | Ga0207670_10679840 | 3300025936 | Bacteria | 851 |
| 231 | Ga0207669_10073704 | 3300025937 | Bacteria | 2155 |
| 232 | Ga0207665_10096435 | 3300025939 | Bacteria | 2057 |
| 233 | Ga0207711_10397443 | 3300025941 | Bacteria | 1280 |
| 234 | Ga0207689_10071181 | 3300025942 | Bacteria | 2856 |
| 235 | Ga0207689_10406533 | 3300025942 | Bacteria | 1135 |
| 236 | Ga0207661_10270516 | 3300025944 | Bacteria | 1516 |
| 237 | Ga0207651_10301483 | 3300025960 | Bacteria | 1332 |
| 238 | Ga0207712_10511526 | 3300025961 | Bacteria | 1028 |
| 239 | Ga0207712_10521189 | 3300025961 | Bacteria | 1019 |
| 240 | Ga0207668_10329638 | 3300025972 | Bacteria | 1269 |
| 241 | Ga0207677_10268314 | 3300026023 | Unclassified | 1395 |
| 242 | Ga0207703_10388540 | 3300026035 | Bacteria | 1292 |
| 243 | Ga0207703_10544164 | 3300026035 | Bacteria | 1094 |
| 244 | Ga0207639_10378727 | 3300026041 | Bacteria | 1270 |
| 245 | Ga0207678_10235817 | 3300026067 | Bacteria | 1567 |
| 246 | Ga0207678_10260133 | 3300026067 | Bacteria | 1487 |
| 247 | Ga0207708_10059501 | 3300026075 | Bacteria | 2916 |
| 248 | Ga0207708_10204450 | 3300026075 | Bacteria | 1576 |
| 249 | Ga0207702_10429796 | 3300026078 | Bacteria | 1278 |
| 250 | Ga0207641_10427368 | 3300026088 | Bacteria | 1276 |
| 251 | Ga0207641_10725845 | 3300026088 | Bacteria | 980 |
| 252 | Ga0207648_10206057 | 3300026089 | Bacteria | 1745 |
| 253 | Ga0207676_10403808 | 3300026095 | Bacteria | 1277 |
| 254 | Ga0207674_10219735 | 3300026116 | Bacteria | 1848 |
| 255 | Ga0207675_100155502 | 3300026118 | Bacteria | 2179 |
| 256 | Ga0207675_100247816 | 3300026118 | Bacteria | 1723 |
| 257 | Ga0207675_100422079 | 3300026118 | Bacteria | 1317 |
| 258 | Ga0207698_10377879 | 3300026142 | Bacteria | 1347 |
| 259 | Ga0207698_10662909 | 3300026142 | Bacteria | 1035 |
| 260 | Ga0209179_1005664 | 3300027512 | Bacteria | 1970 |
| 261 | Ga0207428_10236502 | 3300027907 | Bacteria | 1366 |
| 262 | Ga0207428_10274467 | 3300027907 | Bacteria | 1253 |
| 263 | Ga0207428_10275807 | 3300027907 | Bacteria | 1249 |
| 264 | Ga0265358_100363 | 3300028010 | Bacteria | 1079 |
| 265 | Ga0268266_10408129 | 3300028379 | Bacteria | 1285 |
| 266 | Ga0268265_10253029 | 3300028380 | Bacteria | 1561 |
| 267 | Ga0268265_10544471 | 3300028380 | Bacteria | 1101 |
| 268 | Ga0268265_10575630 | 3300028380 | Bacteria | 1072 |
| 269 | Ga0268264_10345921 | 3300028381 | Bacteria | 1414 |
| 270 | Ga0265338_10268663 | 3300028800 | Bacteria | 1250 |
| 271 | Ga0265762_1011759 | 3300030760 | Bacteria | 1565 |
| 272 | Ga0265763_1005294 | 3300030763 | Bacteria | 1080 |
| 273 | Ga0265773_1001105 | 3300031018 | Bacteria | 1358 |
| 274 | Ga0265760_10030744 | 3300031090 | Bacteria | 1582 |
| 275 | Ga0265760_10047742 | 3300031090 | Bacteria | 1286 |
| 276 | Ga0265332_10069819 | 3300031238 | Bacteria | 1497 |
| 277 | Ga0265329_10032896 | 3300031242 | Bacteria | 1679 |
| 278 | Ga0265339_10186939 | 3300031249 | Bacteria | 1029 |
| 279 | Ga0265331_10092924 | 3300031250 | Bacteria | 1393 |
| 280 | Ga0265327_10105138 | 3300031251 | Unclassified | 1356 |
| 281 | Ga0265316_10054843 | 3300031344 | Bacteria | 3119 |
| 282 | Ga0265314_10111864 | 3300031711 | Bacteria | 1734 |
| 283 | Ga0316583_10024255 | 3300032133 | Bacteria | 2166 |
| 284 | Ga0373930_0015479 | 3300034816 | Bacteria | 1432 |
| 285 | Ga0373930_0017154 | 3300034816 | Bacteria | 1377 |
| 286 | Ga0373948_0016294 | 3300034817 | Bacteria | 1372 |
| 287 | Ga0373948_0018967 | 3300034817 | Bacteria | 1296 |
| 288 | Ga0373950_0012908 | 3300034818 | Bacteria | 1387 |
| 289 | Ga0373950_0013245 | 3300034818 | Bacteria | 1372 |
| 290 | Ga0373958_0018183 | 3300034819 | Bacteria | 1271 |
| 291 | Ga0373959_0010516 | 3300034820 | Bacteria | 1617 |
| 292 | Ga0373938_0002013 | 3300034957 | Bacteria | 3253 |
| 293 | Ga0373926_0047951 | 3300035083 | Bacteria | 1535 |
| 294 | Ga0373926_0057683 | 3300035083 | Bacteria | 1410 |
| 295 | Ga0373928_0015895 | 3300035084 | Bacteria | 1535 |
| 296 | Ga0373929_0020446 | 3300035085 | Bacteria | 1334 |
| 297 | Ga0373934_0071003 | 3300035086 | Bacteria | 1392 |
| 298 | Ga0373940_0004593 | 3300035088 | Bacteria | 2928 |
| 299 | Ga0373940_0041201 | 3300035088 | Unclassified | 1269 |
| 300 | Ga0373944_0092442 | 3300035089 | Bacteria | 1012 |
| 301 | Ga0373949_0007543 | 3300035090 | Bacteria | 2382 |
| 302 | Ga0373949_0022060 | 3300035090 | Bacteria | 1465 |
| 303 | Ga0373951_0030647 | 3300035091 | Bacteria | 1266 |
| 304 | Ga0373952_0018771 | 3300035092 | Bacteria | 1433 |
| 305 | Ga0373952_0023655 | 3300035092 | Bacteria | 1314 |
| 306 | Ga0373923_0141262 | 3300035111 | Bacteria | 1088 |
| 307 | Ga0373923_0175266 | 3300035111 | Unclassified | 983 |
| 308 | Ga0373932_0004499 | 3300035112 | Bacteria | 3292 |
| 309 | Ga0373932_0061720 | 3300035112 | Bacteria | 1141 |
| 310 | Ga0373936_0091987 | 3300035113 | Bacteria | 1272 |
| 311 | Ga0373936_0103750 | 3300035113 | Bacteria | 1201 |
| 312 | Ga0373939_0032079 | 3300035114 | Bacteria | 1523 |
| 313 | Ga0373939_0070210 | 3300035114 | Bacteria | 1138 |
| 314 | Ga0373939_0163206 | 3300035114 | Bacteria | 819 |
| 315 | Ga0373941_0038987 | 3300035115 | Bacteria | 1457 |
| 316 | Ga0373945_0075038 | 3300035116 | Bacteria | 1286 |
| 317 | Ga0373945_0106709 | 3300035116 | Bacteria | 1101 |
| 318 | Ga0373953_0048086 | 3300035117 | Bacteria | 1717 |
| 319 | Ga0373953_0332699 | 3300035117 | Bacteria | 664 |
| 320 | Ga0373954_0016753 | 3300035118 | Bacteria | 3285 |
| 321 | Ga0373954_0065360 | 3300035118 | Bacteria | 1721 |
| 322 | Ga0373954_0105389 | 3300035118 | Unclassified | 1361 |
| 323 | Ga0373954_0116609 | 3300035118 | Bacteria | 1294 |
| 324 | Ga0373954_0151850 | 3300035118 | Bacteria | 1131 |
| 325 | Ga0373956_0122396 | 3300035119 | Bacteria | 1215 |
| 326 | Ga0373956_0124805 | 3300035119 | Bacteria | 1203 |
| 327 | Ga0373956_0166860 | 3300035119 | Unclassified | 1038 |
| 328 | Ga0373957_0082945 | 3300035120 | Bacteria | 1267 |
| 329 | Ga0373957_0117767 | 3300035120 | Bacteria | 1073 |
| 330 | Ga0373957_0128075 | 3300035120 | Unclassified | 1031 |
| 331 | Ga0373957_0136479 | 3300035120 | Bacteria | 1001 |
| 332 | Ga0373960_0029905 | 3300035121 | Bacteria | 1513 |
| 333 | Ga0373960_0056940 | 3300035121 | Bacteria | 1175 |
| 334 | Ga0373943_0128790 | 3300035170 | Bacteria | 1352 |
| 335 | Ga0373943_0140078 | 3300035170 | Bacteria | 1302 |
| 336 | Ga0373943_0197320 | 3300035170 | Unclassified | 1112 |
| 337 | Ga0373943_0283310 | 3300035170 | Bacteria | 937 |
| 338 | Ga0373943_0357715 | 3300035170 | Unclassified | 838 |
| 339 | Ga0373943_0557723 | 3300035170 | Bacteria | 672 |
| 340 | Ga0373946_0051273 | 3300035171 | Bacteria | 1726 |
| 341 | Ga0373946_0115994 | 3300035171 | Bacteria | 1217 |
| 342 | Ga0373955_0099827 | 3300035172 | Bacteria | 1664 |
| 343 | Ga0373955_0205021 | 3300035172 | Bacteria | 1174 |
| 344 | Ga0373955_0234417 | 3300035172 | Bacteria | 1098 |
| 345 | Ga0373955_0344107 | 3300035172 | Unclassified | 902 |
| 346 | Ga0373942_0005145 | 3300035207 | Bacteria | 3030 |
| 347 | Ga0373942_0021769 | 3300035207 | Bacteria | 1620 |
| 348 | Ga0373961_0035680 | 3300035241 | Bacteria | 1412 |
| 349 | Ga0373962_0038023 | 3300035242 | Bacteria | 1345 |
| 350 | Ga0316574_0169693 | 3300035398 | Bacteria | 1405 |
| 351 | Ga0373924_0054798 | 3300035410 | Bacteria | 1658 |
| 352 | Ga0373924_0055860 | 3300035410 | Bacteria | 1643 |
| 353 | Ga0373931_0115407 | 3300035691 | Bacteria | 1528 |
| 354 | Ga0373931_0144663 | 3300035691 | Bacteria | 1380 |
| 355 | Ga0373931_0265719 | 3300035691 | Bacteria | 1048 |
| 356 | Ga0373935_0344782 | 3300035692 | Bacteria | 1061 |
| 357 | Ga0373935_0586405 | 3300035692 | Bacteria | 814 |
| 358 | Ga0373927_0038780 | 3300035695 | Bacteria | 3092 |
| 359 | Ga0373933_0057667 | 3300035724 | Bacteria | 2334 |
| 360 | Ga0373933_0062968 | 3300035724 | Bacteria | 2241 |
| 361 | Ga0373933_0104883 | 3300035724 | Bacteria | 1757 |
| 362 | Ga0373933_0116994 | 3300035724 | Bacteria | 1666 |
| 363 | Ga0373933_0201601 | 3300035724 | Unclassified | 1273 |
| 364 | Ga0373933_0228993 | 3300035724 | Bacteria | 1193 |
| 365 | Ga0373947_0124599 | 3300035725 | Bacteria | 1639 |
| 366 | Ga0373947_0175609 | 3300035725 | Bacteria | 1392 |
| 367 | Ga0373947_0240860 | 3300035725 | Bacteria | 1194 |
| 368 | Ga0373947_0691831 | 3300035725 | Bacteria | 695 |
| 369 | Ga0373947_0728482 | 3300035725 | Bacteria | 676 |
| 370 | Ga0373937_0110242 | 3300036401 | Bacteria | 2559 |
| 371 | Ga0373937_0564011 | 3300036401 | Bacteria | 1081 |
| 372 | Ga0373937_0587398 | 3300036401 | Unclassified | 1057 |
| 373 | Ga0373937_0902159 | 3300036401 | Bacteria | 832 |
| 374 | Ga0316582_0148230 | 3300036647 | Bacteria | 1585 |
| 375 | Ga0316582_0189301 | 3300036647 | Bacteria | 1401 |
| 376 | Ga0316582_0481339 | 3300036647 | Bacteria | 855 |
| 377 | Ga0316582_0611568 | 3300036647 | Archaea | 750 |
| 378 | Ga0316584_0375074 | 3300036712 | Bacteria | 1018 |
| 379 | Ga0373925_0111342 | 3300037068 | Bacteria | 2115 |
| 380 | Ga0373925_0306714 | 3300037068 | Bacteria | 1282 |
| 381 | Ga0373925_0312397 | 3300037068 | Bacteria | 1270 |
| 382 | Ga0373925_0539941 | 3300037068 | Bacteria | 958 |
| 383 | Ga0373925_0558770 | 3300037068 | Unclassified | 941 |
| 384 | Ga0316581_0133591 | 3300037588 | Bacteria | 765 |
| 385 | Ga0436364_0253569 | 3300037853 | Bacteria | 1291 |
| 386 | Ga0436364_1428445 | 3300037853 | Bacteria | 1124 |
| 387 | Ga0400488_24956 | 3300038741 | Unclassified | 1835 |
| 388 | Ga0400486_26827 | 3300038742 | Unclassified | 1163 |
| 389 | Ga0242420_015228 | 3300038996 | Bacteria | 1328 |
| 390 | Ga0400483_093872 | 3300039062 | Unclassified | 2058 |
| 391 | Ga0400489_94519 | 3300039093 | Unclassified | 1291 |
| 392 | Ga0400487_24701 | 3300039110 | Unclassified | 1681 |
| 393 | Ga0436365_1326345 | 3300039437 | Bacteria | 1427 |
| 394 | Ga0436360_0253839 | 3300039438 | Bacteria | 1411 |
| 395 | Ga0436360_0338933 | 3300039438 | Bacteria | 1644 |
| 396 | Ga0436360_0565704 | 3300039438 | Bacteria | 1382 |
| 397 | Ga0436360_0655878 | 3300039438 | Bacteria | 1602 |
| 398 | Ga0436360_0826069 | 3300039438 | Bacteria | 2225 |
| 399 | Ga0436361_0087236 | 3300039447 | Bacteria | 1553 |
| 400 | Ga0436361_0831350 | 3300039447 | Unclassified | 4315 |
| 401 | Ga0436363_0703516 | 3300039450 | Bacteria | 2179 |
| 402 | Ga0436363_1289363 | 3300039450 | Bacteria | 970 |
| 403 | Ga0436362_0035050 | 3300039453 | Bacteria | 1564 |
| 404 | Ga0436362_0529634 | 3300039453 | Bacteria | 2134 |
| 405 | Ga0436362_0553569 | 3300039453 | Unclassified | 4182 |
| 406 | Ga0436362_1169919 | 3300039453 | Bacteria | 1913 |
| 407 | Ga0436362_1201376 | 3300039453 | Bacteria | 1398 |
| 408 | Ga0451787_695444 | 3300041441 | Bacteria | 923 |
| 409 | Ga0451791_0237627 | 3300041451 | Bacteria | 1486 |
| 410 | Ga0451807_1352859 | 3300041486 | Bacteria | 1575 |
| 411 | Ga0451853_0221274 | 3300041512 | Bacteria | 933 |
| 412 | Ga0466966_0268924 | 3300044684 | Bacteria | 1026 |
| 413 | Ga0466957_0225653 | 3300044842 | Bacteria | 1238 |
| 414 | Ga0466959_0150606 | 3300045049 | Bacteria | 1640 |
| 415 | Ga0451576_0444513 | 3300045051 | Bacteria | 1361 |
| 416 | Ga0466967_0229030 | 3300045976 | Bacteria | 1769 |
| 417 | Ga0495617_052334 | 3300046452 | Bacteria | 1356 |
| 418 | Ga0495627_041489 | 3300046453 | Bacteria | 1412 |
| 419 | Ga0495592_0190922 | 3300046454 | Unclassified | 1388 |
| 420 | Ga0495592_0454798 | 3300046454 | Bacteria | 801 |
| 421 | Ga0495603_0176072 | 3300046455 | Bacteria | 1238 |
| 422 | Ga0495629_0120514 | 3300046459 | Bacteria | 1827 |
| 423 | Ga0495629_0187430 | 3300046459 | Bacteria | 1432 |
| 424 | Ga0495638_0047087 | 3300046460 | Bacteria | 2705 |
| 425 | Ga0495641_0086200 | 3300046461 | Bacteria | 1405 |
| 426 | Ga0495641_0315995 | 3300046461 | Bacteria | 704 |
| 427 | Ga0495651_0178792 | 3300046462 | Bacteria | 1503 |
| 428 | Ga0495651_0455277 | 3300046462 | Unclassified | 826 |
| 429 | Ga0495653_0025897 | 3300046463 | Bacteria | 4707 |
| 430 | Ga0495653_0092011 | 3300046463 | Bacteria | 2215 |
| 431 | Ga0495653_0339912 | 3300046463 | Bacteria | 968 |
| 432 | Ga0495580_0228253 | 3300046472 | Bacteria | 1278 |
| 433 | Ga0495580_0259441 | 3300046472 | Bacteria | 1188 |
| 434 | Ga0495580_0375698 | 3300046472 | Unclassified | 960 |
| 435 | Ga0495582_0089380 | 3300046473 | Bacteria | 1716 |
| 436 | Ga0495605_0109710 | 3300046474 | Bacteria | 1260 |
| 437 | Ga0495639_0121043 | 3300046475 | Bacteria | 1248 |
| 438 | Ga0495639_0134233 | 3300046475 | Bacteria | 1186 |
| 439 | Ga0495639_0281447 | 3300046475 | Bacteria | 826 |
| 440 | Ga0495662_0118388 | 3300046476 | Bacteria | 1299 |
| 441 | Ga0495662_0151643 | 3300046476 | Bacteria | 1141 |
| 442 | Ga0495664_0123847 | 3300046477 | Bacteria | 1563 |
| 443 | Ga0495584_0134961 | 3300046491 | Bacteria | 1252 |
| 444 | Ga0495585_0101489 | 3300046492 | Bacteria | 1538 |
| 445 | Ga0495585_0174709 | 3300046492 | Bacteria | 1107 |
| 446 | Ga0495585_0208850 | 3300046492 | Bacteria | 990 |
| 447 | Ga0495607_0113260 | 3300046501 | Bacteria | 1435 |
| 448 | Ga0495607_0121125 | 3300046501 | Bacteria | 1373 |
| 449 | Ga0495607_0153659 | 3300046501 | Bacteria | 1175 |
| 450 | Ga0495583_0136072 | 3300046506 | Bacteria | 1025 |
| 451 | Ga0495608_0157802 | 3300046511 | Bacteria | 1443 |
| 452 | Ga0495608_0166946 | 3300046511 | Unclassified | 1397 |
| 453 | Ga0495610_0173193 | 3300046512 | Bacteria | 903 |
| 454 | Ga0495616_0127241 | 3300046513 | Bacteria | 1170 |
| 455 | Ga0495618_0157177 | 3300046514 | Bacteria | 1450 |
| 456 | Ga0495618_0244080 | 3300046514 | Unclassified | 1128 |
| 457 | Ga0495620_0073600 | 3300046515 | Bacteria | 1392 |
| 458 | Ga0495628_0246893 | 3300046516 | Bacteria | 1334 |
| 459 | Ga0495628_0648935 | 3300046516 | Bacteria | 749 |
| 460 | Ga0495630_0889462 | 3300046517 | Bacteria | 678 |
| 461 | Ga0495631_0097927 | 3300046518 | Bacteria | 1262 |
| 462 | Ga0495637_0076635 | 3300046520 | Bacteria | 1339 |
| 463 | Ga0495644_0067314 | 3300046523 | Bacteria | 1345 |
| 464 | Ga0495644_0073083 | 3300046523 | Bacteria | 1289 |
| 465 | Ga0495644_0117559 | 3300046523 | Bacteria | 1010 |
| 466 | Ga0495663_0008196 | 3300046525 | Bacteria | 2891 |
| 467 | Ga0495663_0040176 | 3300046525 | Bacteria | 1419 |
| 468 | Ga0495666_0158668 | 3300046526 | Bacteria | 1049 |
| 469 | Ga0495652_0239407 | 3300046529 | Bacteria | 1351 |
| 470 | Ga0495654_0084036 | 3300046530 | Bacteria | 1487 |
| 471 | Ga0495665_0137171 | 3300046531 | Bacteria | 1279 |
| 472 | Ga0495640_0044700 | 3300046533 | Bacteria | 3078 |
| 473 | Ga0495640_0168011 | 3300046533 | Bacteria | 1402 |
| 474 | Ga0495587_0105551 | 3300046536 | Bacteria | 1620 |
| 475 | Ga0495587_0163382 | 3300046536 | Bacteria | 1266 |
| 476 | Ga0495598_0004548 | 3300046537 | Bacteria | 3012 |
| 477 | Ga0495609_0081665 | 3300046538 | Bacteria | 1412 |
| 478 | Ga0495621_0004061 | 3300046539 | Bacteria | 4074 |
| 479 | Ga0495621_0131042 | 3300046539 | Bacteria | 975 |
| 480 | Ga0495597_0086496 | 3300046542 | Bacteria | 1334 |
| 481 | Ga0495645_0614190 | 3300046543 | Bacteria | 667 |
| 482 | Ga0495622_0061508 | 3300046557 | Bacteria | 1738 |
| 483 | Ga0495622_0119892 | 3300046557 | Bacteria | 1201 |
| 484 | Ga0495667_0120416 | 3300046559 | Bacteria | 1694 |
| 485 | Ga0495667_0171164 | 3300046559 | Bacteria | 1395 |
| 486 | Ga0495656_0092782 | 3300046615 | Bacteria | 1383 |
| 487 | Ga0495656_0182862 | 3300046615 | Bacteria | 1031 |
| 488 | Ga0495634_0576316 | 3300046642 | Bacteria | 654 |
| 489 | Ga0495611_0142583 | 3300046648 | Bacteria | 1118 |
| 490 | Ga0495625_0255675 | 3300046660 | Bacteria | 1135 |
| 491 | Ga0495635_0053326 | 3300046663 | Bacteria | 2786 |
| 492 | Ga0495635_0120038 | 3300046663 | Bacteria | 1793 |
| 493 | Ga0495635_0182652 | 3300046663 | Unclassified | 1425 |
| 494 | Ga0495635_0531062 | 3300046663 | Bacteria | 772 |
| 495 | Ga0495659_0070389 | 3300046664 | Bacteria | 1309 |
| 496 | Ga0495659_0140511 | 3300046664 | Bacteria | 963 |
| 497 | Ga0495661_0122485 | 3300046665 | Bacteria | 1434 |
| 498 | Ga0495588_0146309 | 3300046674 | Bacteria | 1249 |
| 499 | Ga0495588_0171900 | 3300046674 | Bacteria | 1145 |
| 500 | Ga0495657_0188526 | 3300046675 | Bacteria | 1261 |
| 501 | Ga0495657_0393382 | 3300046675 | Unclassified | 816 |
| 502 | Ga0495599_0008661 | 3300046678 | Bacteria | 6190 |
| 503 | Ga0495599_0235047 | 3300046678 | Bacteria | 1118 |
| 504 | Ga0495623_0135169 | 3300046679 | Bacteria | 1472 |
| 505 | Ga0495646_0077018 | 3300046680 | Bacteria | 1951 |
| 506 | Ga0495646_0236440 | 3300046680 | Unclassified | 983 |
| 507 | Ga0495647_0062666 | 3300046681 | Bacteria | 1470 |
| 508 | Ga0495647_0082519 | 3300046681 | Bacteria | 1305 |
| 509 | Ga0495658_0059032 | 3300046683 | Bacteria | 2195 |
| 510 | Ga0495658_0156755 | 3300046683 | Bacteria | 1401 |
| 511 | Ga0495669_0036196 | 3300046684 | Bacteria | 2181 |
| 512 | Ga0495669_0051179 | 3300046684 | Bacteria | 1853 |
| 513 | Ga0495613_0234196 | 3300046689 | Bacteria | 1285 |
| 514 | Ga0495670_0171576 | 3300046691 | Bacteria | 1142 |
| 515 | Ga0495671_0030929 | 3300046692 | Bacteria | 2739 |
| 516 | Ga0495671_0370974 | 3300046692 | Bacteria | 686 |
| 517 | Ga0495649_0258789 | 3300046694 | Bacteria | 892 |
| 518 | Ga0495600_0177301 | 3300046809 | Unclassified | 1374 |
| 519 | Ga0495600_0199381 | 3300046809 | Bacteria | 1285 |
| 520 | Ga0495581_0087187 | 3300047315 | Bacteria | 1809 |
| 521 | Ga0495581_0118728 | 3300047315 | Bacteria | 1538 |
| 522 | Ga0495604_0642258 | 3300047317 | Bacteria | 677 |
| 523 | Ga0495674_0053893 | 3300047319 | Bacteria | 3534 |
| 524 | Ga0495674_0266809 | 3300047319 | Bacteria | 1405 |
| 525 | Ga0495674_0447729 | 3300047319 | Bacteria | 1038 |
| 526 | Ga0495672_0196736 | 3300047320 | Bacteria | 1010 |
| 527 | Ga0495676_0321392 | 3300047321 | Bacteria | 1039 |
| 528 | Ga0495680_0076598 | 3300047322 | Bacteria | 2535 |
| 529 | Ga0495680_0276493 | 3300047322 | Unclassified | 1184 |
| 530 | Ga0495675_0097658 | 3300047444 | Bacteria | 1840 |
| 531 | Ga0495675_0286350 | 3300047444 | Bacteria | 981 |
| 532 | Ga0495677_0022368 | 3300047445 | Bacteria | 2293 |
| 533 | Ga0495679_045536 | 3300047446 | Bacteria | 1339 |
| 534 | Ga0495679_049392 | 3300047446 | Bacteria | 1269 |
| 535 | Ga0495673_0108098 | 3300047469 | Bacteria | 1115 |
| 536 | Ga0495681_0051735 | 3300047470 | Bacteria | 1930 |
| 537 | Ga0495684_0202092 | 3300047471 | Bacteria | 1464 |
| 538 | Ga0495684_0227943 | 3300047471 | Bacteria | 1363 |
| 539 | Ga0495684_0245427 | 3300047471 | Bacteria | 1304 |
| 540 | Ga0495684_0265144 | 3300047471 | Bacteria | 1245 |
| 541 | Ga0495686_0151252 | 3300047472 | Bacteria | 1362 |
| 542 | Ga0495602_0375685 | 3300048088 | Unclassified | 1019 |
| 543 | Ga0495602_0550640 | 3300048088 | Bacteria | 799 |
| 544 | Ga0495615_0022301 | 3300048090 | Bacteria | 1439 |
| 545 | Ga0495626_0103871 | 3300048091 | Bacteria | 1236 |
| 546 | Ga0496100_0025258 | 3300048903 | Bacteria | 3632 |
| 547 | Ga0496100_0368820 | 3300048903 | Bacteria | 1088 |
| 548 | Ga0496101_0100205 | 3300048904 | Bacteria | 2167 |
| 549 | Ga0496101_0279904 | 3300048904 | Bacteria | 1303 |
| 550 | Ga0496102_0229450 | 3300048905 | Bacteria | 1750 |
| 551 | Ga0496102_0257075 | 3300048905 | Bacteria | 1646 |
| 552 | Ga0496103_0199825 | 3300048906 | Bacteria | 1286 |
| 553 | Ga0496103_0231580 | 3300048906 | Bacteria | 1188 |
| 554 | Ga0496104_0251060 | 3300048907 | Unclassified | 1681 |
| 555 | Ga0496104_0288489 | 3300048907 | Bacteria | 1553 |
| 556 | Ga0496105_0267151 | 3300048908 | Bacteria | 1382 |
| 557 | Ga0496105_0292269 | 3300048908 | Unclassified | 1311 |
| 558 | Ga0496106_0295973 | 3300048909 | Bacteria | 1297 |
| 559 | Ga0496107_0243031 | 3300048910 | Bacteria | 1339 |
| 560 | Ga0496108_0124919 | 3300048911 | Bacteria | 2208 |
| 561 | Ga0496108_0274540 | 3300048911 | Bacteria | 1467 |
| 562 | Ga0496109_0380943 | 3300048912 | Bacteria | 1332 |
| 563 | Ga0496110_0140961 | 3300048913 | Bacteria | 2179 |
| 564 | Ga0496110_0178041 | 3300048913 | Bacteria | 1930 |
| 565 | Ga0496111_0250861 | 3300048914 | Bacteria | 1313 |
| 566 | Ga0496111_0254366 | 3300048914 | Bacteria | 1303 |
| 567 | Ga0496112_0427714 | 3300048915 | Bacteria | 1262 |
| 568 | Ga0496113_0229368 | 3300048916 | Bacteria | 1480 |
| 569 | Ga0496114_0260894 | 3300048917 | Bacteria | 1525 |
| 570 | Ga0496114_0360220 | 3300048917 | Bacteria | 1286 |
| 571 | Ga0496114_0371639 | 3300048917 | Bacteria | 1265 |
| 572 | Ga0496115_0297595 | 3300048918 | Bacteria | 1322 |
| 573 | Ga0496115_0315903 | 3300048918 | Bacteria | 1278 |
| 574 | Ga0496115_0316283 | 3300048918 | Bacteria | 1277 |
| 575 | Ga0496115_0912715 | 3300048918 | Bacteria | 676 |
| 576 | Ga0496119_0127521 | 3300048922 | Bacteria | 1390 |
| 577 | Ga0496120_0103466 | 3300048923 | Bacteria | 1500 |
| 578 | Ga0496121_0238355 | 3300048924 | Bacteria | 1269 |
| 579 | Ga0496125_0193640 | 3300048928 | Bacteria | 1339 |
| 580 | Ga0496126_0108059 | 3300048929 | Bacteria | 2426 |
| 581 | Ga0496126_0308172 | 3300048929 | Bacteria | 1304 |
| 582 | Ga0495678_081247 | 3300049459 | Bacteria | 1163 |
| 583 | Ga0501039_0413753 | 3300049575 | Bacteria | 1059 |
| 584 | Ga0501046_0246115 | 3300049580 | Bacteria | 1317 |
| 585 | Ga0501072_0269385 | 3300049588 | Bacteria | 1355 |
| 586 | Ga0501081_0231291 | 3300049743 | Bacteria | 1346 |
| 587 | nmdc:mga05p37_1031821_c1 | 3300050507 | Bacteria | 870 |
| 588 | nmdc:mga09592_381845_c1 | 3300050508 | Bacteria | 1218 |
| 589 | nmdc:mga06r32_249229_c1 | 3300050510 | Bacteria | 1763 |
| 590 | nmdc:mga08y16_261911_c1 | 3300050511 | Bacteria | 1786 |
| 591 | nmdc:mga0n895_157690_c1 | 3300050512 | Bacteria | 2301 |
| 592 | nmdc:mga0n895_338720_c1 | 3300050512 | Bacteria | 1524 |
| 593 | nmdc:mga0n895_356403_c1 | 3300050512 | Bacteria | 1482 |
| 594 | nmdc:mga0n895_606241_c1 | 3300050512 | Bacteria | 1097 |
| 595 | nmdc:mga0n895_981656_c1 | 3300050512 | Bacteria | 827 |
| 596 | nmdc:mga0rr50_236315_c1 | 3300050513 | Bacteria | 1514 |
| 597 | nmdc:mga0rr50_313780_c1 | 3300050513 | Bacteria | 1314 |
| 598 | nmdc:mga08x19_166146_c1 | 3300050514 | Bacteria | 1501 |
| 599 | nmdc:mga08x19_239765_c1 | 3300050514 | Bacteria | 1250 |
| 600 | nmdc:mga08x19_433765_c1 | 3300050514 | Bacteria | 924 |
| 601 | nmdc:mga0a205_389703_c1 | 3300050515 | Bacteria | 1258 |
| 602 | nmdc:mga0a205_46735_c1 | 3300050515 | Bacteria | 4175 |
| 603 | Ga0495601_0162326 | 3300053077 | Unclassified | 1460 |
| 604 | Ga0495601_0285206 | 3300053077 | Bacteria | 1076 |
| 605 | Ga0495612_0050704 | 3300053078 | Bacteria | 1704 |
| 606 | Ga0495612_0086570 | 3300053078 | Unclassified | 1321 |
| 607 | Ga0495655_0025343 | 3300053083 | Bacteria | 1386 |
| 608 | Ga0495595_0050532 | 3300053084 | Bacteria | 1925 |
| 609 | Ga0495595_0093121 | 3300053084 | Bacteria | 1447 |
| 610 | Ga0495595_0116562 | 3300053084 | Unclassified | 1298 |
| 611 | Ga0495619_0093189 | 3300053085 | Bacteria | 2041 |
| 612 | Ga0495619_0200182 | 3300053085 | Unclassified | 1382 |
| 613 | Ga0500566_0335403 | 3300053094 | Bacteria | 698 |
| 614 | Ga0500633_0075955 | 3300053160 | Bacteria | 1208 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300011119 | Ga0105246_10187061 | Ga0105246_101870611 | 179 |
| 2 | 3300035692 | Ga0373935_0344782 | Ga0373935_0344782_174_770 | 195 |
| 3 | 3300050512 | nmdc:mga0n895_606241_c1 | nmdc:mga0n895_606241_c1_91_687 | 195 |
| 4 | 3300005436 | Ga0070713_100220181 | Ga0070713_1002201813 | 196 |
| 5 | 3300006028 | Ga0070717_10409791 | Ga0070717_104097912 | 196 |
| 6 | 3300006175 | Ga0070712_100062090 | Ga0070712_1000620902 | 196 |
| 7 | 3300035117 | Ga0373953_0048086 | Ga0373953_0048086_178_837 | 196 |
| 8 | 3300035118 | Ga0373954_0016753 | Ga0373954_0016753_1522_2181 | 196 |
| 9 | 3300035724 | Ga0373933_0062968 | Ga0373933_0062968_874_1533 | 196 |
| 10 | 3300046463 | Ga0495653_0025897 | Ga0495653_0025897_3245_3904 | 196 |
| 11 | 3300046663 | Ga0495635_0053326 | Ga0495635_0053326_693_1352 | 196 |
| 12 | 3300047319 | Ga0495674_0053893 | Ga0495674_0053893_2156_2815 | 196 |
| 13 | 3300005354 | Ga0070675_100231302 | Ga0070675_1002313023 | 200 |
| 14 | 3300034816 | Ga0373930_0015479 | Ga0373930_0015479_755_1390 | 200 |
| 15 | 3300005345 | Ga0070692_10274236 | Ga0070692_102742361 | 202 |
| 16 | 3300005441 | Ga0070700_100023878 | Ga0070700_1000238786 | 202 |
| 17 | 3300005441 | Ga0070700_100275602 | Ga0070700_1002756022 | 202 |
| 18 | 3300005547 | Ga0070693_100167707 | Ga0070693_1001677071 | 202 |
| 19 | 3300005563 | Ga0068855_100488395 | Ga0068855_1004883951 | 202 |
| 20 | 3300025919 | Ga0207657_10235849 | Ga0207657_102358491 | 202 |
| 21 | 3300025924 | Ga0207694_10233380 | Ga0207694_102333802 | 202 |
| 22 | 3300025933 | Ga0207706_10101252 | Ga0207706_101012522 | 202 |
| 23 | 3300026035 | Ga0207703_10544164 | Ga0207703_105441641 | 202 |
| 24 | 3300026075 | Ga0207708_10059501 | Ga0207708_100595013 | 202 |
| 25 | 3300026116 | Ga0207674_10219735 | Ga0207674_102197353 | 202 |
| 26 | 3300027907 | Ga0207428_10274467 | Ga0207428_102744672 | 202 |
| 27 | 3300014968 | Ga0157379_10721234 | Ga0157379_107212342 | 203 |
| 28 | 3300014969 | Ga0157376_11044013 | Ga0157376_110440131 | 203 |
| 29 | 3300025915 | Ga0207693_10169099 | Ga0207693_101690993 | 203 |
| 30 | 3300048911 | Ga0496108_0274540 | Ga0496108_0274540_37_648 | 203 |
| 31 | 3300039110 | Ga0400487_24701 | Ga0400487_24701_506_1120 | 204 |
| 32 | 3300036712 | Ga0316584_0375074 | Ga0316584_0375074_219_836 | 205 |
| 33 | 3300001978 | JGI24747J21853_1004312 | JGI24747J21853_10043122 | 206 |
| 34 | 3300001979 | JGI24740J21852_10075945 | JGI24740J21852_100759451 | 206 |
| 35 | 3300002070 | JGI24750J21931_1009827 | JGI24750J21931_10098271 | 206 |
| 36 | 3300002070 | JGI24750J21931_1016975 | JGI24750J21931_10169752 | 206 |
| 37 | 3300005330 | Ga0070690_100217625 | Ga0070690_1002176251 | 206 |
| 38 | 3300005333 | Ga0070677_10088984 | Ga0070677_100889842 | 206 |
| 39 | 3300005335 | Ga0070666_10217953 | Ga0070666_102179531 | 206 |
| 40 | 3300005337 | Ga0070682_100217197 | Ga0070682_1002171972 | 206 |
| 41 | 3300005338 | Ga0068868_100672923 | Ga0068868_1006729231 | 206 |
| 42 | 3300005340 | Ga0070689_100428101 | Ga0070689_1004281012 | 206 |
| 43 | 3300005345 | Ga0070692_10024795 | Ga0070692_100247954 | 206 |
| 44 | 3300005347 | Ga0070668_100305387 | Ga0070668_1003053872 | 206 |
| 45 | 3300005353 | Ga0070669_100161499 | Ga0070669_1001614991 | 206 |
| 46 | 3300005353 | Ga0070669_100169988 | Ga0070669_1001699881 | 206 |
| 47 | 3300005353 | Ga0070669_100219479 | Ga0070669_1002194793 | 206 |
| 48 | 3300005356 | Ga0070674_100236618 | Ga0070674_1002366181 | 206 |
| 49 | 3300005367 | Ga0070667_100256829 | Ga0070667_1002568292 | 206 |
| 50 | 3300005437 | Ga0070710_10234253 | Ga0070710_102342531 | 206 |
| 51 | 3300005439 | Ga0070711_100172050 | Ga0070711_1001720503 | 206 |
| 52 | 3300005444 | Ga0070694_100060592 | Ga0070694_1000605923 | 206 |
| 53 | 3300005455 | Ga0070663_100211000 | Ga0070663_1002110002 | 206 |
| 54 | 3300005530 | Ga0070679_100873568 | Ga0070679_1008735681 | 206 |
| 55 | 3300005536 | Ga0070697_100258454 | Ga0070697_1002584541 | 206 |
| 56 | 3300005536 | Ga0070697_100280060 | Ga0070697_1002800602 | 206 |
| 57 | 3300005543 | Ga0070672_100070100 | Ga0070672_1000701004 | 206 |
| 58 | 3300005545 | Ga0070695_100242763 | Ga0070695_1002427632 | 206 |
| 59 | 3300005549 | Ga0070704_100296973 | Ga0070704_1002969731 | 206 |
| 60 | 3300005616 | Ga0068852_100393599 | Ga0068852_1003935991 | 206 |
| 61 | 3300005617 | Ga0068859_100552542 | Ga0068859_1005525422 | 206 |
| 62 | 3300005718 | Ga0068866_10181645 | Ga0068866_101816451 | 206 |
| 63 | 3300005844 | Ga0068862_100027192 | Ga0068862_1000271924 | 206 |
| 64 | 3300005844 | Ga0068862_100253538 | Ga0068862_1002535382 | 206 |
| 65 | 3300006163 | Ga0070715_10019689 | Ga0070715_100196892 | 206 |
| 66 | 3300006173 | Ga0070716_100181104 | Ga0070716_1001811042 | 206 |
| 67 | 3300006173 | Ga0070716_100201034 | Ga0070716_1002010341 | 206 |
| 68 | 3300006871 | Ga0075434_100315336 | Ga0075434_1003153362 | 206 |
| 69 | 3300006881 | Ga0068865_100220841 | Ga0068865_1002208413 | 206 |
| 70 | 3300006881 | Ga0068865_100311559 | Ga0068865_1003115592 | 206 |
| 71 | 3300006931 | Ga0097620_100552583 | Ga0097620_1005525832 | 206 |
| 72 | 3300007076 | Ga0075435_100456980 | Ga0075435_1004569801 | 206 |
| 73 | 3300009092 | Ga0105250_10138994 | Ga0105250_101389942 | 206 |
| 74 | 3300009094 | Ga0111539_10285824 | Ga0111539_102858242 | 206 |
| 75 | 3300009098 | Ga0105245_10567452 | Ga0105245_105674521 | 206 |
| 76 | 3300009101 | Ga0105247_10116606 | Ga0105247_101166062 | 206 |
| 77 | 3300009148 | Ga0105243_10278903 | Ga0105243_102789031 | 206 |
| 78 | 3300009177 | Ga0105248_10396003 | Ga0105248_103960031 | 206 |
| 79 | 3300009545 | Ga0105237_10264209 | Ga0105237_102642093 | 206 |
| 80 | 3300009553 | Ga0105249_10580693 | Ga0105249_105806931 | 206 |
| 81 | 3300009553 | Ga0105249_10612581 | Ga0105249_106125812 | 206 |
| 82 | 3300012481 | Ga0157320_1001347 | Ga0157320_10013472 | 206 |
| 83 | 3300012513 | Ga0157326_1010575 | Ga0157326_10105751 | 206 |
| 84 | 3300013296 | Ga0157374_10200761 | Ga0157374_102007613 | 206 |
| 85 | 3300013296 | Ga0157374_10578398 | Ga0157374_105783982 | 206 |
| 86 | 3300013297 | Ga0157378_10563393 | Ga0157378_105633931 | 206 |
| 87 | 3300013306 | Ga0163162_10437613 | Ga0163162_104376131 | 206 |
| 88 | 3300013306 | Ga0163162_10658270 | Ga0163162_106582703 | 206 |
| 89 | 3300013307 | Ga0157372_10439307 | Ga0157372_104393072 | 206 |
| 90 | 3300014325 | Ga0163163_10128834 | Ga0163163_101288342 | 206 |
| 91 | 3300014326 | Ga0157380_10110803 | Ga0157380_101108034 | 206 |
| 92 | 3300014326 | Ga0157380_10196395 | Ga0157380_101963953 | 206 |
| 93 | 3300014326 | Ga0157380_10516755 | Ga0157380_105167552 | 206 |
| 94 | 3300014326 | Ga0157380_10676164 | Ga0157380_106761641 | 206 |
| 95 | 3300014497 | Ga0182008_10102012 | Ga0182008_101020122 | 206 |
| 96 | 3300014497 | Ga0182008_10242430 | Ga0182008_102424302 | 206 |
| 97 | 3300014969 | Ga0157376_10411209 | Ga0157376_104112091 | 206 |
| 98 | 3300017792 | Ga0163161_10089097 | Ga0163161_100890972 | 206 |
| 99 | 3300021361 | Ga0213872_10063787 | Ga0213872_100637871 | 206 |
| 100 | 3300025893 | Ga0207682_10097559 | Ga0207682_100975591 | 206 |
| 101 | 3300025899 | Ga0207642_10140908 | Ga0207642_101409081 | 206 |
| 102 | 3300025900 | Ga0207710_10106923 | Ga0207710_101069232 | 206 |
| 103 | 3300025900 | Ga0207710_10244669 | Ga0207710_102446692 | 206 |
| 104 | 3300025905 | Ga0207685_10103049 | Ga0207685_101030492 | 206 |
| 105 | 3300025906 | Ga0207699_10233244 | Ga0207699_102332442 | 206 |
| 106 | 3300025907 | Ga0207645_10314941 | Ga0207645_103149412 | 206 |
| 107 | 3300025911 | Ga0207654_10193646 | Ga0207654_101936462 | 206 |
| 108 | 3300025916 | Ga0207663_10082828 | Ga0207663_100828284 | 206 |
| 109 | 3300025916 | Ga0207663_10274476 | Ga0207663_102744762 | 206 |
| 110 | 3300025918 | Ga0207662_10204676 | Ga0207662_102046762 | 206 |
| 111 | 3300025920 | Ga0207649_10039942 | Ga0207649_100399422 | 206 |
| 112 | 3300025923 | Ga0207681_10116371 | Ga0207681_101163711 | 206 |
| 113 | 3300025923 | Ga0207681_10253657 | Ga0207681_102536571 | 206 |
| 114 | 3300025924 | Ga0207694_10724396 | Ga0207694_107243962 | 206 |
| 115 | 3300025928 | Ga0207700_10426129 | Ga0207700_104261292 | 206 |
| 116 | 3300025929 | Ga0207664_10510954 | Ga0207664_105109542 | 206 |
| 117 | 3300025935 | Ga0207709_10160434 | Ga0207709_101604342 | 206 |
| 118 | 3300025936 | Ga0207670_10679840 | Ga0207670_106798401 | 206 |
| 119 | 3300025939 | Ga0207665_10096435 | Ga0207665_100964354 | 206 |
| 120 | 3300025942 | Ga0207689_10406533 | Ga0207689_104065332 | 206 |
| 121 | 3300025961 | Ga0207712_10521189 | Ga0207712_105211891 | 206 |
| 122 | 3300026067 | Ga0207678_10235817 | Ga0207678_102358172 | 206 |
| 123 | 3300026088 | Ga0207641_10725845 | Ga0207641_107258452 | 206 |
| 124 | 3300026118 | Ga0207675_100155502 | Ga0207675_1001555022 | 206 |
| 125 | 3300026118 | Ga0207675_100422079 | Ga0207675_1004220792 | 206 |
| 126 | 3300026142 | Ga0207698_10662909 | Ga0207698_106629091 | 206 |
| 127 | 3300028380 | Ga0268265_10253029 | Ga0268265_102530292 | 206 |
| 128 | 3300028380 | Ga0268265_10575630 | Ga0268265_105756301 | 206 |
| 129 | 3300028800 | Ga0265338_10268663 | Ga0265338_102686631 | 206 |
| 130 | 3300030760 | Ga0265762_1011759 | Ga0265762_10117592 | 206 |
| 131 | 3300031238 | Ga0265332_10069819 | Ga0265332_100698193 | 206 |
| 132 | 3300031249 | Ga0265339_10186939 | Ga0265339_101869392 | 206 |
| 133 | 3300031250 | Ga0265331_10092924 | Ga0265331_100929241 | 206 |
| 134 | 3300031344 | Ga0265316_10054843 | Ga0265316_100548434 | 206 |
| 135 | 3300034817 | Ga0373948_0016294 | Ga0373948_0016294_719_1339 | 206 |
| 136 | 3300034818 | Ga0373950_0012908 | Ga0373950_0012908_706_1326 | 206 |
| 137 | 3300035088 | Ga0373940_0004593 | Ga0373940_0004593_1874_2494 | 206 |
| 138 | 3300035090 | Ga0373949_0007543 | Ga0373949_0007543_1729_2349 | 206 |
| 139 | 3300035092 | Ga0373952_0023655 | Ga0373952_0023655_628_1248 | 206 |
| 140 | 3300035112 | Ga0373932_0061720 | Ga0373932_0061720_501_1121 | 206 |
| 141 | 3300035114 | Ga0373939_0070210 | Ga0373939_0070210_457_1077 | 206 |
| 142 | 3300035114 | Ga0373939_0163206 | Ga0373939_0163206_42_662 | 206 |
| 143 | 3300035121 | Ga0373960_0056940 | Ga0373960_0056940_517_1137 | 206 |
| 144 | 3300035207 | Ga0373942_0005145 | Ga0373942_0005145_1790_2410 | 206 |
| 145 | 3300035691 | Ga0373931_0115407 | Ga0373931_0115407_140_760 | 206 |
| 146 | 3300035691 | Ga0373931_0265719 | Ga0373931_0265719_285_905 | 206 |
| 147 | 3300035724 | Ga0373933_0201601 | Ga0373933_0201601_515_1135 | 206 |
| 148 | 3300036647 | Ga0316582_0481339 | Ga0316582_0481339_94_714 | 206 |
| 149 | 3300039438 | Ga0436360_0253839 | Ga0436360_0253839_184_804 | 206 |
| 150 | 3300039438 | Ga0436360_0338933 | Ga0436360_0338933_743_1363 | 206 |
| 151 | 3300039447 | Ga0436361_0831350 | Ga0436361_0831350_3560_4180 | 206 |
| 152 | 3300039450 | Ga0436363_1289363 | Ga0436363_1289363_50_670 | 206 |
| 153 | 3300039453 | Ga0436362_0553569 | Ga0436362_0553569_1420_2040 | 206 |
| 154 | 3300045976 | Ga0466967_0229030 | Ga0466967_0229030_750_1370 | 206 |
| 155 | 3300046492 | Ga0495585_0101489 | Ga0495585_0101489_27_647 | 206 |
| 156 | 3300046523 | Ga0495644_0067314 | Ga0495644_0067314_708_1328 | 206 |
| 157 | 3300046525 | Ga0495663_0008196 | Ga0495663_0008196_1653_2273 | 206 |
| 158 | 3300046537 | Ga0495598_0004548 | Ga0495598_0004548_136_756 | 206 |
| 159 | 3300046539 | Ga0495621_0004061 | Ga0495621_0004061_2769_3389 | 206 |
| 160 | 3300046615 | Ga0495656_0182862 | Ga0495656_0182862_300_920 | 206 |
| 161 | 3300046692 | Ga0495671_0030929 | Ga0495671_0030929_1654_2274 | 206 |
| 162 | 3300047471 | Ga0495684_0265144 | Ga0495684_0265144_413_1033 | 206 |
| 163 | 3300048090 | Ga0495615_0022301 | Ga0495615_0022301_198_818 | 206 |
| 164 | 3300048903 | Ga0496100_0368820 | Ga0496100_0368820_38_658 | 206 |
| 165 | 3300048904 | Ga0496101_0100205 | Ga0496101_0100205_871_1491 | 206 |
| 166 | 3300048906 | Ga0496103_0231580 | Ga0496103_0231580_463_1083 | 206 |
| 167 | 3300048907 | Ga0496104_0288489 | Ga0496104_0288489_684_1304 | 206 |
| 168 | 3300048908 | Ga0496105_0267151 | Ga0496105_0267151_662_1282 | 206 |
| 169 | 3300048913 | Ga0496110_0140961 | Ga0496110_0140961_994_1614 | 206 |
| 170 | 3300048914 | Ga0496111_0254366 | Ga0496111_0254366_611_1231 | 206 |
| 171 | 3300048917 | Ga0496114_0360220 | Ga0496114_0360220_40_660 | 206 |
| 172 | 3300048918 | Ga0496115_0315903 | Ga0496115_0315903_36_656 | 206 |
| 173 | 3300048929 | Ga0496126_0308172 | Ga0496126_0308172_620_1240 | 206 |
| 174 | 3300050511 | nmdc:mga08y16_261911_c1 | nmdc:mga08y16_261911_c1_554_1174 | 206 |
| 175 | 3300050512 | nmdc:mga0n895_157690_c1 | nmdc:mga0n895_157690_c1_664_1284 | 206 |
| 176 | 3300050512 | nmdc:mga0n895_338720_c1 | nmdc:mga0n895_338720_c1_304_924 | 206 |
| 177 | 3300050513 | nmdc:mga0rr50_313780_c1 | nmdc:mga0rr50_313780_c1_627_1247 | 206 |
| 178 | 3300050514 | nmdc:mga08x19_239765_c1 | nmdc:mga08x19_239765_c1_616_1236 | 206 |
| 179 | 3300050515 | nmdc:mga0a205_389703_c1 | nmdc:mga0a205_389703_c1_35_655 | 206 |
| 180 | 3300005547 | Ga0070693_100466283 | Ga0070693_1004662832 | 207 |
| 181 | 3300010159 | Ga0099796_10022297 | Ga0099796_100222974 | 207 |
| 182 | 3300021361 | Ga0213872_10249431 | Ga0213872_102494311 | 207 |
| 183 | 3300027512 | Ga0209179_1005664 | Ga0209179_10056642 | 207 |
| 184 | 3300031242 | Ga0265329_10032896 | Ga0265329_100328962 | 207 |
| 185 | 3300035086 | Ga0373934_0071003 | Ga0373934_0071003_750_1373 | 207 |
| 186 | 3300035117 | Ga0373953_0332699 | Ga0373953_0332699_13_636 | 207 |
| 187 | 3300035170 | Ga0373943_0197320 | Ga0373943_0197320_461_1084 | 207 |
| 188 | 3300035170 | Ga0373943_0557723 | Ga0373943_0557723_37_660 | 207 |
| 189 | 3300035725 | Ga0373947_0728482 | Ga0373947_0728482_41_664 | 207 |
| 190 | 3300037853 | Ga0436364_0253569 | Ga0436364_0253569_480_1103 | 207 |
| 191 | 3300038741 | Ga0400488_24956 | Ga0400488_24956_762_1385 | 207 |
| 192 | 3300038742 | Ga0400486_26827 | Ga0400486_26827_109_732 | 207 |
| 193 | 3300039062 | Ga0400483_093872 | Ga0400483_093872_182_805 | 207 |
| 194 | 3300039093 | Ga0400489_94519 | Ga0400489_94519_413_1036 | 207 |
| 195 | 3300039453 | Ga0436362_0529634 | Ga0436362_0529634_1027_1650 | 207 |
| 196 | 3300045049 | Ga0466959_0150606 | Ga0466959_0150606_964_1587 | 207 |
| 197 | 3300046461 | Ga0495641_0315995 | Ga0495641_0315995_69_692 | 207 |
| 198 | 3300046475 | Ga0495639_0281447 | Ga0495639_0281447_21_644 | 207 |
| 199 | 3300046477 | Ga0495664_0123847 | Ga0495664_0123847_928_1551 | 207 |
| 200 | 3300046517 | Ga0495630_0889462 | Ga0495630_0889462_43_666 | 207 |
| 201 | 3300046529 | Ga0495652_0239407 | Ga0495652_0239407_716_1339 | 207 |
| 202 | 3300046543 | Ga0495645_0614190 | Ga0495645_0614190_32_655 | 207 |
| 203 | 3300046642 | Ga0495634_0576316 | Ga0495634_0576316_13_636 | 207 |
| 204 | 3300046663 | Ga0495635_0531062 | Ga0495635_0531062_137_760 | 207 |
| 205 | 3300046692 | Ga0495671_0370974 | Ga0495671_0370974_11_634 | 207 |
| 206 | 3300047317 | Ga0495604_0642258 | Ga0495604_0642258_42_665 | 207 |
| 207 | 3300048918 | Ga0496115_0912715 | Ga0496115_0912715_16_639 | 207 |
| 208 | 3300053094 | Ga0500566_0335403 | Ga0500566_0335403_56_679 | 207 |
| 209 | 3300000549 | LJQas_1007314 | LJQas_10073141 | 208 |
| 210 | 3300005436 | Ga0070713_100546207 | Ga0070713_1005462072 | 208 |
| 211 | 3300006175 | Ga0070712_100208698 | Ga0070712_1002086983 | 208 |
| 212 | 3300006871 | Ga0075434_100959759 | Ga0075434_1009597592 | 208 |
| 213 | 3300007076 | Ga0075435_100436849 | Ga0075435_1004368492 | 208 |
| 214 | 3300036647 | Ga0316582_0148230 | Ga0316582_0148230_586_1212 | 208 |
| 215 | 3300036647 | Ga0316582_0189301 | Ga0316582_0189301_134_760 | 208 |
| 216 | 3300036647 | Ga0316582_0611568 | Ga0316582_0611568_27_653 | 208 |
| 217 | 3300037588 | Ga0316581_0133591 | Ga0316581_0133591_53_679 | 208 |
| 218 | 3300037853 | Ga0436364_1428445 | Ga0436364_1428445_192_818 | 208 |
| 219 | 3300039438 | Ga0436360_0565704 | Ga0436360_0565704_644_1270 | 208 |
| 220 | 3300041451 | Ga0451791_0237627 | Ga0451791_0237627_689_1315 | 208 |
| 221 | 3300044684 | Ga0466966_0268924 | Ga0466966_0268924_226_852 | 208 |
| 222 | 3300044842 | Ga0466957_0225653 | Ga0466957_0225653_383_1009 | 208 |
| 223 | 3300050512 | nmdc:mga0n895_981656_c1 | nmdc:mga0n895_981656_c1_60_686 | 208 |
| 224 | 3300050514 | nmdc:mga08x19_433765_c1 | nmdc:mga08x19_433765_c1_22_648 | 208 |
| 225 | 3300021358 | Ga0213873_10012241 | Ga0213873_100122413 | 210 |
| 226 | 3300032133 | Ga0316583_10024255 | Ga0316583_100242554 | 211 |
| 227 | 3300035120 | Ga0373957_0136479 | Ga0373957_0136479_43_705 | 212 |
| 228 | 3300037068 | Ga0373925_0111342 | Ga0373925_0111342_1262_1906 | 214 |
| 229 | 3300030763 | Ga0265763_1005294 | Ga0265763_10052942 | 215 |
| 230 | 3300041486 | Ga0451807_1352859 | Ga0451807_1352859_225_878 | 217 |
| 231 | 3300001990 | JGI24737J22298_10052276 | JGI24737J22298_100522761 | 219 |
| 232 | 3300025906 | Ga0207699_10224717 | Ga0207699_102247172 | 219 |
| 233 | 3300031251 | Ga0265327_10105138 | Ga0265327_101051381 | 219 |
| 234 | 3300035170 | Ga0373943_0357715 | Ga0373943_0357715_32_691 | 219 |
| 235 | 3300039438 | Ga0436360_0826069 | Ga0436360_0826069_701_1360 | 219 |
| 236 | 3300039453 | Ga0436362_1169919 | Ga0436362_1169919_144_803 | 219 |
| 237 | 3300047319 | Ga0495674_0447729 | Ga0495674_0447729_20_913 | 219 |
| 238 | 3300049575 | Ga0501039_0413753 | Ga0501039_0413753_38_697 | 219 |
| 239 | 3300049580 | Ga0501046_0246115 | Ga0501046_0246115_88_747 | 219 |
| 240 | 3300049588 | Ga0501072_0269385 | Ga0501072_0269385_99_758 | 219 |
| 241 | 3300049743 | Ga0501081_0231291 | Ga0501081_0231291_604_1263 | 219 |
| 242 | 3300053160 | Ga0500633_0075955 | Ga0500633_0075955_108_767 | 219 |
| 243 | 3300001976 | JGI24752J21851_1009895 | JGI24752J21851_10098952 | 220 |
| 244 | 3300001979 | JGI24740J21852_10045097 | JGI24740J21852_100450971 | 220 |
| 245 | 3300002074 | JGI24748J21848_1007540 | JGI24748J21848_10075402 | 220 |
| 246 | 3300002076 | JGI24749J21850_1011151 | JGI24749J21850_10111512 | 220 |
| 247 | 3300002239 | JGI24034J26672_10012414 | JGI24034J26672_100124142 | 220 |
| 248 | 3300002459 | JGI24751J29686_10024765 | JGI24751J29686_100247651 | 220 |
| 249 | 3300005290 | Ga0065712_10294727 | Ga0065712_102947271 | 220 |
| 250 | 3300005330 | Ga0070690_100193408 | Ga0070690_1001934081 | 220 |
| 251 | 3300005331 | Ga0070670_100277965 | Ga0070670_1002779653 | 220 |
| 252 | 3300005334 | Ga0068869_100294918 | Ga0068869_1002949181 | 220 |
| 253 | 3300005337 | Ga0070682_100130815 | Ga0070682_1001308151 | 220 |
| 254 | 3300005338 | Ga0068868_100298528 | Ga0068868_1002985282 | 220 |
| 255 | 3300005340 | Ga0070689_100194321 | Ga0070689_1001943213 | 220 |
| 256 | 3300005347 | Ga0070668_100181686 | Ga0070668_1001816862 | 220 |
| 257 | 3300005354 | Ga0070675_100261716 | Ga0070675_1002617162 | 220 |
| 258 | 3300005355 | Ga0070671_100209000 | Ga0070671_1002090003 | 220 |
| 259 | 3300005356 | Ga0070674_100156992 | Ga0070674_1001569923 | 220 |
| 260 | 3300005364 | Ga0070673_100234245 | Ga0070673_1002342452 | 220 |
| 261 | 3300005365 | Ga0070688_100150405 | Ga0070688_1001504052 | 220 |
| 262 | 3300005406 | Ga0070703_10055876 | Ga0070703_100558761 | 220 |
| 263 | 3300005434 | Ga0070709_10163286 | Ga0070709_101632861 | 220 |
| 264 | 3300005435 | Ga0070714_100267764 | Ga0070714_1002677642 | 220 |
| 265 | 3300005435 | Ga0070714_100298437 | Ga0070714_1002984372 | 220 |
| 266 | 3300005436 | Ga0070713_100245247 | Ga0070713_1002452471 | 220 |
| 267 | 3300005437 | Ga0070710_10055173 | Ga0070710_100551732 | 220 |
| 268 | 3300005438 | Ga0070701_10228335 | Ga0070701_102283352 | 220 |
| 269 | 3300005440 | Ga0070705_100031342 | Ga0070705_1000313421 | 220 |
| 270 | 3300005441 | Ga0070700_100188483 | Ga0070700_1001884832 | 220 |
| 271 | 3300005455 | Ga0070663_100240531 | Ga0070663_1002405312 | 220 |
| 272 | 3300005456 | Ga0070678_100225253 | Ga0070678_1002252532 | 220 |
| 273 | 3300005457 | Ga0070662_100235103 | Ga0070662_1002351031 | 220 |
| 274 | 3300005466 | Ga0070685_10129047 | Ga0070685_101290473 | 220 |
| 275 | 3300005468 | Ga0070707_100313956 | Ga0070707_1003139562 | 220 |
| 276 | 3300005471 | Ga0070698_100251229 | Ga0070698_1002512291 | 220 |
| 277 | 3300005535 | Ga0070684_100413724 | Ga0070684_1004137241 | 220 |
| 278 | 3300005536 | Ga0070697_100379988 | Ga0070697_1003799882 | 220 |
| 279 | 3300005543 | Ga0070672_100261161 | Ga0070672_1002611612 | 220 |
| 280 | 3300005544 | Ga0070686_100159854 | Ga0070686_1001598542 | 220 |
| 281 | 3300005545 | Ga0070695_100170794 | Ga0070695_1001707943 | 220 |
| 282 | 3300005546 | Ga0070696_100194093 | Ga0070696_1001940932 | 220 |
| 283 | 3300005548 | Ga0070665_100289366 | Ga0070665_1002893662 | 220 |
| 284 | 3300005549 | Ga0070704_100155223 | Ga0070704_1001552233 | 220 |
| 285 | 3300005564 | Ga0070664_100319217 | Ga0070664_1003192171 | 220 |
| 286 | 3300005616 | Ga0068852_100395882 | Ga0068852_1003958821 | 220 |
| 287 | 3300005617 | Ga0068859_100324887 | Ga0068859_1003248872 | 220 |
| 288 | 3300005618 | Ga0068864_100208528 | Ga0068864_1002085282 | 220 |
| 289 | 3300005718 | Ga0068866_10152531 | Ga0068866_101525312 | 220 |
| 290 | 3300005719 | Ga0068861_100284716 | Ga0068861_1002847161 | 220 |
| 291 | 3300005841 | Ga0068863_100191117 | Ga0068863_1001911172 | 220 |
| 292 | 3300005842 | Ga0068858_100221104 | Ga0068858_1002211042 | 220 |
| 293 | 3300005843 | Ga0068860_100425567 | Ga0068860_1004255673 | 220 |
| 294 | 3300006058 | Ga0075432_10062319 | Ga0075432_100623192 | 220 |
| 295 | 3300006163 | Ga0070715_10015266 | Ga0070715_100152663 | 220 |
| 296 | 3300006237 | Ga0097621_100158145 | Ga0097621_1001581452 | 220 |
| 297 | 3300006237 | Ga0097621_100310672 | Ga0097621_1003106722 | 220 |
| 298 | 3300006844 | Ga0075428_100415815 | Ga0075428_1004158152 | 220 |
| 299 | 3300006852 | Ga0075433_10264528 | Ga0075433_102645282 | 220 |
| 300 | 3300006914 | Ga0075436_100195398 | Ga0075436_1001953982 | 220 |
| 301 | 3300006931 | Ga0097620_100324888 | Ga0097620_1003248882 | 220 |
| 302 | 3300009011 | Ga0105251_10098993 | Ga0105251_100989933 | 220 |
| 303 | 3300009092 | Ga0105250_10087988 | Ga0105250_100879882 | 220 |
| 304 | 3300009098 | Ga0105245_10322718 | Ga0105245_103227182 | 220 |
| 305 | 3300009101 | Ga0105247_10033007 | Ga0105247_100330072 | 220 |
| 306 | 3300009147 | Ga0114129_10565235 | Ga0114129_105652353 | 220 |
| 307 | 3300009148 | Ga0105243_10265603 | Ga0105243_102656032 | 220 |
| 308 | 3300009174 | Ga0105241_10217583 | Ga0105241_102175831 | 220 |
| 309 | 3300009176 | Ga0105242_10240038 | Ga0105242_102400381 | 220 |
| 310 | 3300009177 | Ga0105248_10303889 | Ga0105248_103038892 | 220 |
| 311 | 3300009545 | Ga0105237_10396527 | Ga0105237_103965271 | 220 |
| 312 | 3300009553 | Ga0105249_10385989 | Ga0105249_103859892 | 220 |
| 313 | 3300010159 | Ga0099796_10012658 | Ga0099796_100126583 | 220 |
| 314 | 3300010375 | Ga0105239_10429473 | Ga0105239_104294733 | 220 |
| 315 | 3300011119 | Ga0105246_10187182 | Ga0105246_101871822 | 220 |
| 316 | 3300012488 | Ga0157343_1000873 | Ga0157343_10008731 | 220 |
| 317 | 3300012510 | Ga0157316_1001838 | Ga0157316_10018381 | 220 |
| 318 | 3300013296 | Ga0157374_10263104 | Ga0157374_102631042 | 220 |
| 319 | 3300013306 | Ga0163162_10249083 | Ga0163162_102490833 | 220 |
| 320 | 3300013306 | Ga0163162_10268317 | Ga0163162_102683173 | 220 |
| 321 | 3300013307 | Ga0157372_10926613 | Ga0157372_109266132 | 220 |
| 322 | 3300013308 | Ga0157375_10314880 | Ga0157375_103148802 | 220 |
| 323 | 3300014325 | Ga0163163_10228568 | Ga0163163_102285683 | 220 |
| 324 | 3300014745 | Ga0157377_10114385 | Ga0157377_101143853 | 220 |
| 325 | 3300014968 | Ga0157379_10257689 | Ga0157379_102576892 | 220 |
| 326 | 3300014969 | Ga0157376_10248628 | Ga0157376_102486283 | 220 |
| 327 | 3300017792 | Ga0163161_10170915 | Ga0163161_101709153 | 220 |
| 328 | 3300021358 | Ga0213873_10022256 | Ga0213873_100222562 | 220 |
| 329 | 3300021358 | Ga0213873_10033300 | Ga0213873_100333001 | 220 |
| 330 | 3300025735 | Ga0207713_1072129 | Ga0207713_10721291 | 220 |
| 331 | 3300025885 | Ga0207653_10056752 | Ga0207653_100567521 | 220 |
| 332 | 3300025893 | Ga0207682_10104383 | Ga0207682_101043832 | 220 |
| 333 | 3300025898 | Ga0207692_10163331 | Ga0207692_101633311 | 220 |
| 334 | 3300025898 | Ga0207692_10217377 | Ga0207692_102173772 | 220 |
| 335 | 3300025899 | Ga0207642_10086400 | Ga0207642_100864003 | 220 |
| 336 | 3300025900 | Ga0207710_10112140 | Ga0207710_101121402 | 220 |
| 337 | 3300025904 | Ga0207647_10161445 | Ga0207647_101614452 | 220 |
| 338 | 3300025905 | Ga0207685_10087709 | Ga0207685_100877092 | 220 |
| 339 | 3300025905 | Ga0207685_10096525 | Ga0207685_100965252 | 220 |
| 340 | 3300025906 | Ga0207699_10230211 | Ga0207699_102302111 | 220 |
| 341 | 3300025906 | Ga0207699_10389649 | Ga0207699_103896491 | 220 |
| 342 | 3300025910 | Ga0207684_10154788 | Ga0207684_101547883 | 220 |
| 343 | 3300025911 | Ga0207654_10210502 | Ga0207654_102105022 | 220 |
| 344 | 3300025915 | Ga0207693_10277112 | Ga0207693_102771121 | 220 |
| 345 | 3300025916 | Ga0207663_10495711 | Ga0207663_104957111 | 220 |
| 346 | 3300025917 | Ga0207660_10260174 | Ga0207660_102601742 | 220 |
| 347 | 3300025921 | Ga0207652_10163267 | Ga0207652_101632672 | 220 |
| 348 | 3300025922 | Ga0207646_10261174 | Ga0207646_102611742 | 220 |
| 349 | 3300025926 | Ga0207659_10281713 | Ga0207659_102817132 | 220 |
| 350 | 3300025927 | Ga0207687_10355214 | Ga0207687_103552141 | 220 |
| 351 | 3300025928 | Ga0207700_10143121 | Ga0207700_101431214 | 220 |
| 352 | 3300025929 | Ga0207664_10376771 | Ga0207664_103767712 | 220 |
| 353 | 3300025931 | Ga0207644_10300427 | Ga0207644_103004272 | 220 |
| 354 | 3300025933 | Ga0207706_10235540 | Ga0207706_102355401 | 220 |
| 355 | 3300025934 | Ga0207686_10182737 | Ga0207686_101827371 | 220 |
| 356 | 3300025935 | Ga0207709_10245944 | Ga0207709_102459442 | 220 |
| 357 | 3300025936 | Ga0207670_10117211 | Ga0207670_101172112 | 220 |
| 358 | 3300025937 | Ga0207669_10073704 | Ga0207669_100737043 | 220 |
| 359 | 3300025941 | Ga0207711_10397443 | Ga0207711_103974431 | 220 |
| 360 | 3300025942 | Ga0207689_10071181 | Ga0207689_100711812 | 220 |
| 361 | 3300025944 | Ga0207661_10270516 | Ga0207661_102705162 | 220 |
| 362 | 3300025960 | Ga0207651_10301483 | Ga0207651_103014832 | 220 |
| 363 | 3300025961 | Ga0207712_10511526 | Ga0207712_105115262 | 220 |
| 364 | 3300025972 | Ga0207668_10329638 | Ga0207668_103296381 | 220 |
| 365 | 3300026023 | Ga0207677_10268314 | Ga0207677_102683142 | 220 |
| 366 | 3300026035 | Ga0207703_10388540 | Ga0207703_103885401 | 220 |
| 367 | 3300026041 | Ga0207639_10378727 | Ga0207639_103787271 | 220 |
| 368 | 3300026067 | Ga0207678_10260133 | Ga0207678_102601333 | 220 |
| 369 | 3300026075 | Ga0207708_10204450 | Ga0207708_102044503 | 220 |
| 370 | 3300026078 | Ga0207702_10429796 | Ga0207702_104297961 | 220 |
| 371 | 3300026088 | Ga0207641_10427368 | Ga0207641_104273682 | 220 |
| 372 | 3300026089 | Ga0207648_10206057 | Ga0207648_102060571 | 220 |
| 373 | 3300026095 | Ga0207676_10403808 | Ga0207676_104038082 | 220 |
| 374 | 3300026118 | Ga0207675_100247816 | Ga0207675_1002478163 | 220 |
| 375 | 3300026142 | Ga0207698_10377879 | Ga0207698_103778791 | 220 |
| 376 | 3300027907 | Ga0207428_10236502 | Ga0207428_102365022 | 220 |
| 377 | 3300027907 | Ga0207428_10275807 | Ga0207428_102758072 | 220 |
| 378 | 3300028010 | Ga0265358_100363 | Ga0265358_1003632 | 220 |
| 379 | 3300028379 | Ga0268266_10408129 | Ga0268266_104081292 | 220 |
| 380 | 3300028380 | Ga0268265_10544471 | Ga0268265_105444711 | 220 |
| 381 | 3300028381 | Ga0268264_10345921 | Ga0268264_103459213 | 220 |
| 382 | 3300031018 | Ga0265773_1001105 | Ga0265773_10011052 | 220 |
| 383 | 3300031090 | Ga0265760_10030744 | Ga0265760_100307443 | 220 |
| 384 | 3300031090 | Ga0265760_10047742 | Ga0265760_100477421 | 220 |
| 385 | 3300031711 | Ga0265314_10111864 | Ga0265314_101118642 | 220 |
| 386 | 3300034816 | Ga0373930_0017154 | Ga0373930_0017154_50_712 | 220 |
| 387 | 3300034817 | Ga0373948_0018967 | Ga0373948_0018967_26_688 | 220 |
| 388 | 3300034818 | Ga0373950_0013245 | Ga0373950_0013245_132_794 | 220 |
| 389 | 3300034819 | Ga0373958_0018183 | Ga0373958_0018183_32_694 | 220 |
| 390 | 3300034820 | Ga0373959_0010516 | Ga0373959_0010516_131_793 | 220 |
| 391 | 3300034957 | Ga0373938_0002013 | Ga0373938_0002013_1905_2567 | 220 |
| 392 | 3300035083 | Ga0373926_0047951 | Ga0373926_0047951_434_1096 | 220 |
| 393 | 3300035083 | Ga0373926_0057683 | Ga0373926_0057683_61_723 | 220 |
| 394 | 3300035084 | Ga0373928_0015895 | Ga0373928_0015895_728_1390 | 220 |
| 395 | 3300035085 | Ga0373929_0020446 | Ga0373929_0020446_648_1310 | 220 |
| 396 | 3300035088 | Ga0373940_0041201 | Ga0373940_0041201_572_1234 | 220 |
| 397 | 3300035089 | Ga0373944_0092442 | Ga0373944_0092442_18_680 | 220 |
| 398 | 3300035090 | Ga0373949_0022060 | Ga0373949_0022060_211_873 | 220 |
| 399 | 3300035091 | Ga0373951_0030647 | Ga0373951_0030647_580_1242 | 220 |
| 400 | 3300035092 | Ga0373952_0018771 | Ga0373952_0018771_202_864 | 220 |
| 401 | 3300035111 | Ga0373923_0141262 | Ga0373923_0141262_34_696 | 220 |
| 402 | 3300035111 | Ga0373923_0175266 | Ga0373923_0175266_209_871 | 220 |
| 403 | 3300035112 | Ga0373932_0004499 | Ga0373932_0004499_683_1345 | 220 |
| 404 | 3300035113 | Ga0373936_0091987 | Ga0373936_0091987_33_695 | 220 |
| 405 | 3300035113 | Ga0373936_0103750 | Ga0373936_0103750_451_1113 | 220 |
| 406 | 3300035114 | Ga0373939_0032079 | Ga0373939_0032079_280_942 | 220 |
| 407 | 3300035115 | Ga0373941_0038987 | Ga0373941_0038987_31_693 | 220 |
| 408 | 3300035116 | Ga0373945_0075038 | Ga0373945_0075038_37_699 | 220 |
| 409 | 3300035116 | Ga0373945_0106709 | Ga0373945_0106709_17_679 | 220 |
| 410 | 3300035118 | Ga0373954_0065360 | Ga0373954_0065360_709_1371 | 220 |
| 411 | 3300035118 | Ga0373954_0105389 | Ga0373954_0105389_632_1294 | 220 |
| 412 | 3300035118 | Ga0373954_0116609 | Ga0373954_0116609_575_1237 | 220 |
| 413 | 3300035118 | Ga0373954_0151850 | Ga0373954_0151850_447_1109 | 220 |
| 414 | 3300035119 | Ga0373956_0122396 | Ga0373956_0122396_28_720 | 220 |
| 415 | 3300035119 | Ga0373956_0124805 | Ga0373956_0124805_84_746 | 220 |
| 416 | 3300035119 | Ga0373956_0166860 | Ga0373956_0166860_349_1011 | 220 |
| 417 | 3300035120 | Ga0373957_0082945 | Ga0373957_0082945_568_1230 | 220 |
| 418 | 3300035120 | Ga0373957_0117767 | Ga0373957_0117767_70_732 | 220 |
| 419 | 3300035120 | Ga0373957_0128075 | Ga0373957_0128075_37_699 | 220 |
| 420 | 3300035121 | Ga0373960_0029905 | Ga0373960_0029905_88_750 | 220 |
| 421 | 3300035170 | Ga0373943_0128790 | Ga0373943_0128790_566_1228 | 220 |
| 422 | 3300035170 | Ga0373943_0140078 | Ga0373943_0140078_17_679 | 220 |
| 423 | 3300035170 | Ga0373943_0283310 | Ga0373943_0283310_24_686 | 220 |
| 424 | 3300035171 | Ga0373946_0051273 | Ga0373946_0051273_915_1577 | 220 |
| 425 | 3300035171 | Ga0373946_0115994 | Ga0373946_0115994_493_1155 | 220 |
| 426 | 3300035172 | Ga0373955_0099827 | Ga0373955_0099827_105_767 | 220 |
| 427 | 3300035172 | Ga0373955_0205021 | Ga0373955_0205021_17_679 | 220 |
| 428 | 3300035172 | Ga0373955_0234417 | Ga0373955_0234417_331_1023 | 220 |
| 429 | 3300035172 | Ga0373955_0344107 | Ga0373955_0344107_225_887 | 220 |
| 430 | 3300035207 | Ga0373942_0021769 | Ga0373942_0021769_864_1526 | 220 |
| 431 | 3300035241 | Ga0373961_0035680 | Ga0373961_0035680_114_776 | 220 |
| 432 | 3300035242 | Ga0373962_0038023 | Ga0373962_0038023_667_1329 | 220 |
| 433 | 3300035410 | Ga0373924_0054798 | Ga0373924_0054798_425_1087 | 220 |
| 434 | 3300035410 | Ga0373924_0055860 | Ga0373924_0055860_948_1610 | 220 |
| 435 | 3300035691 | Ga0373931_0144663 | Ga0373931_0144663_139_801 | 220 |
| 436 | 3300035692 | Ga0373935_0586405 | Ga0373935_0586405_37_699 | 220 |
| 437 | 3300035695 | Ga0373927_0038780 | Ga0373927_0038780_581_1243 | 220 |
| 438 | 3300035724 | Ga0373933_0057667 | Ga0373933_0057667_1596_2258 | 220 |
| 439 | 3300035724 | Ga0373933_0104883 | Ga0373933_0104883_579_1241 | 220 |
| 440 | 3300035724 | Ga0373933_0116994 | Ga0373933_0116994_862_1524 | 220 |
| 441 | 3300035724 | Ga0373933_0228993 | Ga0373933_0228993_457_1149 | 220 |
| 442 | 3300035725 | Ga0373947_0124599 | Ga0373947_0124599_673_1335 | 220 |
| 443 | 3300035725 | Ga0373947_0175609 | Ga0373947_0175609_354_1016 | 220 |
| 444 | 3300035725 | Ga0373947_0691831 | Ga0373947_0691831_14_676 | 220 |
| 445 | 3300036401 | Ga0373937_0110242 | Ga0373937_0110242_641_1303 | 220 |
| 446 | 3300036401 | Ga0373937_0564011 | Ga0373937_0564011_59_721 | 220 |
| 447 | 3300036401 | Ga0373937_0587398 | Ga0373937_0587398_35_697 | 220 |
| 448 | 3300036401 | Ga0373937_0902159 | Ga0373937_0902159_134_796 | 220 |
| 449 | 3300037068 | Ga0373925_0306714 | Ga0373925_0306714_567_1229 | 220 |
| 450 | 3300037068 | Ga0373925_0312397 | Ga0373925_0312397_24_686 | 220 |
| 451 | 3300037068 | Ga0373925_0539941 | Ga0373925_0539941_31_693 | 220 |
| 452 | 3300037068 | Ga0373925_0558770 | Ga0373925_0558770_30_692 | 220 |
| 453 | 3300038996 | Ga0242420_015228 | Ga0242420_015228_84_746 | 220 |
| 454 | 3300039437 | Ga0436365_1326345 | Ga0436365_1326345_603_1265 | 220 |
| 455 | 3300039438 | Ga0436360_0655878 | Ga0436360_0655878_229_891 | 220 |
| 456 | 3300039447 | Ga0436361_0087236 | Ga0436361_0087236_705_1367 | 220 |
| 457 | 3300039450 | Ga0436363_0703516 | Ga0436363_0703516_753_1415 | 220 |
| 458 | 3300039453 | Ga0436362_0035050 | Ga0436362_0035050_144_806 | 220 |
| 459 | 3300039453 | Ga0436362_1201376 | Ga0436362_1201376_666_1328 | 220 |
| 460 | 3300041441 | Ga0451787_695444 | Ga0451787_695444_221_883 | 220 |
| 461 | 3300041512 | Ga0451853_0221274 | Ga0451853_0221274_14_676 | 220 |
| 462 | 3300045051 | Ga0451576_0444513 | Ga0451576_0444513_688_1350 | 220 |
| 463 | 3300046452 | Ga0495617_052334 | Ga0495617_052334_332_994 | 220 |
| 464 | 3300046453 | Ga0495627_041489 | Ga0495627_041489_727_1389 | 220 |
| 465 | 3300046454 | Ga0495592_0190922 | Ga0495592_0190922_581_1243 | 220 |
| 466 | 3300046454 | Ga0495592_0454798 | Ga0495592_0454798_38_700 | 220 |
| 467 | 3300046455 | Ga0495603_0176072 | Ga0495603_0176072_42_704 | 220 |
| 468 | 3300046459 | Ga0495629_0120514 | Ga0495629_0120514_747_1409 | 220 |
| 469 | 3300046459 | Ga0495629_0187430 | Ga0495629_0187430_607_1269 | 220 |
| 470 | 3300046460 | Ga0495638_0047087 | Ga0495638_0047087_1856_2518 | 220 |
| 471 | 3300046461 | Ga0495641_0086200 | Ga0495641_0086200_581_1243 | 220 |
| 472 | 3300046462 | Ga0495651_0178792 | Ga0495651_0178792_818_1480 | 220 |
| 473 | 3300046462 | Ga0495651_0455277 | Ga0495651_0455277_91_753 | 220 |
| 474 | 3300046463 | Ga0495653_0092011 | Ga0495653_0092011_32_694 | 220 |
| 475 | 3300046463 | Ga0495653_0339912 | Ga0495653_0339912_197_859 | 220 |
| 476 | 3300046472 | Ga0495580_0228253 | Ga0495580_0228253_591_1253 | 220 |
| 477 | 3300046472 | Ga0495580_0259441 | Ga0495580_0259441_134_796 | 220 |
| 478 | 3300046472 | Ga0495580_0375698 | Ga0495580_0375698_27_689 | 220 |
| 479 | 3300046473 | Ga0495582_0089380 | Ga0495582_0089380_702_1364 | 220 |
| 480 | 3300046474 | Ga0495605_0109710 | Ga0495605_0109710_566_1228 | 220 |
| 481 | 3300046475 | Ga0495639_0121043 | Ga0495639_0121043_20_682 | 220 |
| 482 | 3300046475 | Ga0495639_0134233 | Ga0495639_0134233_30_692 | 220 |
| 483 | 3300046476 | Ga0495662_0118388 | Ga0495662_0118388_513_1175 | 220 |
| 484 | 3300046476 | Ga0495662_0151643 | Ga0495662_0151643_57_719 | 220 |
| 485 | 3300046491 | Ga0495584_0134961 | Ga0495584_0134961_31_693 | 220 |
| 486 | 3300046492 | Ga0495585_0174709 | Ga0495585_0174709_382_1044 | 220 |
| 487 | 3300046492 | Ga0495585_0208850 | Ga0495585_0208850_47_709 | 220 |
| 488 | 3300046501 | Ga0495607_0113260 | Ga0495607_0113260_122_784 | 220 |
| 489 | 3300046501 | Ga0495607_0121125 | Ga0495607_0121125_613_1275 | 220 |
| 490 | 3300046501 | Ga0495607_0153659 | Ga0495607_0153659_459_1121 | 220 |
| 491 | 3300046506 | Ga0495583_0136072 | Ga0495583_0136072_82_744 | 220 |
| 492 | 3300046511 | Ga0495608_0157802 | Ga0495608_0157802_736_1398 | 220 |
| 493 | 3300046511 | Ga0495608_0166946 | Ga0495608_0166946_85_747 | 220 |
| 494 | 3300046512 | Ga0495610_0173193 | Ga0495610_0173193_74_736 | 220 |
| 495 | 3300046513 | Ga0495616_0127241 | Ga0495616_0127241_31_693 | 220 |
| 496 | 3300046514 | Ga0495618_0157177 | Ga0495618_0157177_37_699 | 220 |
| 497 | 3300046514 | Ga0495618_0244080 | Ga0495618_0244080_78_740 | 220 |
| 498 | 3300046515 | Ga0495620_0073600 | Ga0495620_0073600_591_1253 | 220 |
| 499 | 3300046516 | Ga0495628_0246893 | Ga0495628_0246893_603_1265 | 220 |
| 500 | 3300046516 | Ga0495628_0648935 | Ga0495628_0648935_53_715 | 220 |
| 501 | 3300046518 | Ga0495631_0097927 | Ga0495631_0097927_543_1205 | 220 |
| 502 | 3300046520 | Ga0495637_0076635 | Ga0495637_0076635_56_718 | 220 |
| 503 | 3300046523 | Ga0495644_0073083 | Ga0495644_0073083_567_1229 | 220 |
| 504 | 3300046523 | Ga0495644_0117559 | Ga0495644_0117559_281_943 | 220 |
| 505 | 3300046525 | Ga0495663_0040176 | Ga0495663_0040176_566_1228 | 220 |
| 506 | 3300046526 | Ga0495666_0158668 | Ga0495666_0158668_31_693 | 220 |
| 507 | 3300046530 | Ga0495654_0084036 | Ga0495654_0084036_789_1451 | 220 |
| 508 | 3300046531 | Ga0495665_0137171 | Ga0495665_0137171_195_857 | 220 |
| 509 | 3300046533 | Ga0495640_0044700 | Ga0495640_0044700_2230_2892 | 220 |
| 510 | 3300046533 | Ga0495640_0168011 | Ga0495640_0168011_712_1374 | 220 |
| 511 | 3300046536 | Ga0495587_0105551 | Ga0495587_0105551_200_862 | 220 |
| 512 | 3300046536 | Ga0495587_0163382 | Ga0495587_0163382_582_1244 | 220 |
| 513 | 3300046538 | Ga0495609_0081665 | Ga0495609_0081665_677_1339 | 220 |
| 514 | 3300046539 | Ga0495621_0131042 | Ga0495621_0131042_32_694 | 220 |
| 515 | 3300046542 | Ga0495597_0086496 | Ga0495597_0086496_649_1311 | 220 |
| 516 | 3300046557 | Ga0495622_0061508 | Ga0495622_0061508_73_735 | 220 |
| 517 | 3300046557 | Ga0495622_0119892 | Ga0495622_0119892_27_689 | 220 |
| 518 | 3300046559 | Ga0495667_0120416 | Ga0495667_0120416_802_1464 | 220 |
| 519 | 3300046559 | Ga0495667_0171164 | Ga0495667_0171164_36_698 | 220 |
| 520 | 3300046615 | Ga0495656_0092782 | Ga0495656_0092782_622_1284 | 220 |
| 521 | 3300046648 | Ga0495611_0142583 | Ga0495611_0142583_431_1093 | 220 |
| 522 | 3300046660 | Ga0495625_0255675 | Ga0495625_0255675_437_1099 | 220 |
| 523 | 3300046663 | Ga0495635_0120038 | Ga0495635_0120038_700_1362 | 220 |
| 524 | 3300046663 | Ga0495635_0182652 | Ga0495635_0182652_119_781 | 220 |
| 525 | 3300046664 | Ga0495659_0070389 | Ga0495659_0070389_61_723 | 220 |
| 526 | 3300046664 | Ga0495659_0140511 | Ga0495659_0140511_20_682 | 220 |
| 527 | 3300046665 | Ga0495661_0122485 | Ga0495661_0122485_747_1409 | 220 |
| 528 | 3300046674 | Ga0495588_0171900 | Ga0495588_0171900_45_707 | 220 |
| 529 | 3300046675 | Ga0495657_0188526 | Ga0495657_0188526_30_692 | 220 |
| 530 | 3300046675 | Ga0495657_0393382 | Ga0495657_0393382_46_708 | 220 |
| 531 | 3300046678 | Ga0495599_0008661 | Ga0495599_0008661_3344_4006 | 220 |
| 532 | 3300046678 | Ga0495599_0235047 | Ga0495599_0235047_355_1017 | 220 |
| 533 | 3300046679 | Ga0495623_0135169 | Ga0495623_0135169_576_1268 | 220 |
| 534 | 3300046680 | Ga0495646_0077018 | Ga0495646_0077018_1198_1860 | 220 |
| 535 | 3300046680 | Ga0495646_0236440 | Ga0495646_0236440_191_853 | 220 |
| 536 | 3300046681 | Ga0495647_0062666 | Ga0495647_0062666_663_1325 | 220 |
| 537 | 3300046681 | Ga0495647_0082519 | Ga0495647_0082519_287_949 | 220 |
| 538 | 3300046683 | Ga0495658_0059032 | Ga0495658_0059032_1218_1880 | 220 |
| 539 | 3300046683 | Ga0495658_0156755 | Ga0495658_0156755_587_1249 | 220 |
| 540 | 3300046684 | Ga0495669_0036196 | Ga0495669_0036196_1040_1702 | 220 |
| 541 | 3300046684 | Ga0495669_0051179 | Ga0495669_0051179_567_1229 | 220 |
| 542 | 3300046689 | Ga0495613_0234196 | Ga0495613_0234196_31_693 | 220 |
| 543 | 3300046691 | Ga0495670_0171576 | Ga0495670_0171576_65_727 | 220 |
| 544 | 3300046694 | Ga0495649_0258789 | Ga0495649_0258789_72_734 | 220 |
| 545 | 3300046809 | Ga0495600_0177301 | Ga0495600_0177301_72_734 | 220 |
| 546 | 3300046809 | Ga0495600_0199381 | Ga0495600_0199381_586_1248 | 220 |
| 547 | 3300047315 | Ga0495581_0087187 | Ga0495581_0087187_36_698 | 220 |
| 548 | 3300047315 | Ga0495581_0118728 | Ga0495581_0118728_589_1251 | 220 |
| 549 | 3300047319 | Ga0495674_0266809 | Ga0495674_0266809_588_1250 | 220 |
| 550 | 3300047320 | Ga0495672_0196736 | Ga0495672_0196736_86_748 | 220 |
| 551 | 3300047321 | Ga0495676_0321392 | Ga0495676_0321392_21_683 | 220 |
| 552 | 3300047322 | Ga0495680_0076598 | Ga0495680_0076598_1262_1924 | 220 |
| 553 | 3300047322 | Ga0495680_0276493 | Ga0495680_0276493_423_1085 | 220 |
| 554 | 3300047444 | Ga0495675_0097658 | Ga0495675_0097658_596_1258 | 220 |
| 555 | 3300047444 | Ga0495675_0286350 | Ga0495675_0286350_181_843 | 220 |
| 556 | 3300047445 | Ga0495677_0022368 | Ga0495677_0022368_1574_2236 | 220 |
| 557 | 3300047446 | Ga0495679_045536 | Ga0495679_045536_59_721 | 220 |
| 558 | 3300047446 | Ga0495679_049392 | Ga0495679_049392_576_1238 | 220 |
| 559 | 3300047469 | Ga0495673_0108098 | Ga0495673_0108098_392_1054 | 220 |
| 560 | 3300047470 | Ga0495681_0051735 | Ga0495681_0051735_627_1289 | 220 |
| 561 | 3300047471 | Ga0495684_0202092 | Ga0495684_0202092_699_1361 | 220 |
| 562 | 3300047471 | Ga0495684_0227943 | Ga0495684_0227943_279_941 | 220 |
| 563 | 3300047471 | Ga0495684_0245427 | Ga0495684_0245427_39_701 | 220 |
| 564 | 3300047472 | Ga0495686_0151252 | Ga0495686_0151252_136_798 | 220 |
| 565 | 3300048088 | Ga0495602_0375685 | Ga0495602_0375685_25_687 | 220 |
| 566 | 3300048088 | Ga0495602_0550640 | Ga0495602_0550640_36_698 | 220 |
| 567 | 3300048091 | Ga0495626_0103871 | Ga0495626_0103871_118_780 | 220 |
| 568 | 3300048903 | Ga0496100_0025258 | Ga0496100_0025258_40_702 | 220 |
| 569 | 3300048904 | Ga0496101_0279904 | Ga0496101_0279904_36_698 | 220 |
| 570 | 3300048905 | Ga0496102_0229450 | Ga0496102_0229450_32_694 | 220 |
| 571 | 3300048905 | Ga0496102_0257075 | Ga0496102_0257075_391_1053 | 220 |
| 572 | 3300048906 | Ga0496103_0199825 | Ga0496103_0199825_589_1251 | 220 |
| 573 | 3300048907 | Ga0496104_0251060 | Ga0496104_0251060_605_1267 | 220 |
| 574 | 3300048908 | Ga0496105_0292269 | Ga0496105_0292269_606_1268 | 220 |
| 575 | 3300048909 | Ga0496106_0295973 | Ga0496106_0295973_38_700 | 220 |
| 576 | 3300048910 | Ga0496107_0243031 | Ga0496107_0243031_40_702 | 220 |
| 577 | 3300048911 | Ga0496108_0124919 | Ga0496108_0124919_895_1557 | 220 |
| 578 | 3300048912 | Ga0496109_0380943 | Ga0496109_0380943_609_1271 | 220 |
| 579 | 3300048913 | Ga0496110_0178041 | Ga0496110_0178041_588_1250 | 220 |
| 580 | 3300048914 | Ga0496111_0250861 | Ga0496111_0250861_66_728 | 220 |
| 581 | 3300048915 | Ga0496112_0427714 | Ga0496112_0427714_567_1229 | 220 |
| 582 | 3300048916 | Ga0496113_0229368 | Ga0496113_0229368_770_1432 | 220 |
| 583 | 3300048917 | Ga0496114_0260894 | Ga0496114_0260894_827_1489 | 220 |
| 584 | 3300048917 | Ga0496114_0371639 | Ga0496114_0371639_576_1238 | 220 |
| 585 | 3300048918 | Ga0496115_0297595 | Ga0496115_0297595_21_683 | 220 |
| 586 | 3300048918 | Ga0496115_0316283 | Ga0496115_0316283_602_1264 | 220 |
| 587 | 3300048922 | Ga0496119_0127521 | Ga0496119_0127521_651_1313 | 220 |
| 588 | 3300048923 | Ga0496120_0103466 | Ga0496120_0103466_738_1400 | 220 |
| 589 | 3300048924 | Ga0496121_0238355 | Ga0496121_0238355_111_773 | 220 |
| 590 | 3300048928 | Ga0496125_0193640 | Ga0496125_0193640_100_762 | 220 |
| 591 | 3300048929 | Ga0496126_0108059 | Ga0496126_0108059_166_828 | 220 |
| 592 | 3300049459 | Ga0495678_081247 | Ga0495678_081247_30_692 | 220 |
| 593 | 3300050507 | nmdc:mga05p37_1031821_c1 | nmdc:mga05p37_1031821_c1_155_817 | 220 |
| 594 | 3300050508 | nmdc:mga09592_381845_c1 | nmdc:mga09592_381845_c1_167_829 | 220 |
| 595 | 3300050510 | nmdc:mga06r32_249229_c1 | nmdc:mga06r32_249229_c1_85_747 | 220 |
| 596 | 3300050512 | nmdc:mga0n895_356403_c1 | nmdc:mga0n895_356403_c1_578_1240 | 220 |
| 597 | 3300050513 | nmdc:mga0rr50_236315_c1 | nmdc:mga0rr50_236315_c1_715_1377 | 220 |
| 598 | 3300050514 | nmdc:mga08x19_166146_c1 | nmdc:mga08x19_166146_c1_252_914 | 220 |
| 599 | 3300050515 | nmdc:mga0a205_46735_c1 | nmdc:mga0a205_46735_c1_850_1512 | 220 |
| 600 | 3300053077 | Ga0495601_0162326 | Ga0495601_0162326_557_1219 | 220 |
| 601 | 3300053077 | Ga0495601_0285206 | Ga0495601_0285206_366_1028 | 220 |
| 602 | 3300053078 | Ga0495612_0050704 | Ga0495612_0050704_33_695 | 220 |
| 603 | 3300053078 | Ga0495612_0086570 | Ga0495612_0086570_584_1246 | 220 |
| 604 | 3300053083 | Ga0495655_0025343 | Ga0495655_0025343_665_1327 | 220 |
| 605 | 3300053084 | Ga0495595_0050532 | Ga0495595_0050532_662_1324 | 220 |
| 606 | 3300053084 | Ga0495595_0093121 | Ga0495595_0093121_613_1275 | 220 |
| 607 | 3300053084 | Ga0495595_0116562 | Ga0495595_0116562_583_1245 | 220 |
| 608 | 3300053085 | Ga0495619_0093189 | Ga0495619_0093189_54_716 | 220 |
| 609 | 3300053085 | Ga0495619_0200182 | Ga0495619_0200182_585_1247 | 220 |
| 610 | 3300005535 | Ga0070684_100405804 | Ga0070684_1004058041 | 221 |
| 611 | 3300035398 | Ga0316574_0169693 | Ga0316574_0169693_653_1333 | 221 |
| 612 | 3300035725 | Ga0373947_0240860 | Ga0373947_0240860_58_738 | 221 |
| 613 | 3300046674 | Ga0495588_0146309 | Ga0495588_0146309_130_822 | 221 |
| 614 | 3300000546 | LJNas_1009304 | LJNas_10093042 | 224 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1itg-assembly1.cif.gz_A-2 | crystal structure of the catalytic domain of hiv-1 integrase: similarity to other polynucleotidyl transferases | 0.7369 | 24 | 147 |
| 7ouf-assembly1.cif.gz_D | structure of the stlv intasome:b56 complex bound to the strand-transfer inhibitor xz450 | 0.7244 | 22 | 147 |
| 6qbv-assembly2.cif.gz_D | structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form) | 0.7192 | 23 | 168 |
| 6u8q-assembly1.cif.gz_J | cryoem structure of hiv-1 cleaved synaptic complex (csc) intasome | 0.712 | 25 | 169 |
| 6u8q-assembly1.cif.gz_L | cryoem structure of hiv-1 cleaved synaptic complex (csc) intasome | 0.6839 | 25 | 168 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P35443_731_958_2.60.120.200 | Mainly Beta;Sandwich;Jelly Rolls; | 0.7834 | 64 | 88 | 2.60.120.200 |
| af_I6YC39_133_303_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.7359 | 30 | 188 | 3.30.420.10 |
| af_Q8T132_51_168_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.6975 | 52 | 168 | 3.30.420.10 |
| af_Q559S3_126_326_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.6957 | 9 | 193 | 3.30.420.10 |
| af_Q8IZF6_28_218_2.60.120.200 | Mainly Beta;Sandwich;Jelly Rolls; | 0.6843 | 62 | 87 | 2.60.120.200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3MX84-F1-model_v4 | IS630 family transposase | 0.9841 | 64 | 190 |
|
| AF-A0A2G2KKG6-F1-model_v4 | deleted | 0.9807 | 75 | 184 |
|
| AF-A0A535VRX6-F1-model_v4 | Tc1-like transposase DDE domain-containing protein | 0.9778 | 77 | 193 |
|
| AF-A0A840DCK1-F1-model_v4 | deleted | 0.9744 | 87 | 188 |
|
| AF-A0A326U8B3-F1-model_v4 | DDE superfamily endonuclease | 0.9705 | 69 | 148 |
GO:0004519
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar