F469362

General Info

Members Datasets Scaffolds Average Seq Length
614 346 1228 77

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_11318260|Ga0307406_113182601
Length 90
Sequence VDETRRPRDRVSSGSRVMVKPTLVSNSIRSHRAAAGLTQAELARTIGVTRQTLIAIEQQRYSPTLELAFQIARAFGVGIDDLFQYPEVSR

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
151 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
152 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
165 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
166 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
191 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
192 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
193 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
194 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
195 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
196 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
197 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
198 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
199 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
200 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
201 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
204 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
205 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
206 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
207 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
208 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
209 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
210 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
211 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
212 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
213 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
214 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
217 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
239 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
242 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
257 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
258 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
262 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
269 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
270 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
271 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
276 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
297 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
298 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
299 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
303 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
312 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
317 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
318 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
319 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
320 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
321 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
322 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
325 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
326 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
327 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
331 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
332 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
337 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
338 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
339 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
340 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
341 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
342 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
343 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
344 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
345 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
346 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.51
Nodule 0
Rhizoplane 9.12
Rhizosphere 78.01
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_11318260 3300031901 Bacteria 630
2 LJQas_1047879 3300000549 Bacteria 511
3 JGI24737J22298_10081411 3300001990 Bacteria 963
4 JGI24738J21930_10034999 3300002075 Bacteria 1023
5 Ga0007423J48922_101416 3300003285 Bacteria 954
6 rootH1_10066067 3300003316 Bacteria 2823
7 rootH2_10097559 3300003320 Bacteria 5323
8 JGI25407J50210_10018298 3300003373 Bacteria 1820
9 Ga0006562J51391_1053289 3300003578 Bacteria 750
10 Ga0065714_10153235 3300005288 Bacteria 1093
11 Ga0065714_10154033 3300005288 Bacteria 1088
12 Ga0068869_100342339 3300005334 Bacteria 1217
13 Ga0068869_100819915 3300005334 Bacteria 801
14 Ga0070666_11307829 3300005335 Bacteria 541
15 Ga0070682_100558647 3300005337 Bacteria 897
16 Ga0068868_101330807 3300005338 Bacteria 668
17 Ga0070660_101223404 3300005339 Bacteria 637
18 Ga0070687_101007118 3300005343 Bacteria 604
19 Ga0070668_100008932 3300005347 Bacteria 7439
20 Ga0070668_100426679 3300005347 Bacteria 1136
21 Ga0070668_101116878 3300005347 Bacteria 712
22 Ga0070668_101607656 3300005347 Bacteria 596
23 Ga0070669_101262034 3300005353 Bacteria 639
24 Ga0070675_100164471 3300005354 Bacteria 1910
25 Ga0070675_100260699 3300005354 Bacteria 1519
26 Ga0070675_101848124 3300005354 Bacteria 557
27 Ga0070671_100299895 3300005355 Bacteria 1368
28 Ga0070671_101087557 3300005355 Bacteria 702
29 Ga0070674_100107329 3300005356 Bacteria 2044
30 Ga0070659_101424748 3300005366 Bacteria 616
31 Ga0070659_102058719 3300005366 Bacteria 513
32 Ga0070667_100042072 3300005367 Bacteria 3833
33 Ga0070667_100319287 3300005367 Bacteria 1401
34 Ga0070667_101142949 3300005367 Bacteria 728
35 Ga0070703_10384817 3300005406 Bacteria 607
36 Ga0070714_100000552 3300005435 Bacteria 26986
37 Ga0070714_100213318 3300005435 Bacteria 1770
38 Ga0070714_101350410 3300005435 Bacteria 696
39 Ga0070713_100140592 3300005436 Bacteria 2138
40 Ga0070713_100566592 3300005436 Bacteria 1077
41 Ga0070710_10130982 3300005437 Bacteria 1529
42 Ga0070710_10180578 3300005437 Bacteria 1321
43 Ga0070711_100744142 3300005439 Bacteria 828
44 Ga0070700_100166077 3300005441 Bacteria 1524
45 Ga0070700_100227278 3300005441 Bacteria 1326
46 Ga0070708_100200607 3300005445 Bacteria 1867
47 Ga0070678_100156103 3300005456 Bacteria 1843
48 Ga0070678_100470056 3300005456 Bacteria 1105
49 Ga0070662_101127984 3300005457 Bacteria 673
50 Ga0070707_100106415 3300005468 Bacteria 2720
51 Ga0070707_100887757 3300005468 Bacteria 856
52 Ga0070699_100006138 3300005518 Bacteria 10506
53 Ga0070684_100046301 3300005535 Bacteria 3769
54 Ga0070672_100525840 3300005543 Bacteria 1025
55 Ga0070686_101086634 3300005544 Bacteria 660
56 Ga0070696_100258224 3300005546 Bacteria 1320
57 Ga0070693_101503226 3300005547 Bacteria 526
58 Ga0070665_100179537 3300005548 Bacteria 2118
59 Ga0070665_100201062 3300005548 Bacteria 1993
60 Ga0070665_101121717 3300005548 Bacteria 798
61 Ga0070704_100712114 3300005549 Bacteria 891
62 Ga0070704_100873351 3300005549 Bacteria 807
63 Ga0070664_101570520 3300005564 Bacteria 623
64 Ga0070664_101830857 3300005564 Bacteria 576
65 Ga0068857_100444847 3300005577 Bacteria 1211
66 Ga0068857_102129682 3300005577 Bacteria 550
67 Ga0068856_100398303 3300005614 Bacteria 1396
68 Ga0070702_100656212 3300005615 Bacteria 794
69 Ga0070702_100801690 3300005615 Bacteria 728
70 Ga0068859_100033620 3300005617 Bacteria 5150
71 Ga0068864_100066702 3300005618 Bacteria 3124
72 Ga0068864_100171937 3300005618 Bacteria 1976
73 Ga0068864_100312905 3300005618 Bacteria 1473
74 Ga0068861_102253479 3300005719 Bacteria 546
75 Ga0068863_100050620 3300005841 Bacteria 3937
76 Ga0068863_100155043 3300005841 Bacteria 2193
77 Ga0068863_101211193 3300005841 Bacteria 761
78 Ga0068858_100448146 3300005842 Bacteria 1244
79 Ga0068860_100015827 3300005843 Bacteria 7364
80 Ga0068862_100064886 3300005844 Bacteria 3144
81 Ga0068862_102491293 3300005844 Bacteria 529
82 Ga0081538_10000209 3300005981 Bacteria 65166
83 Ga0081540_1058750 3300005983 Bacteria 1850
84 Ga0081539_10007693 3300005985 Bacteria 9680
85 Ga0081539_10282426 3300005985 Bacteria 722
86 Ga0070717_10190762 3300006028 Bacteria 1791
87 Ga0070717_10282431 3300006028 Bacteria 1473
88 Ga0075365_10005065 3300006038 Bacteria 7071
89 Ga0075365_10064814 3300006038 Bacteria 2448
90 Ga0075368_10098807 3300006042 Bacteria 1197
91 Ga0075363_100185747 3300006048 Bacteria 1184
92 Ga0075364_10006482 3300006051 Bacteria 6879
93 Ga0075364_10378144 3300006051 Bacteria 966
94 Ga0075364_10442207 3300006051 Bacteria 888
95 Ga0075364_10788802 3300006051 Bacteria 648
96 Ga0070715_10014088 3300006163 Bacteria 2953
97 Ga0070716_100155325 3300006173 Bacteria 1476
98 Ga0070712_100765144 3300006175 Bacteria 827
99 Ga0075362_10240737 3300006177 Bacteria 888
100 Ga0075369_10038603 3300006186 Bacteria 2038
101 Ga0075369_10242887 3300006186 Bacteria 835
102 Ga0097621_100816539 3300006237 Bacteria 865
103 Ga0097621_101732740 3300006237 Bacteria 595
104 Ga0075370_10045511 3300006353 Bacteria 2482
105 Ga0075428_100331166 3300006844 Bacteria 1635
106 Ga0075428_100696097 3300006844 Bacteria 1083
107 Ga0075428_100989579 3300006844 Bacteria 890
108 Ga0075428_101630909 3300006844 Bacteria 674
109 Ga0075430_100338812 3300006846 Bacteria 1242
110 Ga0075430_100472457 3300006846 Bacteria 1035
111 Ga0075430_100560921 3300006846 Bacteria 942
112 Ga0075430_101509598 3300006846 Bacteria 552
113 Ga0075431_100313189 3300006847 Bacteria 1584
114 Ga0075431_100601449 3300006847 Bacteria 1083
115 Ga0075433_10195357 3300006852 Bacteria 1800
116 Ga0075434_101397635 3300006871 Bacteria 710
117 Ga0075434_101934896 3300006871 Bacteria 595
118 Ga0075434_102353277 3300006871 Bacteria 535
119 Ga0075429_100011643 3300006880 Bacteria 7627
120 Ga0075436_100793989 3300006914 Bacteria 704
121 Ga0097620_100033620 3300006931 Bacteria 5150
122 Ga0075435_101054654 3300007076 Bacteria 710
123 Ga0105244_10144673 3300009036 Bacteria 1141
124 Ga0105244_10336418 3300009036 Bacteria 696
125 Ga0105244_10455893 3300009036 Bacteria 588
126 Ga0105240_11738847 3300009093 Bacteria 651
127 Ga0111539_10142464 3300009094 Bacteria 2806
128 Ga0111539_12649782 3300009094 Bacteria 581
129 Ga0105247_10140950 3300009101 Bacteria 1580
130 Ga0105247_10385125 3300009101 Bacteria 995
131 Ga0114129_10000525 3300009147 Bacteria 46845
132 Ga0114129_10056516 3300009147 Bacteria 5496
133 Ga0114129_10370570 3300009147 Bacteria 1893
134 Ga0114129_10649549 3300009147 Bacteria 1362
135 Ga0114129_10878984 3300009147 Bacteria 1137
136 Ga0105243_10211942 3300009148 Bacteria 1706
137 Ga0105243_10431346 3300009148 Bacteria 1232
138 Ga0105243_10671964 3300009148 Bacteria 1006
139 Ga0105243_10726766 3300009148 Bacteria 971
140 Ga0105243_11238069 3300009148 Bacteria 761
141 Ga0105241_11083495 3300009174 Bacteria 754
142 Ga0105242_12423746 3300009176 Bacteria 572
143 Ga0105248_10064931 3300009177 Bacteria 4097
144 Ga0105237_12664720 3300009545 Bacteria 511
145 Ga0105249_12072174 3300009553 Bacteria 642
146 Ga0105246_10376406 3300011119 Bacteria 1172
147 Ga0105246_10411688 3300011119 Bacteria 1126
148 Ga0157313_1037821 3300012503 Bacteria 579
149 Ga0157373_10264010 3300013100 Bacteria 1218
150 Ga0157370_10164528 3300013104 Bacteria 2063
151 Ga0157370_11016055 3300013104 Bacteria 750
152 Ga0157374_11076845 3300013296 Bacteria 824
153 Ga0157374_12279291 3300013296 Bacteria 569
154 Ga0157378_11810310 3300013297 Bacteria 659
155 Ga0163162_10260698 3300013306 Bacteria 1865
156 Ga0163162_10308564 3300013306 Bacteria 1714
157 Ga0163162_10663112 3300013306 Bacteria 1166
158 Ga0163162_10877828 3300013306 Bacteria 1011
159 Ga0157372_12911638 3300013307 Bacteria 548
160 Ga0157375_10046874 3300013308 Bacteria 4217
161 Ga0157375_12212123 3300013308 Bacteria 655
162 Ga0157375_12414079 3300013308 Bacteria 627
163 Ga0157375_12958384 3300013308 Bacteria 567
164 Ga0163163_10009330 3300014325 Bacteria 8754
165 Ga0157380_10398661 3300014326 Bacteria 1305
166 Ga0157380_10909185 3300014326 Bacteria 907
167 Ga0157380_11657438 3300014326 Bacteria 696
168 Ga0157380_12500653 3300014326 Bacteria 582
169 Ga0157380_12559530 3300014326 Bacteria 576
170 Ga0157380_13339573 3300014326 Bacteria 513
171 Ga0157377_10936195 3300014745 Bacteria 651
172 Ga0157379_10140978 3300014968 Bacteria 2173
173 Ga0157379_10223717 3300014968 Bacteria 1705
174 Ga0157379_10813700 3300014968 Bacteria 882
175 Ga0157376_10331287 3300014969 Bacteria 1451
176 Ga0163161_10698668 3300017792 Bacteria 844
177 Ga0209646_1000014 3300025246 Bacteria 550484
178 Ga0207655_1114232 3300025728 Bacteria 906
179 Ga0207655_1245370 3300025728 Bacteria 510
180 Ga0207682_10484963 3300025893 Bacteria 585
181 Ga0207692_10105927 3300025898 Bacteria 1552
182 Ga0207692_10285681 3300025898 Bacteria 1000
183 Ga0207688_10790881 3300025901 Bacteria 601
184 Ga0207688_10884523 3300025901 Bacteria 566
185 Ga0207645_10647525 3300025907 Bacteria 718
186 Ga0207643_10120712 3300025908 Bacteria 1552
187 Ga0207643_10724054 3300025908 Bacteria 643
188 Ga0207693_10019010 3300025915 Bacteria 5469
189 Ga0207693_11069006 3300025915 Bacteria 614
190 Ga0207663_11224366 3300025916 Bacteria 604
191 Ga0207663_11671174 3300025916 Bacteria 512
192 Ga0207646_10027054 3300025922 Bacteria 5230
193 Ga0207681_10457081 3300025923 Bacteria 1040
194 Ga0207650_11440003 3300025925 Bacteria 586
195 Ga0207659_10327818 3300025926 Bacteria 1265
196 Ga0207700_10062615 3300025928 Bacteria 2826
197 Ga0207700_10152755 3300025928 Bacteria 1909
198 Ga0207664_10018340 3300025929 Bacteria 5149
199 Ga0207664_10021530 3300025929 Bacteria 4797
200 Ga0207664_10768033 3300025929 Bacteria 867
201 Ga0207664_11294739 3300025929 Bacteria 648
202 Ga0207644_10292285 3300025931 Bacteria 1311
203 Ga0207706_10053598 3300025933 Bacteria 3560
204 Ga0207706_10940879 3300025933 Bacteria 728
205 Ga0207686_10521855 3300025934 Bacteria 925
206 Ga0207709_10506553 3300025935 Bacteria 943
207 Ga0207709_11768173 3300025935 Bacteria 514
208 Ga0207670_10726276 3300025936 Bacteria 824
209 Ga0207665_10564274 3300025939 Bacteria 886
210 Ga0207691_10382944 3300025940 Bacteria 1201
211 Ga0207711_10825556 3300025941 Bacteria 863
212 Ga0207689_10176233 3300025942 Bacteria 1763
213 Ga0207661_10925618 3300025944 Bacteria 803
214 Ga0207667_11031291 3300025949 Bacteria 809
215 Ga0207651_10850530 3300025960 Bacteria 811
216 Ga0207712_10818681 3300025961 Bacteria 819
217 Ga0207668_11531379 3300025972 Bacteria 602
218 Ga0207658_10562085 3300025986 Bacteria 1022
219 Ga0207677_10812166 3300026023 Bacteria 838
220 Ga0207677_11668540 3300026023 Bacteria 591
221 Ga0207703_10125315 3300026035 Bacteria 2211
222 Ga0207678_10543960 3300026067 Bacteria 1015
223 Ga0207708_10099235 3300026075 Bacteria 2252
224 Ga0207708_10123089 3300026075 Bacteria 2022
225 Ga0207641_10069137 3300026088 Bacteria 3030
226 Ga0207641_10428588 3300026088 Bacteria 1275
227 Ga0207648_10308912 3300026089 Bacteria 1419
228 Ga0207676_10028447 3300026095 Bacteria 4175
229 Ga0207676_10193197 3300026095 Bacteria 1793
230 Ga0207674_10044880 3300026116 Bacteria 4551
231 Ga0207674_10406443 3300026116 Bacteria 1316
232 Ga0207674_11494801 3300026116 Bacteria 645
233 Ga0207674_11742447 3300026116 Bacteria 591
234 Ga0207675_101894295 3300026118 Bacteria 615
235 Ga0207683_10159024 3300026121 Bacteria 2042
236 Ga0207683_11955889 3300026121 Bacteria 535
237 Ga0209983_1121713 3300027665 Bacteria 595
238 Ga0209813_10093882 3300027866 Bacteria 1011
239 Ga0268266_10353723 3300028379 Bacteria 1381
240 Ga0307515_10097187 3300028794 Bacteria 3602
241 Ga0307515_10496103 3300028794 Bacteria 832
242 Ga0307513_10010361 3300031456 Bacteria 11691
243 Ga0307513_10276106 3300031456 Bacteria 1460
244 Ga0307513_10449787 3300031456 Bacteria 1013
245 Ga0307408_100002277 3300031548 Bacteria 13670
246 Ga0307408_100004071 3300031548 Bacteria 9973
247 Ga0307408_100283877 3300031548 Bacteria 1380
248 Ga0307408_100341976 3300031548 Bacteria 1267
249 Ga0307408_100549077 3300031548 Bacteria 1019
250 Ga0307508_10195368 3300031616 Bacteria 1625
251 Ga0307514_10209345 3300031649 Bacteria 1213
252 Ga0316575_10000013 3300031665 Bacteria 50283
253 Ga0316579_10653131 3300031691 Bacteria 509
254 Ga0307516_10012688 3300031730 Bacteria 9060
255 Ga0307516_10338399 3300031730 Bacteria 1172
256 Ga0307405_10013635 3300031731 Bacteria 4341
257 Ga0307405_10116864 3300031731 Bacteria 1817
258 Ga0307405_10187020 3300031731 Bacteria 1492
259 Ga0307405_10951416 3300031731 Bacteria 730
260 Ga0307405_11047140 3300031731 Bacteria 698
261 Ga0307405_11296050 3300031731 Bacteria 633
262 Ga0307413_10027423 3300031824 Bacteria 3156
263 Ga0307413_10070165 3300031824 Bacteria 2202
264 Ga0307413_10175362 3300031824 Bacteria 1522
265 Ga0307413_10586006 3300031824 Bacteria 910
266 Ga0307413_11827153 3300031824 Bacteria 544
267 Ga0307410_10004387 3300031852 Bacteria 7286
268 Ga0307410_10055843 3300031852 Bacteria 2682
269 Ga0307410_11715341 3300031852 Bacteria 557
270 Ga0307406_10000057 3300031901 Bacteria 61661
271 Ga0307406_10010349 3300031901 Bacteria 5257
272 Ga0307406_10194288 3300031901 Bacteria 1488
273 Ga0307406_10285083 3300031901 Bacteria 1262
274 Ga0307406_10504761 3300031901 Bacteria 981
275 Ga0307406_11314230 3300031901 Bacteria 631
276 Ga0307406_11780949 3300031901 Bacteria 547
277 Ga0307407_10041601 3300031903 Bacteria 2571
278 Ga0307407_10209925 3300031903 Bacteria 1310
279 Ga0307407_10553721 3300031903 Bacteria 850
280 Ga0307407_10770408 3300031903 Bacteria 730
281 Ga0307407_11227373 3300031903 Bacteria 586
282 Ga0307407_11535853 3300031903 Bacteria 527
283 Ga0307412_10007088 3300031911 Bacteria 6361
284 Ga0307412_10087921 3300031911 Bacteria 2166
285 Ga0307412_10139136 3300031911 Bacteria 1775
286 Ga0307412_10807276 3300031911 Bacteria 815
287 Ga0307412_11090843 3300031911 Bacteria 710
288 Ga0307412_11497191 3300031911 Bacteria 613
289 Ga0307409_100011513 3300031995 Bacteria 5584
290 Ga0307409_100030211 3300031995 Bacteria 3890
291 Ga0307409_100114495 3300031995 Bacteria 2269
292 Ga0307416_100032797 3300032002 Bacteria 3930
293 Ga0307416_100409281 3300032002 Bacteria 1397
294 Ga0307416_100672569 3300032002 Bacteria 1122
295 Ga0307416_100828905 3300032002 Bacteria 1022
296 Ga0307416_100892838 3300032002 Bacteria 988
297 Ga0307416_103433210 3300032002 Bacteria 530
298 Ga0307416_103530194 3300032002 Bacteria 523
299 Ga0307414_10089559 3300032004 Bacteria 2281
300 Ga0307414_10258889 3300032004 Bacteria 1451
301 Ga0307414_10500258 3300032004 Bacteria 1075
302 Ga0307414_10655179 3300032004 Bacteria 947
303 Ga0307414_10741194 3300032004 Bacteria 892
304 Ga0307414_11019063 3300032004 Bacteria 762
305 Ga0307414_11043111 3300032004 Bacteria 754
306 Ga0307414_11195118 3300032004 Bacteria 704
307 Ga0307411_10065077 3300032005 Bacteria 2444
308 Ga0307411_10679290 3300032005 Bacteria 895
309 Ga0307411_10999904 3300032005 Bacteria 749
310 Ga0307411_11145776 3300032005 Bacteria 703
311 Ga0307415_100102257 3300032126 Bacteria 2105
312 Ga0307415_101238710 3300032126 Bacteria 704
313 Ga0307415_101471462 3300032126 Bacteria 651
314 Ga0307507_10015090 3300033179 Bacteria 9128
315 Ga0307507_10158221 3300033179 Bacteria 1682
316 Ga0373950_0036090 3300034818 Bacteria 932
317 Ga0373926_0094913 3300035083 Bacteria 1112
318 Ga0373934_0016675 3300035086 Bacteria 2794
319 Ga0373949_0087746 3300035090 Bacteria 837
320 Ga0373923_0019868 3300035111 Bacteria 2605
321 Ga0373936_0193679 3300035113 Bacteria 895
322 Ga0373953_0481835 3300035117 Bacteria 549
323 Ga0373954_0060976 3300035118 Bacteria 1780
324 Ga0373957_0013917 3300035120 Bacteria 2741
325 Ga0373943_1007375 3300035170 Bacteria 500
326 Ga0373946_0063756 3300035171 Bacteria 1575
327 Ga0373955_0051905 3300035172 Bacteria 2235
328 Ga0373961_0176309 3300035241 Bacteria 742
329 Ga0373924_0065994 3300035410 Bacteria 1520
330 Ga0373935_0192536 3300035692 Bacteria 1405
331 Ga0373933_0113958 3300035724 Bacteria 1688
332 Ga0373937_0009916 3300036401 Bacteria 8305
333 Ga0373925_0298181 3300037068 Bacteria 1301
334 Ga0373925_0776668 3300037068 Bacteria 790
335 Ga0395900_1003191 3300037418 Bacteria 755
336 Ga0395898_0177462 3300037466 Bacteria 2036
337 Ga0436364_0238576 3300037853 Bacteria 643
338 Ga0395901_0056987 3300038443 Bacteria 4065
339 Ga0436363_1376076 3300039450 Bacteria 707
340 Ga0439466_0163349 3300041411 Bacteria 681
341 Ga0439465_0200923 3300041413 Bacteria 726
342 Ga0439465_0309698 3300041413 Bacteria 592
343 Ga0451787_088622 3300041441 Bacteria 714
344 Ga0451787_222038 3300041441 Bacteria 757
345 Ga0451787_828715 3300041441 Bacteria 531
346 Ga0451791_0887963 3300041451 Bacteria 540
347 Ga0451791_1801626 3300041451 Bacteria 642
348 Ga0451793_0385174 3300041452 Bacteria 816
349 Ga0451797_1389128 3300041453 Bacteria 896
350 Ga0451798_0539254 3300041458 Bacteria 521
351 Ga0451800_1683393 3300041459 Bacteria 503
352 Ga0451802_0002292 3300041460 Bacteria 592
353 Ga0451802_0259616 3300041460 Bacteria 551
354 Ga0451802_0505636 3300041460 Bacteria 678
355 Ga0451807_0844761 3300041486 Bacteria 777
356 Ga0451807_2679380 3300041486 Bacteria 586
357 Ga0451807_2685360 3300041486 Bacteria 596
358 Ga0451837_1387813 3300041494 Bacteria 672
359 Ga0451839_0820932 3300041496 Bacteria 713
360 Ga0451851_0551522 3300041507 Bacteria 652
361 Ga0451843_0182767 3300041509 Bacteria 773
362 Ga0451853_1677312 3300041512 Bacteria 742
363 Ga0451853_1857742 3300041512 Bacteria 572
364 Ga0439442_000746 3300042002 Bacteria 6808
365 Ga0439442_058369 3300042002 Bacteria 816
366 Ga0439432_041132 3300042006 Bacteria 1465
367 Ga0439451_029352 3300042009 Bacteria 1107
368 Ga0439451_129967 3300042009 Bacteria 514
369 Ga0439452_056324 3300042010 Bacteria 889
370 Ga0439457_078313 3300042014 Bacteria 758
371 Ga0450920_000821 3300042122 Bacteria 5029
372 Ga0450920_009829 3300042122 Bacteria 1766
373 Ga0450907_004322 3300042146 Bacteria 2456
374 Ga0450910_014503 3300042147 Bacteria 1154
375 Ga0439446_0181596 3300042156 Bacteria 704
376 Ga0450908_011277 3300042184 Bacteria 1638
377 Ga0439434_0001297 3300042435 Bacteria 7198
378 Ga0439434_0152072 3300042435 Bacteria 767
379 Ga0450918_011400 3300042531 Bacteria 1550
380 Ga0451577_0005201 3300042876 Bacteria 13390
381 Ga0451577_0058864 3300042876 Bacteria 3426
382 Ga0466972_0146845 3300044658 Bacteria 1109
383 Ga0466965_0163815 3300044683 Bacteria 1167
384 Ga0453684_0023308 3300044712 Bacteria 9129
385 Ga0453684_0471259 3300044712 Bacteria 1394
386 Ga0453684_0929758 3300044712 Bacteria 929
387 Ga0466970_0591466 3300044765 Bacteria 643
388 Ga0466960_0135340 3300044901 Bacteria 1304
389 Ga0466960_0143205 3300044901 Bacteria 1271
390 Ga0451576_0219846 3300045051 Bacteria 1983
391 Ga0451576_0538054 3300045051 Bacteria 1227
392 Ga0451576_1670605 3300045051 Bacteria 660
393 Ga0495592_0245237 3300046454 Bacteria 1187
394 Ga0495629_0278894 3300046459 Bacteria 1147
395 Ga0495641_0032849 3300046461 Bacteria 2467
396 Ga0495651_0060458 3300046462 Bacteria 2901
397 Ga0495653_0028718 3300046463 Bacteria 4446
398 Ga0495653_0355989 3300046463 Bacteria 940
399 Ga0495650_0001684 3300046471 Bacteria 20384
400 Ga0495580_0012435 3300046472 Bacteria 6525
401 Ga0495580_0228524 3300046472 Bacteria 1278
402 Ga0495582_0146352 3300046473 Bacteria 1340
403 Ga0495582_0162282 3300046473 Bacteria 1271
404 Ga0495582_0239435 3300046473 Bacteria 1040
405 Ga0495639_0014707 3300046475 Bacteria 3390
406 Ga0495639_0125032 3300046475 Bacteria 1228
407 Ga0495662_0346515 3300046476 Bacteria 730
408 Ga0495664_0335304 3300046477 Bacteria 911
409 Ga0495594_0036480 3300046499 Bacteria 2681
410 Ga0495608_0008233 3300046511 Bacteria 7320
411 Ga0495618_0101847 3300046514 Bacteria 1838
412 Ga0495620_0012855 3300046515 Bacteria 4304
413 Ga0495628_0126081 3300046516 Bacteria 1961
414 Ga0495631_0072148 3300046518 Bacteria 1491
415 Ga0495637_0243984 3300046520 Bacteria 648
416 Ga0495652_0798778 3300046529 Bacteria 628
417 Ga0495652_1009888 3300046529 Bacteria 544
418 Ga0495654_0087718 3300046530 Bacteria 1448
419 Ga0495654_0124196 3300046530 Bacteria 1165
420 Ga0495654_0187264 3300046530 Bacteria 893
421 Ga0495665_0086890 3300046531 Bacteria 1643
422 Ga0495665_0299671 3300046531 Bacteria 823
423 Ga0495640_0195992 3300046533 Bacteria 1282
424 Ga0495640_0547677 3300046533 Bacteria 701
425 Ga0495586_0032386 3300046535 Bacteria 2802
426 Ga0495586_0134356 3300046535 Bacteria 1386
427 Ga0495587_0407302 3300046536 Bacteria 755
428 Ga0495622_0472890 3300046557 Bacteria 537
429 Ga0495633_0270110 3300046558 Bacteria 774
430 Ga0495667_0010813 3300046559 Bacteria 6170
431 Ga0495667_1012427 3300046559 Bacteria 506
432 Ga0495656_0003807 3300046615 Bacteria 5128
433 Ga0495656_0354038 3300046615 Bacteria 761
434 Ga0495656_0420817 3300046615 Bacteria 701
435 Ga0495656_0578433 3300046615 Bacteria 600
436 Ga0495656_0656308 3300046615 Bacteria 563
437 Ga0495668_0673187 3300046616 Bacteria 572
438 Ga0495634_0015237 3300046642 Bacteria 5527
439 Ga0495659_0076455 3300046664 Bacteria 1263
440 Ga0495659_0205336 3300046664 Bacteria 809
441 Ga0495588_0010192 3300046674 Bacteria 4361
442 Ga0495588_0054597 3300046674 Bacteria 2061
443 Ga0495588_0295169 3300046674 Bacteria 854
444 Ga0495588_0532681 3300046674 Bacteria 615
445 Ga0495657_0136259 3300046675 Bacteria 1533
446 Ga0495599_0088807 3300046678 Bacteria 1929
447 Ga0495623_0295370 3300046679 Bacteria 897
448 Ga0495623_0659117 3300046679 Bacteria 539
449 Ga0495646_0018007 3300046680 Bacteria 4474
450 Ga0495647_0227053 3300046681 Bacteria 826
451 Ga0495658_0118194 3300046683 Bacteria 1601
452 Ga0495658_0532542 3300046683 Bacteria 752
453 Ga0495670_0007294 3300046691 Bacteria 5433
454 Ga0495670_0588478 3300046691 Bacteria 606
455 Ga0495671_0185005 3300046692 Bacteria 1011
456 Ga0495649_0421772 3300046694 Bacteria 668
457 Ga0495600_0036311 3300046809 Bacteria 3202
458 Ga0495581_0082032 3300047315 Bacteria 1868
459 Ga0495581_0105094 3300047315 Bacteria 1641
460 Ga0495581_0110181 3300047315 Bacteria 1601
461 Ga0495674_0153596 3300047319 Bacteria 1929
462 Ga0495674_0272454 3300047319 Bacteria 1388
463 Ga0495674_0375791 3300047319 Bacteria 1150
464 Ga0495672_0032541 3300047320 Bacteria 3242
465 Ga0495680_0028046 3300047322 Bacteria 4619
466 Ga0495680_0935006 3300047322 Bacteria 558
467 Ga0495683_0427186 3300047323 Bacteria 547
468 Ga0495675_0112700 3300047444 Bacteria 1697
469 Ga0495677_0332147 3300047445 Bacteria 599
470 Ga0495681_0329633 3300047470 Bacteria 584
471 Ga0495681_0341296 3300047470 Bacteria 571
472 Ga0495686_0180827 3300047472 Bacteria 1222
473 Ga0495686_0362026 3300047472 Bacteria 786
474 Ga0495686_0474339 3300047472 Bacteria 662
475 Ga0495593_0229699 3300047673 Bacteria 930
476 Ga0495602_0056874 3300048088 Bacteria 3436
477 Ga0495614_0134758 3300048089 Bacteria 1095
478 Ga0495626_0379084 3300048091 Bacteria 549
479 Ga0496100_0330271 3300048903 Bacteria 1147
480 Ga0496101_0016210 3300048904 Bacteria 5029
481 Ga0496101_0895856 3300048904 Bacteria 699
482 Ga0496102_0089622 3300048905 Bacteria 2845
483 Ga0496102_0193163 3300048905 Bacteria 1918
484 Ga0496102_0413469 3300048905 Bacteria 1267
485 Ga0496102_1806053 3300048905 Bacteria 528
486 Ga0496103_0111827 3300048906 Bacteria 1735
487 Ga0496103_0246010 3300048906 Bacteria 1151
488 Ga0496103_0333480 3300048906 Bacteria 975
489 Ga0496104_0365361 3300048907 Bacteria 1355
490 Ga0496104_1452259 3300048907 Bacteria 589
491 Ga0496105_0216130 3300048908 Bacteria 1561
492 Ga0496105_0254154 3300048908 Bacteria 1423
493 Ga0496106_0007674 3300048909 Bacteria 7981
494 Ga0496106_0405943 3300048909 Bacteria 1095
495 Ga0496107_0033789 3300048910 Bacteria 3660
496 Ga0496107_0199020 3300048910 Bacteria 1489
497 Ga0496108_0013116 3300048911 Bacteria 6756
498 Ga0496108_0526856 3300048911 Bacteria 1031
499 Ga0496108_0771928 3300048911 Bacteria 830
500 Ga0496108_1340852 3300048911 Bacteria 600
501 Ga0496109_0005336 3300048912 Bacteria 10746
502 Ga0496109_0370739 3300048912 Bacteria 1352
503 Ga0496109_0593561 3300048912 Bacteria 1043
504 Ga0496110_0008492 3300048913 Bacteria 8270
505 Ga0496110_0062788 3300048913 Bacteria 3282
506 Ga0496110_0292173 3300048913 Bacteria 1484
507 Ga0496111_0050629 3300048914 Bacteria 2997
508 Ga0496111_0079863 3300048914 Bacteria 2387
509 Ga0496111_0181940 3300048914 Bacteria 1562
510 Ga0496111_0904246 3300048914 Bacteria 635
511 Ga0496112_0728745 3300048915 Bacteria 918
512 Ga0496112_0753058 3300048915 Bacteria 900
513 Ga0496112_1890639 3300048915 Bacteria 508
514 Ga0496113_0004740 3300048916 Bacteria 8395
515 Ga0496113_0644562 3300048916 Bacteria 847
516 Ga0496114_0035589 3300048917 Bacteria 4112
517 Ga0496114_0374914 3300048917 Bacteria 1259
518 Ga0496115_0012959 3300048918 Bacteria 6289
519 Ga0496115_0183308 3300048918 Bacteria 1730
520 Ga0496117_0002221 3300048920 Bacteria 25126
521 Ga0496118_0009941 3300048921 Bacteria 9499
522 Ga0496119_0025427 3300048922 Bacteria 4135
523 Ga0496120_0031620 3300048923 Bacteria 3202
524 Ga0496122_0000511 3300048925 Bacteria 80182
525 Ga0496122_0019106 3300048925 Bacteria 6283
526 Ga0496123_0000011 3300048926 Bacteria 493925
527 Ga0496123_0149174 3300048926 Bacteria 1265
528 Ga0496124_0195881 3300048927 Bacteria 1541
529 Ga0496124_0284227 3300048927 Bacteria 1204
530 Ga0496125_0009452 3300048928 Bacteria 10011
531 Ga0496125_0061711 3300048928 Bacteria 3004
532 Ga0496126_0005089 3300048929 Bacteria 15250
533 Ga0496126_0022853 3300048929 Bacteria 6072
534 Ga0496126_0185015 3300048929 Bacteria 1767
535 Ga0496126_0275639 3300048929 Bacteria 1395
536 Ga0501290_056529 3300049513 Bacteria 623
537 Ga0501031_0449796 3300049568 Bacteria 832
538 Ga0501034_0000622 3300049571 Bacteria 55475
539 Ga0501034_0034200 3300049571 Bacteria 5153
540 Ga0501034_0489350 3300049571 Unclassified 1145
541 Ga0501034_1351809 3300049571 Unclassified 588
542 Ga0501034_1530080 3300049571 Bacteria 541
543 Ga0501036_1696434 3300049572 Bacteria 509
544 Ga0501039_0426211 3300049575 Bacteria 1042
545 Ga0501039_1177094 3300049575 Bacteria 593
546 Ga0501046_0814804 3300049580 Bacteria 654
547 Ga0501048_0527519 3300049582 Bacteria 847
548 Ga0501067_0030688 3300049583 Bacteria 2981
549 Ga0501071_0746366 3300049587 Bacteria 754
550 Ga0501073_0000734 3300049589 Bacteria 23212
551 Ga0501074_0304447 3300049590 Bacteria 1132
552 Ga0501074_0417369 3300049590 Bacteria 952
553 Ga0501076_0136394 3300049592 Bacteria 1992
554 Ga0501076_0492217 3300049592 Bacteria 1011
555 Ga0501076_0915286 3300049592 Bacteria 723
556 Ga0501079_0372985 3300049741 Bacteria 1119
557 Ga0501081_0321539 3300049743 Bacteria 1137
558 Ga0501283_025522 3300049779 Bacteria 968
559 nmdc:mga03683_116823_c1 3300050489 Bacteria 1183
560 nmdc:mga03n38_13420_c1 3300050490 Bacteria 3111
561 nmdc:mga00v17_149303_c1 3300050491 Bacteria 1501
562 nmdc:mga00v17_409731_c1 3300050491 Bacteria 881
563 nmdc:mga00v17_60179_c1 3300050491 Bacteria 893
564 nmdc:mga00v17_874411_c1 3300050491 Bacteria 570
565 nmdc:mga0yw44_10771_c1 3300050492 Bacteria 4685
566 nmdc:mga0yw44_166913_c1 3300050492 Bacteria 1444
567 nmdc:mga0yw44_20493_c1 3300050492 Bacteria 3670
568 nmdc:mga0yw44_761306_c1 3300050492 Bacteria 658
569 nmdc:mga06z11_6684_c1 3300050494 Bacteria 4713
570 nmdc:mga04h51_61907_c1 3300050495 Bacteria 1285
571 nmdc:mga05p37_36974_c1 3300050507 Bacteria 5989
572 nmdc:mga05p37_546691_c1 3300050507 Bacteria 1319
573 nmdc:mga05p37_660037_c1 3300050507 Bacteria 1169
574 nmdc:mga05p37_827850_c1 3300050507 Bacteria 1008
575 nmdc:mga05p37_90166_c1 3300050507 Bacteria 3779
576 nmdc:mga09592_1062185_c1 3300050508 Bacteria 674
577 nmdc:mga09592_225490_c1 3300050508 Bacteria 1624
578 nmdc:mga09592_952194_c1 3300050508 Bacteria 720
579 nmdc:mga0qj67_1178873_c1 3300050509 Bacteria 596
580 nmdc:mga0qj67_269536_c1 3300050509 Bacteria 1380
581 nmdc:mga0qj67_643403_c1 3300050509 Bacteria 846
582 nmdc:mga06r32_403669_c1 3300050510 Bacteria 1349
583 nmdc:mga06r32_649612_c1 3300050510 Bacteria 1023
584 nmdc:mga06r32_759335_c1 3300050510 Bacteria 932
585 nmdc:mga08y16_1467927_c1 3300050511 Bacteria 643
586 nmdc:mga08y16_276026_c1 3300050511 Bacteria 1734
587 nmdc:mga08y16_404134_c1 3300050511 Bacteria 1397
588 nmdc:mga0n895_1517841_c1 3300050512 Bacteria 636
589 nmdc:mga0rr50_918932_c1 3300050513 Bacteria 746
590 nmdc:mga08x19_153360_c1 3300050514 Bacteria 1561
591 nmdc:mga0a205_1238870_c1 3300050515 Bacteria 594
592 nmdc:mga0a205_556236_c1 3300050515 Bacteria 1002
593 nmdc:mga0sz30_13164_c1 3300050516 Bacteria 3233
594 nmdc:mga0sz30_295331_c1 3300050516 Bacteria 722
595 nmdc:mga0sz30_351689_c1 3300050516 Bacteria 658
596 nmdc:mga0sz30_86672_c1 3300050516 Bacteria 1359
597 Ga0495601_0273632 3300053077 Bacteria 1101
598 Ga0495601_0475912 3300053077 Bacteria 807
599 Ga0495612_0209736 3300053078 Bacteria 861
600 Ga0495619_0216913 3300053085 Bacteria 1325
601 Ga0495619_1009586 3300053085 Bacteria 556
602 Ga0500578_0669466 3300053086 Bacteria 562
603 Ga0500555_047504 3300053103 Bacteria 1181
604 Ga0500562_000889 3300053108 Bacteria 7263
605 Ga0500593_091047 3300053117 Bacteria 1290
606 Ga0500568_0004302 3300053139 Bacteria 7640
607 Ga0500568_0022446 3300053139 Bacteria 2698
608 Ga0500573_0340672 3300053140 Bacteria 732
609 Ga0500579_043829 3300053143 Bacteria 2791
610 Ga0500600_0012686 3300053149 Bacteria 5115
611 Ga0500616_0001208 3300053153 Bacteria 26113
612 Ga0500616_0172087 3300053153 Bacteria 982
613 Ga0501084_1556014 3300054114 Bacteria 553
614 Ga0501082_0407186 3300060353 Bacteria 1187
615 Ga0307406_11318260
616 LJQas_1047879
617 JGI24737J22298_10081411
618 JGI24738J21930_10034999
619 Ga0007423J48922_101416
620 rootH1_10066067
621 rootH2_10097559
622 JGI25407J50210_10018298
623 Ga0006562J51391_1053289
624 Ga0065714_10153235
625 Ga0065714_10154033
626 Ga0068869_100342339
627 Ga0068869_100819915
628 Ga0070666_11307829
629 Ga0070682_100558647
630 Ga0068868_101330807
631 Ga0070660_101223404
632 Ga0070687_101007118
633 Ga0070668_100008932
634 Ga0070668_100426679
635 Ga0070668_101116878
636 Ga0070668_101607656
637 Ga0070669_101262034
638 Ga0070675_100164471
639 Ga0070675_100260699
640 Ga0070675_101848124
641 Ga0070671_100299895
642 Ga0070671_101087557
643 Ga0070674_100107329
644 Ga0070659_101424748
645 Ga0070659_102058719
646 Ga0070667_100042072
647 Ga0070667_100319287
648 Ga0070667_101142949
649 Ga0070703_10384817
650 Ga0070714_100000552
651 Ga0070714_100213318
652 Ga0070714_101350410
653 Ga0070713_100140592
654 Ga0070713_100566592
655 Ga0070710_10130982
656 Ga0070710_10180578
657 Ga0070711_100744142
658 Ga0070700_100166077
659 Ga0070700_100227278
660 Ga0070708_100200607
661 Ga0070678_100156103
662 Ga0070678_100470056
663 Ga0070662_101127984
664 Ga0070707_100106415
665 Ga0070707_100887757
666 Ga0070699_100006138
667 Ga0070684_100046301
668 Ga0070672_100525840
669 Ga0070686_101086634
670 Ga0070696_100258224
671 Ga0070693_101503226
672 Ga0070665_100179537
673 Ga0070665_100201062
674 Ga0070665_101121717
675 Ga0070704_100712114
676 Ga0070704_100873351
677 Ga0070664_101570520
678 Ga0070664_101830857
679 Ga0068857_100444847
680 Ga0068857_102129682
681 Ga0068856_100398303
682 Ga0070702_100656212
683 Ga0070702_100801690
684 Ga0068859_100033620
685 Ga0068864_100066702
686 Ga0068864_100171937
687 Ga0068864_100312905
688 Ga0068861_102253479
689 Ga0068863_100050620
690 Ga0068863_100155043
691 Ga0068863_101211193
692 Ga0068858_100448146
693 Ga0068860_100015827
694 Ga0068862_100064886
695 Ga0068862_102491293
696 Ga0081538_10000209
697 Ga0081540_1058750
698 Ga0081539_10007693
699 Ga0081539_10282426
700 Ga0070717_10190762
701 Ga0070717_10282431
702 Ga0075365_10005065
703 Ga0075365_10064814
704 Ga0075368_10098807
705 Ga0075363_100185747
706 Ga0075364_10006482
707 Ga0075364_10378144
708 Ga0075364_10442207
709 Ga0075364_10788802
710 Ga0070715_10014088
711 Ga0070716_100155325
712 Ga0070712_100765144
713 Ga0075362_10240737
714 Ga0075369_10038603
715 Ga0075369_10242887
716 Ga0097621_100816539
717 Ga0097621_101732740
718 Ga0075370_10045511
719 Ga0075428_100331166
720 Ga0075428_100696097
721 Ga0075428_100989579
722 Ga0075428_101630909
723 Ga0075430_100338812
724 Ga0075430_100472457
725 Ga0075430_100560921
726 Ga0075430_101509598
727 Ga0075431_100313189
728 Ga0075431_100601449
729 Ga0075433_10195357
730 Ga0075434_101397635
731 Ga0075434_101934896
732 Ga0075434_102353277
733 Ga0075429_100011643
734 Ga0075436_100793989
735 Ga0097620_100033620
736 Ga0075435_101054654
737 Ga0105244_10144673
738 Ga0105244_10336418
739 Ga0105244_10455893
740 Ga0105240_11738847
741 Ga0111539_10142464
742 Ga0111539_12649782
743 Ga0105247_10140950
744 Ga0105247_10385125
745 Ga0114129_10000525
746 Ga0114129_10056516
747 Ga0114129_10370570
748 Ga0114129_10649549
749 Ga0114129_10878984
750 Ga0105243_10211942
751 Ga0105243_10431346
752 Ga0105243_10671964
753 Ga0105243_10726766
754 Ga0105243_11238069
755 Ga0105241_11083495
756 Ga0105242_12423746
757 Ga0105248_10064931
758 Ga0105237_12664720
759 Ga0105249_12072174
760 Ga0105246_10376406
761 Ga0105246_10411688
762 Ga0157313_1037821
763 Ga0157373_10264010
764 Ga0157370_10164528
765 Ga0157370_11016055
766 Ga0157374_11076845
767 Ga0157374_12279291
768 Ga0157378_11810310
769 Ga0163162_10260698
770 Ga0163162_10308564
771 Ga0163162_10663112
772 Ga0163162_10877828
773 Ga0157372_12911638
774 Ga0157375_10046874
775 Ga0157375_12212123
776 Ga0157375_12414079
777 Ga0157375_12958384
778 Ga0163163_10009330
779 Ga0157380_10398661
780 Ga0157380_10909185
781 Ga0157380_11657438
782 Ga0157380_12500653
783 Ga0157380_12559530
784 Ga0157380_13339573
785 Ga0157377_10936195
786 Ga0157379_10140978
787 Ga0157379_10223717
788 Ga0157379_10813700
789 Ga0157376_10331287
790 Ga0163161_10698668
791 Ga0209646_1000014
792 Ga0207655_1114232
793 Ga0207655_1245370
794 Ga0207682_10484963
795 Ga0207692_10105927
796 Ga0207692_10285681
797 Ga0207688_10790881
798 Ga0207688_10884523
799 Ga0207645_10647525
800 Ga0207643_10120712
801 Ga0207643_10724054
802 Ga0207693_10019010
803 Ga0207693_11069006
804 Ga0207663_11224366
805 Ga0207663_11671174
806 Ga0207646_10027054
807 Ga0207681_10457081
808 Ga0207650_11440003
809 Ga0207659_10327818
810 Ga0207700_10062615
811 Ga0207700_10152755
812 Ga0207664_10018340
813 Ga0207664_10021530
814 Ga0207664_10768033
815 Ga0207664_11294739
816 Ga0207644_10292285
817 Ga0207706_10053598
818 Ga0207706_10940879
819 Ga0207686_10521855
820 Ga0207709_10506553
821 Ga0207709_11768173
822 Ga0207670_10726276
823 Ga0207665_10564274
824 Ga0207691_10382944
825 Ga0207711_10825556
826 Ga0207689_10176233
827 Ga0207661_10925618
828 Ga0207667_11031291
829 Ga0207651_10850530
830 Ga0207712_10818681
831 Ga0207668_11531379
832 Ga0207658_10562085
833 Ga0207677_10812166
834 Ga0207677_11668540
835 Ga0207703_10125315
836 Ga0207678_10543960
837 Ga0207708_10099235
838 Ga0207708_10123089
839 Ga0207641_10069137
840 Ga0207641_10428588
841 Ga0207648_10308912
842 Ga0207676_10028447
843 Ga0207676_10193197
844 Ga0207674_10044880
845 Ga0207674_10406443
846 Ga0207674_11494801
847 Ga0207674_11742447
848 Ga0207675_101894295
849 Ga0207683_10159024
850 Ga0207683_11955889
851 Ga0209983_1121713
852 Ga0209813_10093882
853 Ga0268266_10353723
854 Ga0307515_10097187
855 Ga0307515_10496103
856 Ga0307513_10010361
857 Ga0307513_10276106
858 Ga0307513_10449787
859 Ga0307408_100002277
860 Ga0307408_100004071
861 Ga0307408_100283877
862 Ga0307408_100341976
863 Ga0307408_100549077
864 Ga0307508_10195368
865 Ga0307514_10209345
866 Ga0316575_10000013
867 Ga0316579_10653131
868 Ga0307516_10012688
869 Ga0307516_10338399
870 Ga0307405_10013635
871 Ga0307405_10116864
872 Ga0307405_10187020
873 Ga0307405_10951416
874 Ga0307405_11047140
875 Ga0307405_11296050
876 Ga0307413_10027423
877 Ga0307413_10070165
878 Ga0307413_10175362
879 Ga0307413_10586006
880 Ga0307413_11827153
881 Ga0307410_10004387
882 Ga0307410_10055843
883 Ga0307410_11715341
884 Ga0307406_10000057
885 Ga0307406_10010349
886 Ga0307406_10194288
887 Ga0307406_10285083
888 Ga0307406_10504761
889 Ga0307406_11314230
890 Ga0307406_11780949
891 Ga0307407_10041601
892 Ga0307407_10209925
893 Ga0307407_10553721
894 Ga0307407_10770408
895 Ga0307407_11227373
896 Ga0307407_11535853
897 Ga0307412_10007088
898 Ga0307412_10087921
899 Ga0307412_10139136
900 Ga0307412_10807276
901 Ga0307412_11090843
902 Ga0307412_11497191
903 Ga0307409_100011513
904 Ga0307409_100030211
905 Ga0307409_100114495
906 Ga0307416_100032797
907 Ga0307416_100409281
908 Ga0307416_100672569
909 Ga0307416_100828905
910 Ga0307416_100892838
911 Ga0307416_103433210
912 Ga0307416_103530194
913 Ga0307414_10089559
914 Ga0307414_10258889
915 Ga0307414_10500258
916 Ga0307414_10655179
917 Ga0307414_10741194
918 Ga0307414_11019063
919 Ga0307414_11043111
920 Ga0307414_11195118
921 Ga0307411_10065077
922 Ga0307411_10679290
923 Ga0307411_10999904
924 Ga0307411_11145776
925 Ga0307415_100102257
926 Ga0307415_101238710
927 Ga0307415_101471462
928 Ga0307507_10015090
929 Ga0307507_10158221
930 Ga0373950_0036090
931 Ga0373926_0094913
932 Ga0373934_0016675
933 Ga0373949_0087746
934 Ga0373923_0019868
935 Ga0373936_0193679
936 Ga0373953_0481835
937 Ga0373954_0060976
938 Ga0373957_0013917
939 Ga0373943_1007375
940 Ga0373946_0063756
941 Ga0373955_0051905
942 Ga0373961_0176309
943 Ga0373924_0065994
944 Ga0373935_0192536
945 Ga0373933_0113958
946 Ga0373937_0009916
947 Ga0373925_0298181
948 Ga0373925_0776668
949 Ga0395900_1003191
950 Ga0395898_0177462
951 Ga0436364_0238576
952 Ga0395901_0056987
953 Ga0436363_1376076
954 Ga0439466_0163349
955 Ga0439465_0200923
956 Ga0439465_0309698
957 Ga0451787_088622
958 Ga0451787_222038
959 Ga0451787_828715
960 Ga0451791_0887963
961 Ga0451791_1801626
962 Ga0451793_0385174
963 Ga0451797_1389128
964 Ga0451798_0539254
965 Ga0451800_1683393
966 Ga0451802_0002292
967 Ga0451802_0259616
968 Ga0451802_0505636
969 Ga0451807_0844761
970 Ga0451807_2679380
971 Ga0451807_2685360
972 Ga0451837_1387813
973 Ga0451839_0820932
974 Ga0451851_0551522
975 Ga0451843_0182767
976 Ga0451853_1677312
977 Ga0451853_1857742
978 Ga0439442_000746
979 Ga0439442_058369
980 Ga0439432_041132
981 Ga0439451_029352
982 Ga0439451_129967
983 Ga0439452_056324
984 Ga0439457_078313
985 Ga0450920_000821
986 Ga0450920_009829
987 Ga0450907_004322
988 Ga0450910_014503
989 Ga0439446_0181596
990 Ga0450908_011277
991 Ga0439434_0001297
992 Ga0439434_0152072
993 Ga0450918_011400
994 Ga0451577_0005201
995 Ga0451577_0058864
996 Ga0466972_0146845
997 Ga0466965_0163815
998 Ga0453684_0023308
999 Ga0453684_0471259
1000 Ga0453684_0929758
1001 Ga0466970_0591466
1002 Ga0466960_0135340
1003 Ga0466960_0143205
1004 Ga0451576_0219846
1005 Ga0451576_0538054
1006 Ga0451576_1670605
1007 Ga0495592_0245237
1008 Ga0495629_0278894
1009 Ga0495641_0032849
1010 Ga0495651_0060458
1011 Ga0495653_0028718
1012 Ga0495653_0355989
1013 Ga0495650_0001684
1014 Ga0495580_0012435
1015 Ga0495580_0228524
1016 Ga0495582_0146352
1017 Ga0495582_0162282
1018 Ga0495582_0239435
1019 Ga0495639_0014707
1020 Ga0495639_0125032
1021 Ga0495662_0346515
1022 Ga0495664_0335304
1023 Ga0495594_0036480
1024 Ga0495608_0008233
1025 Ga0495618_0101847
1026 Ga0495620_0012855
1027 Ga0495628_0126081
1028 Ga0495631_0072148
1029 Ga0495637_0243984
1030 Ga0495652_0798778
1031 Ga0495652_1009888
1032 Ga0495654_0087718
1033 Ga0495654_0124196
1034 Ga0495654_0187264
1035 Ga0495665_0086890
1036 Ga0495665_0299671
1037 Ga0495640_0195992
1038 Ga0495640_0547677
1039 Ga0495586_0032386
1040 Ga0495586_0134356
1041 Ga0495587_0407302
1042 Ga0495622_0472890
1043 Ga0495633_0270110
1044 Ga0495667_0010813
1045 Ga0495667_1012427
1046 Ga0495656_0003807
1047 Ga0495656_0354038
1048 Ga0495656_0420817
1049 Ga0495656_0578433
1050 Ga0495656_0656308
1051 Ga0495668_0673187
1052 Ga0495634_0015237
1053 Ga0495659_0076455
1054 Ga0495659_0205336
1055 Ga0495588_0010192
1056 Ga0495588_0054597
1057 Ga0495588_0295169
1058 Ga0495588_0532681
1059 Ga0495657_0136259
1060 Ga0495599_0088807
1061 Ga0495623_0295370
1062 Ga0495623_0659117
1063 Ga0495646_0018007
1064 Ga0495647_0227053
1065 Ga0495658_0118194
1066 Ga0495658_0532542
1067 Ga0495670_0007294
1068 Ga0495670_0588478
1069 Ga0495671_0185005
1070 Ga0495649_0421772
1071 Ga0495600_0036311
1072 Ga0495581_0082032
1073 Ga0495581_0105094
1074 Ga0495581_0110181
1075 Ga0495674_0153596
1076 Ga0495674_0272454
1077 Ga0495674_0375791
1078 Ga0495672_0032541
1079 Ga0495680_0028046
1080 Ga0495680_0935006
1081 Ga0495683_0427186
1082 Ga0495675_0112700
1083 Ga0495677_0332147
1084 Ga0495681_0329633
1085 Ga0495681_0341296
1086 Ga0495686_0180827
1087 Ga0495686_0362026
1088 Ga0495686_0474339
1089 Ga0495593_0229699
1090 Ga0495602_0056874
1091 Ga0495614_0134758
1092 Ga0495626_0379084
1093 Ga0496100_0330271
1094 Ga0496101_0016210
1095 Ga0496101_0895856
1096 Ga0496102_0089622
1097 Ga0496102_0193163
1098 Ga0496102_0413469
1099 Ga0496102_1806053
1100 Ga0496103_0111827
1101 Ga0496103_0246010
1102 Ga0496103_0333480
1103 Ga0496104_0365361
1104 Ga0496104_1452259
1105 Ga0496105_0216130
1106 Ga0496105_0254154
1107 Ga0496106_0007674
1108 Ga0496106_0405943
1109 Ga0496107_0033789
1110 Ga0496107_0199020
1111 Ga0496108_0013116
1112 Ga0496108_0526856
1113 Ga0496108_0771928
1114 Ga0496108_1340852
1115 Ga0496109_0005336
1116 Ga0496109_0370739
1117 Ga0496109_0593561
1118 Ga0496110_0008492
1119 Ga0496110_0062788
1120 Ga0496110_0292173
1121 Ga0496111_0050629
1122 Ga0496111_0079863
1123 Ga0496111_0181940
1124 Ga0496111_0904246
1125 Ga0496112_0728745
1126 Ga0496112_0753058
1127 Ga0496112_1890639
1128 Ga0496113_0004740
1129 Ga0496113_0644562
1130 Ga0496114_0035589
1131 Ga0496114_0374914
1132 Ga0496115_0012959
1133 Ga0496115_0183308
1134 Ga0496117_0002221
1135 Ga0496118_0009941
1136 Ga0496119_0025427
1137 Ga0496120_0031620
1138 Ga0496122_0000511
1139 Ga0496122_0019106
1140 Ga0496123_0000011
1141 Ga0496123_0149174
1142 Ga0496124_0195881
1143 Ga0496124_0284227
1144 Ga0496125_0009452
1145 Ga0496125_0061711
1146 Ga0496126_0005089
1147 Ga0496126_0022853
1148 Ga0496126_0185015
1149 Ga0496126_0275639
1150 Ga0501290_056529
1151 Ga0501031_0449796
1152 Ga0501034_0000622
1153 Ga0501034_0034200
1154 Ga0501034_0489350
1155 Ga0501034_1351809
1156 Ga0501034_1530080
1157 Ga0501036_1696434
1158 Ga0501039_0426211
1159 Ga0501039_1177094
1160 Ga0501046_0814804
1161 Ga0501048_0527519
1162 Ga0501067_0030688
1163 Ga0501071_0746366
1164 Ga0501073_0000734
1165 Ga0501074_0304447
1166 Ga0501074_0417369
1167 Ga0501076_0136394
1168 Ga0501076_0492217
1169 Ga0501076_0915286
1170 Ga0501079_0372985
1171 Ga0501081_0321539
1172 Ga0501283_025522
1173 nmdc:mga03683_116823_c1
1174 nmdc:mga03n38_13420_c1
1175 nmdc:mga00v17_149303_c1
1176 nmdc:mga00v17_409731_c1
1177 nmdc:mga00v17_60179_c1
1178 nmdc:mga00v17_874411_c1
1179 nmdc:mga0yw44_10771_c1
1180 nmdc:mga0yw44_166913_c1
1181 nmdc:mga0yw44_20493_c1
1182 nmdc:mga0yw44_761306_c1
1183 nmdc:mga06z11_6684_c1
1184 nmdc:mga04h51_61907_c1
1185 nmdc:mga05p37_36974_c1
1186 nmdc:mga05p37_546691_c1
1187 nmdc:mga05p37_660037_c1
1188 nmdc:mga05p37_827850_c1
1189 nmdc:mga05p37_90166_c1
1190 nmdc:mga09592_1062185_c1
1191 nmdc:mga09592_225490_c1
1192 nmdc:mga09592_952194_c1
1193 nmdc:mga0qj67_1178873_c1
1194 nmdc:mga0qj67_269536_c1
1195 nmdc:mga0qj67_643403_c1
1196 nmdc:mga06r32_403669_c1
1197 nmdc:mga06r32_649612_c1
1198 nmdc:mga06r32_759335_c1
1199 nmdc:mga08y16_1467927_c1
1200 nmdc:mga08y16_276026_c1
1201 nmdc:mga08y16_404134_c1
1202 nmdc:mga0n895_1517841_c1
1203 nmdc:mga0rr50_918932_c1
1204 nmdc:mga08x19_153360_c1
1205 nmdc:mga0a205_1238870_c1
1206 nmdc:mga0a205_556236_c1
1207 nmdc:mga0sz30_13164_c1
1208 nmdc:mga0sz30_295331_c1
1209 nmdc:mga0sz30_351689_c1
1210 nmdc:mga0sz30_86672_c1
1211 Ga0495601_0273632
1212 Ga0495601_0475912
1213 Ga0495612_0209736
1214 Ga0495619_0216913
1215 Ga0495619_1009586
1216 Ga0500578_0669466
1217 Ga0500555_047504
1218 Ga0500562_000889
1219 Ga0500593_091047
1220 Ga0500568_0004302
1221 Ga0500568_0022446
1222 Ga0500573_0340672
1223 Ga0500579_043829
1224 Ga0500600_0012686
1225 Ga0500616_0001208
1226 Ga0500616_0172087
1227 Ga0501084_1556014
1228 Ga0501082_0407186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

28

82

0.97

PF13560

HTH_31

Helix-turn-helix domain

26

83

0.94

PF12844

HTH_19

Helix-turn-helix domain

26

88

0.93

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

27

87

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jxc-assembly1.cif.gz_L crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+ 0.9421 11 65
2xj3-assembly1.cif.gz_A high resolution structure of the t55c mutant of cylr2. 0.9414 7 70
2xi8-assembly1.cif.gz_A high resolution structure of native cylr2 0.9387 7 70
2xj3-assembly1.cif.gz_B high resolution structure of the t55c mutant of cylr2. 0.9327 9 70
2lyk-assembly1.cif.gz_B noe-based 3d structure of the cylr2 homodimer at 270k (-3 celsius degrees) 0.9283 7 70
ID Description Score Start End Superfamily
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9582 8 71 1.10.260.40
2lykB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9283 7 70 1.10.260.40
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9244 11 65 1.10.260.40
2r1jL00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9236 11 65 1.10.260.40
3u3wB01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9225 10 65 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A6S6FY68-F1-model_v4 XRE family transcriptional regulator 1.004 7 69 GO:0003677
AF-A0A6C1PC08-F1-model_v4 Transcriptional regulator 1.002 8 70 GO:0003677
AF-A0A841AIM4-F1-model_v4 Putative transcriptional regulator 0.9977 8 70 GO:0003677
AF-A0A6A8Q651-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9972 6 69 GO:0003677
AF-A0A2H0RRH5-F1-model_v4 Transcriptional regulator 0.9939 7 68 GO:0003677

Map