F469309

General Info

Members Datasets Scaffolds Average Seq Length
613 280 611 218

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0424471|Ga0501076_0424471_300_953
Length 217
Sequence MALIESRPPVAPGERAPEFTLPAIDRPESVSLADYRGRSALFLALFIGLWCPFCRRAIAQMSKIESSLKAAGVETLGVVATTPENARLYFKFRPTRLRLASDPELSTHRAYGLPKPELTPEFMQAMDTVRVNPFGEFAAPLTITEAARTMAAQDGYVENETDKAELDRQFPQLKGQFLIDRDGIVRWANIECAEGVAAVGKFPSEQEILAAARALPR

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2738543013 Variovorax sp. BT01 Isolate Unclassified
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
113 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
169 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
170 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
186 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
187 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
188 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
189 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
190 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
191 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
192 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
193 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
211 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
214 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
215 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
216 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
236 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.49
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 1.47
Rhizoplane 1.31
Rhizosphere 94.78
Stem 0
Stem Tuber 0
Unclassified 1.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1017318 3300002987 Bacteria 1494
2 Ga0055534_1001421 3300003784 Bacteria 9525
3 Ga0065715_10155528 3300005293 Bacteria 1681
4 Ga0065707_10160728 3300005295 Bacteria 1566
5 Ga0070676_10002814 3300005328 Bacteria 8993
6 Ga0070676_10019968 3300005328 Bacteria 3733
7 Ga0070683_100131652 3300005329 Bacteria 2367
8 Ga0070683_100158723 3300005329 Bacteria 2145
9 Ga0070690_100034427 3300005330 Bacteria 3174
10 Ga0068869_100000228 3300005334 Bacteria 29468
11 Ga0068869_100037255 3300005334 Bacteria 3458
12 Ga0070680_100001225 3300005336 Bacteria 18474
13 Ga0070680_100394844 3300005336 Bacteria 1179
14 Ga0070680_100694006 3300005336 Bacteria 876
15 Ga0070682_100001200 3300005337 Bacteria 14755
16 Ga0068868_100147977 3300005338 Bacteria 1932
17 Ga0068868_100702049 3300005338 Unclassified 905
18 Ga0070660_100000281 3300005339 Bacteria 33896
19 Ga0070689_100016424 3300005340 Bacteria 5417
20 Ga0070691_10029628 3300005341 Bacteria 2562
21 Ga0070687_100032253 3300005343 Bacteria 2576
22 Ga0070661_100015722 3300005344 Bacteria 5341
23 Ga0070661_100126336 3300005344 Bacteria 1919
24 Ga0070692_10002011 3300005345 Bacteria 7717
25 Ga0070669_100550291 3300005353 Bacteria 962
26 Ga0070671_100254429 3300005355 Bacteria 1492
27 Ga0070671_100358633 3300005355 Bacteria 1245
28 Ga0070674_100098794 3300005356 Unclassified 2122
29 Ga0070673_100119857 3300005364 Bacteria 2193
30 Ga0070659_100041894 3300005366 Bacteria 3580
31 Ga0070667_100181142 3300005367 Bacteria 1863
32 Ga0070667_100490120 3300005367 Bacteria 1126
33 Ga0070703_10000633 3300005406 Bacteria 12378
34 Ga0070703_10004012 3300005406 Bacteria 4161
35 Ga0070703_10016100 3300005406 Bacteria 2143
36 Ga0070709_10066103 3300005434 Bacteria 2318
37 Ga0070713_100450987 3300005436 Unclassified 1208
38 Ga0070701_10201675 3300005438 Bacteria 1176
39 Ga0070705_100000209 3300005440 Bacteria 34614
40 Ga0070705_100003105 3300005440 Bacteria 8169
41 Ga0070705_100071605 3300005440 Unclassified 2097
42 Ga0070705_100210021 3300005440 Bacteria 1341
43 Ga0070694_100001135 3300005444 Bacteria 15257
44 Ga0070694_100016158 3300005444 Bacteria 4697
45 Ga0070694_100273488 3300005444 Bacteria 1285
46 Ga0070708_100033393 3300005445 Bacteria 4470
47 Ga0070708_100193769 3300005445 Bacteria 1901
48 Ga0070708_100621420 3300005445 Bacteria 1018
49 Ga0070663_100069022 3300005455 Bacteria 2567
50 Ga0070663_100577038 3300005455 Bacteria 943
51 Ga0070678_100921559 3300005456 Bacteria 800
52 Ga0070662_100023687 3300005457 Bacteria 4220
53 Ga0070662_100058269 3300005457 Bacteria 2810
54 Ga0070662_100202847 3300005457 Bacteria 1574
55 Ga0070662_100883675 3300005457 Unclassified 762
56 Ga0070681_10054874 3300005458 Bacteria 3970
57 Ga0070681_10349207 3300005458 Bacteria 1389
58 Ga0068867_100001387 3300005459 Bacteria 16747
59 Ga0068867_100002339 3300005459 Bacteria 13345
60 Ga0068867_100086876 3300005459 Bacteria 2367
61 Ga0068867_100304422 3300005459 Bacteria 1315
62 Ga0068867_100592378 3300005459 Unclassified 966
63 Ga0068867_100823125 3300005459 Bacteria 830
64 Ga0070706_100060610 3300005467 Bacteria 3493
65 Ga0070706_100261907 3300005467 Bacteria 1614
66 Ga0070706_100454084 3300005467 Unclassified 1192
67 Ga0070707_100117335 3300005468 Bacteria 2583
68 Ga0070707_100420162 3300005468 Bacteria 1297
69 Ga0070698_100007922 3300005471 Bacteria 11497
70 Ga0070698_100028305 3300005471 Bacteria 5822
71 Ga0070698_100071818 3300005471 Bacteria 3470
72 Ga0070698_100295623 3300005471 Bacteria 1550
73 Ga0070698_100603497 3300005471 Bacteria 1038
74 Ga0070698_100787044 3300005471 Bacteria 895
75 Ga0070699_100119424 3300005518 Bacteria 2317
76 Ga0070699_100123238 3300005518 Bacteria 2280
77 Ga0070699_100503395 3300005518 Bacteria 1100
78 Ga0070679_100000384 3300005530 Bacteria 37636
79 Ga0070684_100012681 3300005535 Bacteria 6762
80 Ga0070697_100029267 3300005536 Bacteria 4414
81 Ga0070697_100043485 3300005536 Bacteria 3638
82 Ga0070697_100296124 3300005536 Bacteria 1390
83 Ga0068853_100005645 3300005539 Bacteria 9832
84 Ga0068853_100339222 3300005539 Bacteria 1396
85 Ga0070672_100007475 3300005543 Bacteria 7417
86 Ga0070672_100078247 3300005543 Bacteria 2646
87 Ga0070695_100006033 3300005545 Bacteria 7155
88 Ga0070695_100011071 3300005545 Bacteria 5391
89 Ga0070695_100409901 3300005545 Bacteria 1029
90 Ga0070696_100000432 3300005546 Bacteria 26336
91 Ga0070696_100005303 3300005546 Bacteria 8594
92 Ga0070693_100000049 3300005547 Bacteria 45536
93 Ga0070665_100005547 3300005548 Bacteria 12974
94 Ga0070665_100390171 3300005548 Bacteria 1400
95 Ga0070704_100000798 3300005549 Bacteria 15591
96 Ga0070704_100084926 3300005549 Unclassified 2341
97 Ga0070704_100270097 3300005549 Unclassified 1405
98 Ga0070704_100565307 3300005549 Unclassified 995
99 Ga0070704_100848971 3300005549 Unclassified 818
100 Ga0068855_100006053 3300005563 Bacteria 14753
101 Ga0068855_100174475 3300005563 Bacteria 2433
102 Ga0070664_100028901 3300005564 Bacteria 4617
103 Ga0068857_100008279 3300005577 Bacteria 8985
104 Ga0068857_100014260 3300005577 Bacteria 6924
105 Ga0068857_100155337 3300005577 Unclassified 2074
106 Ga0068857_101063994 3300005577 Bacteria 780
107 Ga0068854_100053986 3300005578 Bacteria 2888
108 Ga0068856_100002309 3300005614 Bacteria 19640
109 Ga0068856_100005140 3300005614 Bacteria 12921
110 Ga0070702_100505498 3300005615 Bacteria 888
111 Ga0068852_100069153 3300005616 Bacteria 3093
112 Ga0068852_100532752 3300005616 Bacteria 1173
113 Ga0068859_100028623 3300005617 Bacteria 5587
114 Ga0068859_100765546 3300005617 Bacteria 1054
115 Ga0068864_100010526 3300005618 Bacteria 7643
116 Ga0068864_100072247 3300005618 Bacteria 3006
117 Ga0068861_100045224 3300005719 Bacteria 3314
118 Ga0068861_100085740 3300005719 Bacteria 2474
119 Ga0068870_10000058 3300005840 Bacteria 35575
120 Ga0068870_10081427 3300005840 Bacteria 1791
121 Ga0068870_10203432 3300005840 Bacteria 1202
122 Ga0068863_100012852 3300005841 Bacteria 8074
123 Ga0068863_100692235 3300005841 Bacteria 1013
124 Ga0068858_100029779 3300005842 Bacteria 5071
125 Ga0068858_100233404 3300005842 Bacteria 1744
126 Ga0068860_100007602 3300005843 Bacteria 10846
127 Ga0068862_100002587 3300005844 Bacteria 15978
128 Ga0068862_100025663 3300005844 Bacteria 4948
129 Ga0068862_100064953 3300005844 Bacteria 3142
130 Ga0068862_101217674 3300005844 Unclassified 752
131 Ga0081455_10000658 3300005937 Bacteria 44747
132 Ga0081455_10506455 3300005937 Unclassified 809
133 Ga0081540_1037400 3300005983 Bacteria 2574
134 Ga0070716_100012162 3300006173 Bacteria 4355
135 Ga0070712_100437454 3300006175 Bacteria 1087
136 Ga0075362_10053809 3300006177 Bacteria 1808
137 Ga0068871_100457295 3300006358 Bacteria 1145
138 Ga0075428_100002400 3300006844 Bacteria 20345
139 Ga0075428_100009400 3300006844 Bacteria 10845
140 Ga0075428_100029033 3300006844 Bacteria 6120
141 Ga0075428_100042157 3300006844 Bacteria 5020
142 Ga0075428_100046664 3300006844 Bacteria 4758
143 Ga0075428_100068421 3300006844 Bacteria 3884
144 Ga0075428_100119345 3300006844 Bacteria 2872
145 Ga0075428_100427415 3300006844 Bacteria 1419
146 Ga0075428_100567287 3300006844 Unclassified 1213
147 Ga0075428_100966407 3300006844 Unclassified 902
148 Ga0075430_100000047 3300006846 Bacteria 63972
149 Ga0075430_100005950 3300006846 Bacteria 10302
150 Ga0075430_100007006 3300006846 Bacteria 9502
151 Ga0075430_100029165 3300006846 Bacteria 4683
152 Ga0075430_100196082 3300006846 Bacteria 1678
153 Ga0075430_100342881 3300006846 Unclassified 1234
154 Ga0075430_100412242 3300006846 Bacteria 1115
155 Ga0075431_100000424 3300006847 Bacteria 34431
156 Ga0075431_100015317 3300006847 Bacteria 7770
157 Ga0075431_100015506 3300006847 Bacteria 7722
158 Ga0075431_100070429 3300006847 Bacteria 3609
159 Ga0075431_100080770 3300006847 Bacteria 3357
160 Ga0075431_100081470 3300006847 Plasmid 3342
161 Ga0075431_100098604 3300006847 Bacteria 3017
162 Ga0075431_100172556 3300006847 Bacteria 2222
163 Ga0075431_100218449 3300006847 Bacteria 1945
164 Ga0075431_100331688 3300006847 Unclassified 1532
165 Ga0075433_10000715 3300006852 Bacteria 22715
166 Ga0075433_10014955 3300006852 Bacteria 6353
167 Ga0075433_10035954 3300006852 Bacteria 4263
168 Ga0075433_10052169 3300006852 Bacteria 3563
169 Ga0075433_10089399 3300006852 Unclassified 2722
170 Ga0075433_10098100 3300006852 Bacteria 2594
171 Ga0075433_10118487 3300006852 Bacteria 2350
172 Ga0075433_10472458 3300006852 Unclassified 1105
173 Ga0075434_100000430 3300006871 Bacteria 31085
174 Ga0075434_100002095 3300006871 Bacteria 17343
175 Ga0075434_100012865 3300006871 Bacteria 7946
176 Ga0075434_100081864 3300006871 Bacteria 3225
177 Ga0075434_100091306 3300006871 Bacteria 3047
178 Ga0075434_100179939 3300006871 Bacteria 2134
179 Ga0075434_100184653 3300006871 Unclassified 2106
180 Ga0075434_100194316 3300006871 Bacteria 2049
181 Ga0075434_100277686 3300006871 Bacteria 1695
182 Ga0075434_100642478 3300006871 Bacteria 1079
183 Ga0075429_100001286 3300006880 Bacteria 20437
184 Ga0075429_100002725 3300006880 Bacteria 14908
185 Ga0075429_100025276 3300006880 Bacteria 5155
186 Ga0075429_100039035 3300006880 Bacteria 4133
187 Ga0075429_100044089 3300006880 Bacteria 3879
188 Ga0075429_100281365 3300006880 Bacteria 1457
189 Ga0075429_100301015 3300006880 Bacteria 1404
190 Ga0075429_100630637 3300006880 Unclassified 939
191 Ga0068865_100094183 3300006881 Bacteria 2179
192 Ga0075436_100051694 3300006914 Bacteria 2835
193 Ga0075436_100090946 3300006914 Bacteria 2121
194 Ga0075436_100103286 3300006914 Bacteria 1986
195 Ga0075436_100150074 3300006914 Unclassified 1640
196 Ga0097620_100028624 3300006931 Bacteria 5587
197 Ga0097620_100765607 3300006931 Bacteria 1054
198 Ga0079104_1010200 3300006946 Bacteria 3112
199 Ga0075435_100003005 3300007076 Bacteria 11352
200 Ga0075435_100014083 3300007076 Bacteria 5965
201 Ga0075435_100016145 3300007076 Bacteria 5625
202 Ga0075435_100021878 3300007076 Bacteria 4928
203 Ga0075435_100023001 3300007076 Bacteria 4813
204 Ga0075435_100087344 3300007076 Bacteria 2569
205 Ga0075435_100135696 3300007076 Unclassified 2061
206 Ga0075435_100176241 3300007076 Bacteria 1805
207 Ga0075435_100297143 3300007076 Bacteria 1381
208 Ga0075435_100471357 3300007076 Bacteria 1084
209 Ga0099794_10005130 3300007265 Bacteria 5225
210 Ga0105240_10098611 3300009093 Bacteria 3558
211 Ga0105240_10519201 3300009093 Bacteria 1322
212 Ga0111539_10003941 3300009094 Bacteria 19514
213 Ga0111539_10005060 3300009094 Bacteria 17122
214 Ga0111539_10040200 3300009094 Bacteria 5631
215 Ga0111539_10086857 3300009094 Bacteria 3675
216 Ga0111539_10932484 3300009094 Unclassified 1010
217 Ga0111539_10944703 3300009094 Bacteria 1002
218 Ga0105245_10104108 3300009098 Bacteria 2631
219 Ga0105245_10965750 3300009098 Bacteria 895
220 Ga0114129_10007581 3300009147 Bacteria 15450
221 Ga0114129_10015402 3300009147 Bacteria 10878
222 Ga0114129_10015887 3300009147 Bacteria 10706
223 Ga0114129_10021214 3300009147 Bacteria 9225
224 Ga0114129_10025203 3300009147 Bacteria 8428
225 Ga0114129_10028553 3300009147 Bacteria 7905
226 Ga0114129_10053062 3300009147 Bacteria 5687
227 Ga0114129_10058865 3300009147 Bacteria 5374
228 Ga0114129_10070216 3300009147 Bacteria 4883
229 Ga0114129_10081413 3300009147 Bacteria 4500
230 Ga0114129_10091450 3300009147 Bacteria 4216
231 Ga0114129_10103105 3300009147 Bacteria 3945
232 Ga0114129_10106382 3300009147 Bacteria 3875
233 Ga0114129_10163192 3300009147 Bacteria 3042
234 Ga0114129_10200877 3300009147 Bacteria 2700
235 Ga0114129_10427062 3300009147 Bacteria 1742
236 Ga0114129_10437772 3300009147 Bacteria 1717
237 Ga0114129_10866501 3300009147 Archaea 1147
238 Ga0114129_10909733 3300009147 Bacteria 1114
239 Ga0114129_11135377 3300009147 Unclassified 977
240 Ga0114129_11404099 3300009147 Bacteria 861
241 Ga0105243_10048073 3300009148 Bacteria 3361
242 Ga0105243_10198043 3300009148 Bacteria 1760
243 Ga0105241_10000194 3300009174 Bacteria 45709
244 Ga0105241_10435942 3300009174 Bacteria 1156
245 Ga0105242_10889866 3300009176 Bacteria 889
246 Ga0105248_10079613 3300009177 Bacteria 3683
247 Ga0105248_10371574 3300009177 Bacteria 1610
248 Ga0105248_10696953 3300009177 Unclassified 1146
249 Ga0105237_10514719 3300009545 Bacteria 1203
250 Ga0105238_10375187 3300009551 Bacteria 1413
251 Ga0105249_10274682 3300009553 Unclassified 1680
252 Ga0105239_10158506 3300010375 Bacteria 2528
253 Ga0105246_10018572 3300011119 Bacteria 4433
254 Ga0105246_10142674 3300011119 Bacteria 1803
255 Ga0105246_10345743 3300011119 Bacteria 1217
256 Ga0157373_10000236 3300013100 Bacteria 45123
257 Ga0157371_10177895 3300013102 Bacteria 1521
258 Ga0157369_10032514 3300013105 Bacteria 5736
259 Ga0157369_10111236 3300013105 Bacteria 2911
260 Ga0157378_10596225 3300013297 Bacteria 1115
261 Ga0163162_10590127 3300013306 Bacteria 1238
262 Ga0157372_10004639 3300013307 Bacteria 14601
263 Ga0157372_10177373 3300013307 Bacteria 2466
264 Ga0157375_10119855 3300013308 Bacteria 2739
265 Ga0157375_10647796 3300013308 Unclassified 1213
266 Ga0157375_10878411 3300013308 Bacteria 1042
267 Ga0163163_10181122 3300014325 Bacteria 2154
268 Ga0157380_10183447 3300014326 Unclassified 1841
269 Ga0182008_10047391 3300014497 Bacteria 2135
270 Ga0157376_10718302 3300014969 Bacteria 1006
271 Ga0157376_10856638 3300014969 Bacteria 924
272 Ga0157376_11041723 3300014969 Unclassified 842
273 Ga0163161_10040601 3300017792 Bacteria 3343
274 Ga0163161_10354866 3300017792 Unclassified 1166
275 Ga0206356_10482442 3300020070 Bacteria 1243
276 Ga0206353_10020003 3300020082 Bacteria 2246
277 Ga0206353_10074030 3300020082 Bacteria 2501
278 Ga0228711_1000772 3300022739 Bacteria 42689
279 Ga0228710_1000936 3300022740 Bacteria 41455
280 Ga0209675_1010530 3300025291 Bacteria 3147
281 Ga0209676_1007736 3300025292 Bacteria 4957
282 Ga0209025_1038293 3300025294 Bacteria 2112
283 Ga0207653_10000861 3300025885 Bacteria 10125
284 Ga0207642_10533097 3300025899 Bacteria 723
285 Ga0207688_10100092 3300025901 Bacteria 1673
286 Ga0207680_10299560 3300025903 Bacteria 1120
287 Ga0207699_10009472 3300025906 Bacteria 4852
288 Ga0207645_10004529 3300025907 Bacteria 10263
289 Ga0207645_10005678 3300025907 Bacteria 9014
290 Ga0207643_10000214 3300025908 Bacteria 40483
291 Ga0207643_10052275 3300025908 Bacteria 2320
292 Ga0207705_10153819 3300025909 Bacteria 1725
293 Ga0207684_10004470 3300025910 Bacteria 13164
294 Ga0207684_10009147 3300025910 Bacteria 8768
295 Ga0207684_10013221 3300025910 Bacteria 7145
296 Ga0207684_10019719 3300025910 Bacteria 5767
297 Ga0207684_10120310 3300025910 Bacteria 2251
298 Ga0207684_10337852 3300025910 Bacteria 1297
299 Ga0207654_10018803 3300025911 Bacteria 3632
300 Ga0207707_10000056 3300025912 Bacteria 113344
301 Ga0207707_10180919 3300025912 Bacteria 1841
302 Ga0207695_10112636 3300025913 Bacteria 2698
303 Ga0207695_10676429 3300025913 Unclassified 913
304 Ga0207660_10011192 3300025917 Bacteria 5832
305 Ga0207660_10174147 3300025917 Bacteria 1667
306 Ga0207660_10211873 3300025917 Bacteria 1517
307 Ga0207662_10072950 3300025918 Bacteria 2081
308 Ga0207657_10000306 3300025919 Bacteria 51970
309 Ga0207649_10148978 3300025920 Bacteria 1609
310 Ga0207649_10507969 3300025920 Bacteria 917
311 Ga0207652_10000532 3300025921 Bacteria 38675
312 Ga0207646_10005923 3300025922 Bacteria 12753
313 Ga0207646_10039786 3300025922 Bacteria 4230
314 Ga0207646_10084261 3300025922 Bacteria 2844
315 Ga0207681_10052258 3300025923 Bacteria 2771
316 Ga0207650_10037076 3300025925 Bacteria 3551
317 Ga0207659_10259307 3300025926 Bacteria 1413
318 Ga0207644_10016103 3300025931 Bacteria 5029
319 Ga0207644_10050925 3300025931 Bacteria 2970
320 Ga0207644_10150521 3300025931 Bacteria 1800
321 Ga0207690_10001831 3300025932 Bacteria 13051
322 Ga0207690_10094902 3300025932 Bacteria 2118
323 Ga0207706_10004233 3300025933 Bacteria 13521
324 Ga0207706_10140746 3300025933 Bacteria 2123
325 Ga0207686_10379113 3300025934 Bacteria 1072
326 Ga0207709_10032207 3300025935 Bacteria 3068
327 Ga0207670_10009764 3300025936 Bacteria 5492
328 Ga0207669_10060150 3300025937 Bacteria 2327
329 Ga0207704_10329198 3300025938 Bacteria 1181
330 Ga0207665_10000418 3300025939 Bacteria 29273
331 Ga0207691_10003291 3300025940 Bacteria 15739
332 Ga0207691_10107746 3300025940 Bacteria 2480
333 Ga0207691_10114388 3300025940 Bacteria 2397
334 Ga0207711_10422286 3300025941 Bacteria 1240
335 Ga0207711_10671430 3300025941 Unclassified 967
336 Ga0207689_10000126 3300025942 Bacteria 64343
337 Ga0207689_10008403 3300025942 Bacteria 8989
338 Ga0207689_10008688 3300025942 Bacteria 8838
339 Ga0207661_10019931 3300025944 Bacteria 5006
340 Ga0207661_10095929 3300025944 Bacteria 2481
341 Ga0207679_10127626 3300025945 Bacteria 2035
342 Ga0207679_10193881 3300025945 Bacteria 1691
343 Ga0207667_10002367 3300025949 Bacteria 23612
344 Ga0207667_10076350 3300025949 Bacteria 3477
345 Ga0207667_10695850 3300025949 Bacteria 1019
346 Ga0207651_10045190 3300025960 Bacteria 2952
347 Ga0207651_10373326 3300025960 Bacteria 1207
348 Ga0207651_10596314 3300025960 Bacteria 965
349 Ga0207651_10790863 3300025960 Bacteria 841
350 Ga0207712_10056020 3300025961 Bacteria 2776
351 Ga0207640_10041543 3300025981 Bacteria 2926
352 Ga0207658_10855682 3300025986 Bacteria 827
353 Ga0207703_10287061 3300026035 Bacteria 1496
354 Ga0207703_10865784 3300026035 Bacteria 864
355 Ga0207639_10032694 3300026041 Bacteria 3831
356 Ga0207678_10000963 3300026067 Bacteria 26320
357 Ga0207708_10386652 3300026075 Archaea 1155
358 Ga0207708_10448893 3300026075 Bacteria 1074
359 Ga0207702_10006723 3300026078 Bacteria 9883
360 Ga0207702_10015062 3300026078 Bacteria 6412
361 Ga0207641_10112923 3300026088 Bacteria 2411
362 Ga0207648_10001171 3300026089 Bacteria 29341
363 Ga0207648_10001548 3300026089 Bacteria 25313
364 Ga0207648_10081826 3300026089 Bacteria 2816
365 Ga0207648_10342691 3300026089 Bacteria 1346
366 Ga0207674_10000270 3300026116 Bacteria 65461
367 Ga0207674_10163488 3300026116 Bacteria 2180
368 Ga0207674_10241233 3300026116 Unclassified 1754
369 Ga0207675_100040347 3300026118 Bacteria 4359
370 Ga0207683_10119521 3300026121 Bacteria 2364
371 Ga0207683_10318262 3300026121 Bacteria 1425
372 Ga0207683_10828675 3300026121 Bacteria 859
373 Ga0207698_10017913 3300026142 Bacteria 4816
374 Ga0207698_10458727 3300026142 Bacteria 1232
375 Ga0209281_1000469 3300027111 Bacteria 56711
376 Ga0209282_1000038 3300027666 Bacteria 128955
377 Ga0209588_1005306 3300027671 Bacteria 3686
378 Ga0207428_10000190 3300027907 Bacteria 85215
379 Ga0207428_10123992 3300027907 Unclassified 1979
380 Ga0207428_10153688 3300027907 Bacteria 1751
381 Ga0268266_10024221 3300028379 Bacteria 5165
382 Ga0268266_10173486 3300028379 Bacteria 1958
383 Ga0268265_10019740 3300028380 Bacteria 4692
384 Ga0268264_10071383 3300028381 Bacteria 2942
385 Ga0307509_10092103 3300031507 Bacteria 3100
386 Ga0307509_10092932 3300031507 Bacteria 3081
387 Ga0307509_10146991 3300031507 Bacteria 2280
388 Ga0307508_10078432 3300031616 Bacteria 2883
389 Ga0307508_10098024 3300031616 Bacteria 2523
390 Ga0307514_10071822 3300031649 Bacteria 2594
391 Ga0307405_10234159 3300031731 Unclassified 1356
392 Ga0307405_10321144 3300031731 Bacteria 1183
393 Ga0307413_10832358 3300031824 Bacteria 778
394 Ga0307406_10527458 3300031901 Bacteria 962
395 Ga0315914_1000204 3300031967 Bacteria 62058
396 Ga0307409_100614810 3300031995 Unclassified 1076
397 Ga0307409_101156641 3300031995 Bacteria 796
398 Ga0307416_101516103 3300032002 Bacteria 776
399 Ga0307411_10125618 3300032005 Bacteria 1865
400 Ga0307510_10109517 3300033180 Bacteria 2510
401 Ga0315913_1002007 3300033430 Bacteria 23344
402 Ga0315915_1000018 3300033464 Bacteria 129799
403 Ga0373950_0073010 3300034818 Bacteria 706
404 Ga0373959_0023487 3300034820 Bacteria 1199
405 Ga0373928_0029632 3300035084 Unclassified 1204
406 Ga0373940_0030656 3300035088 Bacteria 1431
407 Ga0373949_0012274 3300035090 Bacteria 1893
408 Ga0373949_0018253 3300035090 Unclassified 1588
409 Ga0373932_0117966 3300035112 Bacteria 882
410 Ga0373941_0057428 3300035115 Bacteria 1256
411 Ga0373945_0075509 3300035116 Unclassified 1283
412 Ga0373960_0017157 3300035121 Unclassified 1872
413 Ga0373942_0006964 3300035207 Bacteria 2612
414 Ga0373961_0017523 3300035241 Bacteria 1859
415 Ga0373961_0045743 3300035241 Unclassified 1281
416 Ga0373962_0015397 3300035242 Unclassified 1960
417 Ga0373931_0001354 3300035691 Bacteria 10487
418 Ga0373931_0007904 3300035691 Bacteria 5031
419 Ga0373935_0060295 3300035692 Bacteria 2427
420 Ga0373947_0195973 3300035725 Unclassified 1320
421 Ga0373937_0012966 3300036401 Bacteria 7341
422 Ga0373925_0107474 3300037068 Bacteria 2152
423 Ga0395899_0014364 3300037312 Bacteria 6045
424 Ga0395899_0090178 3300037312 Bacteria 2223
425 Ga0395900_0120803 3300037418 Bacteria 2688
426 Ga0395898_0026079 3300037466 Bacteria 5884
427 Ga0395905_0064748 3300037471 Bacteria 3422
428 Ga0395905_0203495 3300037471 Bacteria 1856
429 Ga0395901_0017803 3300038443 Bacteria 7250
430 Ga0395901_0096910 3300038443 Bacteria 3091
431 Ga0242420_016693 3300038996 Bacteria 1280
432 Ga0439465_0121468 3300041413 Bacteria 916
433 Ga0439448_0017428 3300042005 Bacteria 2193
434 Ga0439449_0011605 3300042007 Bacteria 3313
435 Ga0439458_0004322 3300042157 Bacteria 3268
436 Ga0439444_0055918 3300042437 Unclassified 813
437 Ga0439460_0092056 3300042461 Unclassified 965
438 Ga0451577_0003647 3300042876 Bacteria 16886
439 Ga0451577_0014564 3300042876 Bacteria 7329
440 Ga0451577_0036675 3300042876 Bacteria 4413
441 Ga0451577_0109599 3300042876 Bacteria 2469
442 Ga0453683_0015247 3300044673 Bacteria 4981
443 Ga0453684_0009883 3300044712 Bacteria 16494
444 Ga0451576_0007779 3300045051 Bacteria 12719
445 Ga0451576_0016259 3300045051 Bacteria 8217
446 Ga0451576_0276540 3300045051 Bacteria 1755
447 Ga0451576_0423849 3300045051 Bacteria 1396
448 Ga0466967_0003029 3300045976 Bacteria 10782
449 Ga0495592_0000404 3300046454 Bacteria 32909
450 Ga0495629_0065105 3300046459 Bacteria 2544
451 Ga0495651_0160541 3300046462 Bacteria 1611
452 Ga0495580_0002613 3300046472 Bacteria 15639
453 Ga0495580_0025906 3300046472 Bacteria 4281
454 Ga0495584_0143896 3300046491 Bacteria 1211
455 Ga0495585_0093815 3300046492 Bacteria 1614
456 Ga0495663_0095272 3300046525 Bacteria 974
457 Ga0495666_0066506 3300046526 Bacteria 1718
458 Ga0495642_0144879 3300046528 Bacteria 1026
459 Ga0495656_0001040 3300046615 Bacteria 8959
460 Ga0495656_0029405 3300046615 Bacteria 2212
461 Ga0495625_0065109 3300046660 Bacteria 2570
462 Ga0495658_0017250 3300046683 Bacteria 3727
463 Ga0495658_0058552 3300046683 Bacteria 2204
464 Ga0495613_0036147 3300046689 Unclassified 3663
465 Ga0495636_0152968 3300047318 Bacteria 1036
466 Ga0495673_0044908 3300047469 Bacteria 1968
467 Ga0495684_0072723 3300047471 Bacteria 2612
468 Ga0495615_0003476 3300048090 Bacteria 2644
469 Ga0496101_0191242 3300048904 Bacteria 1580
470 Ga0496101_0667573 3300048904 Bacteria 821
471 Ga0496104_0059381 3300048907 Bacteria 3621
472 Ga0496104_0683619 3300048907 Bacteria 934
473 Ga0496108_0044701 3300048911 Bacteria 3697
474 Ga0496109_0580189 3300048912 Bacteria 1057
475 Ga0496112_0115705 3300048915 Bacteria 2652
476 Ga0496113_0171595 3300048916 Bacteria 1718
477 Ga0501037_0278955 3300049573 Unclassified 1165
478 Ga0501038_0191780 3300049574 Bacteria 1644
479 Ga0501039_0091285 3300049575 Bacteria 2374
480 Ga0501039_0247478 3300049575 Bacteria 1402
481 Ga0501040_0034862 3300049576 Bacteria 3410
482 Ga0501040_0066597 3300049576 Bacteria 2482
483 Ga0501040_0073753 3300049576 Bacteria 2359
484 Ga0501040_0100466 3300049576 Bacteria 2017
485 Ga0501041_0036689 3300049577 Bacteria 2969
486 Ga0501041_0103789 3300049577 Bacteria 1761
487 Ga0501042_0057714 3300049578 Bacteria 2770
488 Ga0501042_0198713 3300049578 Unclassified 1446
489 Ga0501043_0171110 3300049579 Bacteria 1695
490 Ga0501068_0365313 3300049584 Bacteria 928
491 Ga0501069_0061800 3300049585 Bacteria 2092
492 Ga0501071_0084330 3300049587 Bacteria 2329
493 Ga0501071_0186653 3300049587 Bacteria 1554
494 Ga0501071_0217587 3300049587 Bacteria 1437
495 Ga0501072_0014173 3300049588 Bacteria 6109
496 Ga0501072_0023866 3300049588 Bacteria 4752
497 Ga0501074_0077242 3300049590 Bacteria 2390
498 Ga0501075_0010075 3300049591 Bacteria 6632
499 Ga0501075_0110770 3300049591 Bacteria 2087
500 Ga0501076_0006637 3300049592 Bacteria 8392
501 Ga0501076_0047682 3300049592 Bacteria 3387
502 Ga0501076_0096780 3300049592 Bacteria 2378
503 Ga0501076_0098529 3300049592 Bacteria 2355
504 Ga0501076_0260858 3300049592 Bacteria 1419
505 Ga0501076_0424471 3300049592 Bacteria 1094
506 Ga0501076_0442302 3300049592 Unclassified 1070
507 Ga0501077_0012674 3300049593 Bacteria 5280
508 Ga0501077_0185993 3300049593 Bacteria 1320
509 Ga0501077_0277961 3300049593 Bacteria 1065
510 Ga0501079_0018901 3300049741 Bacteria 5266
511 Ga0501079_0030236 3300049741 Bacteria 4161
512 Ga0501079_0086957 3300049741 Bacteria 2420
513 Ga0501079_0675431 3300049741 Unclassified 813
514 Ga0501080_0019290 3300049742 Bacteria 6318
515 Ga0501080_0176508 3300049742 Bacteria 1968
516 Ga0501080_0362419 3300049742 Bacteria 1308
517 Ga0501081_0008099 3300049743 Bacteria 6819
518 Ga0501081_0018852 3300049743 Bacteria 4584
519 Ga0501081_0046986 3300049743 Bacteria 2969
520 Ga0501081_0311522 3300049743 Unclassified 1156
521 Ga0501044_0068764 3300049823 Bacteria 3607
522 Ga0501045_0058299 3300049824 Bacteria 2827
523 nmdc:mga05p37_101116_c1 3300050507 Bacteria 3551
524 nmdc:mga05p37_13970_c1 3300050507 Bacteria 9629
525 nmdc:mga05p37_15394_c1 3300050507 Bacteria 9188
526 nmdc:mga05p37_15550_c1 3300050507 Bacteria 9146
527 nmdc:mga05p37_18754_c1 3300050507 Bacteria 8360
528 nmdc:mga05p37_189172_c1 3300050507 Bacteria 2501
529 nmdc:mga05p37_413905_c1 3300050507 Bacteria 1571
530 nmdc:mga05p37_49349_c1 3300050507 Bacteria 5176
531 nmdc:mga05p37_541260_c1 3300050507 Bacteria 1328
532 nmdc:mga05p37_599294_c1 3300050507 Bacteria 1244
533 nmdc:mga05p37_648305_c1 3300050507 Unclassified 1183
534 nmdc:mga05p37_714690_c1 3300050507 Unclassified 1111
535 nmdc:mga05p37_725372_c1 3300050507 Bacteria 1100
536 nmdc:mga05p37_90029_c1 3300050507 Bacteria 3782
537 nmdc:mga09592_13093_c1 3300050508 Bacteria 6769
538 nmdc:mga09592_16549_c1 3300050508 Bacteria 6034
539 nmdc:mga09592_205965_c1 3300050508 Bacteria 1704
540 nmdc:mga09592_389953_c1 3300050508 Bacteria 1204
541 nmdc:mga09592_511_c1 3300050508 Bacteria 29376
542 nmdc:mga09592_52975_c1 3300050508 Bacteria 3425
543 nmdc:mga09592_575873_c1 3300050508 Unclassified 966
544 nmdc:mga0qj67_11850_c1 3300050509 Bacteria 6546
545 nmdc:mga0qj67_203_c1 3300050509 Bacteria 40147
546 nmdc:mga0qj67_473634_c1 3300050509 Unclassified 1008
547 nmdc:mga0qj67_747_c1 3300050509 Bacteria 22059
548 nmdc:mga06r32_101495_c1 3300050510 Bacteria 2824
549 nmdc:mga06r32_169993_c1 3300050510 Unclassified 2163
550 nmdc:mga06r32_26305_c1 3300050510 Bacteria 5424
551 nmdc:mga06r32_269518_c1 3300050510 Bacteria 1690
552 nmdc:mga06r32_3064_c1 3300050510 Bacteria 14955
553 nmdc:mga06r32_64807_c1 3300050510 Bacteria 3524
554 nmdc:mga06r32_695493_c1 3300050510 Unclassified 983
555 nmdc:mga06r32_815918_c1 3300050510 Bacteria 893
556 nmdc:mga06r32_88857_c1 3300050510 Plasmid 3016
557 nmdc:mga08y16_128790_c1 3300050511 Unclassified 2633
558 nmdc:mga08y16_1951_c1 3300050511 Bacteria 21034
559 nmdc:mga08y16_1952_c1 3300050511 Bacteria 21031
560 nmdc:mga08y16_285618_c1 3300050511 Bacteria 1701
561 nmdc:mga08y16_35481_c1 3300050511 Bacteria 5237
562 nmdc:mga08y16_53865_c1 3300050511 Bacteria 4205
563 nmdc:mga0n895_1262919_c1 3300050512 Bacteria 711
564 nmdc:mga0n895_184911_c1 3300050512 Bacteria 2115
565 nmdc:mga0n895_321580_c1 3300050512 Bacteria 1568
566 nmdc:mga0n895_469395_c1 3300050512 Bacteria 1270
567 nmdc:mga0n895_509624_c1 3300050512 Bacteria 1212
568 nmdc:mga0n895_52345_c1 3300050512 Bacteria 4008
569 nmdc:mga0n895_61577_c1 3300050512 Bacteria 3706
570 nmdc:mga0n895_62932_c1 3300050512 Unclassified 3669
571 nmdc:mga0n895_9928_c1 3300050512 Bacteria 8374
572 nmdc:mga0rr50_16048_c1 3300050513 Bacteria 4962
573 nmdc:mga0rr50_192338_c1 3300050513 Bacteria 1673
574 nmdc:mga0rr50_20450_c1 3300050513 Bacteria 4497
575 nmdc:mga0rr50_297875_c1 3300050513 Bacteria 1349
576 nmdc:mga0rr50_299179_c1 3300050513 Bacteria 1346
577 nmdc:mga0rr50_33438_c1 3300050513 Bacteria 3673
578 nmdc:mga0rr50_40728_c1 3300050513 Unclassified 3379
579 nmdc:mga0rr50_54408_c1 3300050513 Bacteria 2982
580 nmdc:mga0rr50_68667_c1 3300050513 Bacteria 2696
581 nmdc:mga08x19_14859_c1 3300050514 Bacteria 4728
582 nmdc:mga08x19_29708_c1 3300050514 Bacteria 3429
583 nmdc:mga08x19_41223_c1 3300050514 Bacteria 2940
584 nmdc:mga08x19_4310_c1 3300050514 Bacteria 8426
585 nmdc:mga08x19_487301_c1 3300050514 Bacteria 870
586 nmdc:mga0a205_103790_c2 3300050515 Unclassified 1812
587 nmdc:mga0a205_10877_c1 3300050515 Bacteria 8372
588 nmdc:mga0a205_1214_c1 3300050515 Bacteria 21582
589 nmdc:mga0a205_139966_c1 3300050515 Bacteria 2320
590 nmdc:mga0a205_19486_c1 3300050515 Bacteria 6397
591 nmdc:mga0a205_2135_c1 3300050515 Bacteria 17365
592 nmdc:mga0a205_21654_c1 3300050515 Bacteria 6078
593 nmdc:mga0a205_25739_c1 3300050515 Bacteria 5607
594 nmdc:mga0a205_34641_c1 3300050515 Bacteria 4844
595 nmdc:mga0a205_64330_c2 3300050515 Bacteria 3238
596 Ga0495612_0054004 3300053078 Unclassified 1655
597 Ga0495595_0049813 3300053084 Unclassified 1938
598 Ga0495619_0031297 3300053085 Bacteria 3448
599 Ga0500645_001329 3300053730 Bacteria 12797
600 Ga0501084_0001636 3300054114 Bacteria 17786
601 Ga0501084_0039097 3300054114 Bacteria 3968
602 Ga0501084_0114813 3300054114 Bacteria 2264
603 Ga0501084_0234988 3300054114 Bacteria 1547
604 Ga0501084_0575689 3300054114 Bacteria 951
605 Ga0501082_0014328 3300060353 Bacteria 6822
606 Ga0501082_0028956 3300060353 Bacteria 4771
607 Ga0501082_0463987 3300060353 Bacteria 1107
608 Ga0501082_0520201 3300060353 Bacteria 1040
609 Ga0530510_0097460 3300061734 Bacteria 2150
610 Ga0530510_0241670 3300061734 Bacteria 1344
611 Ga0530510_0244730 3300061734 Unclassified 1336

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028381 Ga0268264_10071383 Ga0268264_100713834 214
2 iso_pu_bacteria 2508501050 2508731245 215
3 3300005455 Ga0070663_100577038 Ga0070663_1005770381 216
4 3300005457 Ga0070662_100058269 Ga0070662_1000582692 216
5 3300005471 Ga0070698_100603497 Ga0070698_1006034972 216
6 3300005539 Ga0068853_100339222 Ga0068853_1003392222 216
7 3300005548 Ga0070665_100390171 Ga0070665_1003901712 216
8 3300005844 Ga0068862_100064953 Ga0068862_1000649532 216
9 3300006847 Ga0075431_100218449 Ga0075431_1002184492 216
10 3300006852 Ga0075433_10052169 Ga0075433_100521694 216
11 3300006871 Ga0075434_100091306 Ga0075434_1000913063 216
12 3300007076 Ga0075435_100297143 Ga0075435_1002971432 216
13 iso_pu_bacteria 2738543013 2739251186 216
14 3300005293 Ga0065715_10155528 Ga0065715_101555281 217
15 3300005328 Ga0070676_10002814 Ga0070676_100028147 217
16 3300005329 Ga0070683_100131652 Ga0070683_1001316522 217
17 3300005329 Ga0070683_100158723 Ga0070683_1001587232 217
18 3300005330 Ga0070690_100034427 Ga0070690_1000344272 217
19 3300005334 Ga0068869_100000228 Ga0068869_10000022813 217
20 3300005336 Ga0070680_100001225 Ga0070680_10000122510 217
21 3300005336 Ga0070680_100394844 Ga0070680_1003948441 217
22 3300005336 Ga0070680_100694006 Ga0070680_1006940061 217
23 3300005337 Ga0070682_100001200 Ga0070682_10000120012 217
24 3300005338 Ga0068868_100702049 Ga0068868_1007020492 217
25 3300005339 Ga0070660_100000281 Ga0070660_10000028118 217
26 3300005340 Ga0070689_100016424 Ga0070689_1000164242 217
27 3300005341 Ga0070691_10029628 Ga0070691_100296282 217
28 3300005343 Ga0070687_100032253 Ga0070687_1000322532 217
29 3300005344 Ga0070661_100015722 Ga0070661_1000157222 217
30 3300005344 Ga0070661_100126336 Ga0070661_1001263362 217
31 3300005345 Ga0070692_10002011 Ga0070692_100020118 217
32 3300005355 Ga0070671_100358633 Ga0070671_1003586332 217
33 3300005366 Ga0070659_100041894 Ga0070659_1000418942 217
34 3300005367 Ga0070667_100181142 Ga0070667_1001811422 217
35 3300005367 Ga0070667_100490120 Ga0070667_1004901202 217
36 3300005406 Ga0070703_10000633 Ga0070703_1000063310 217
37 3300005406 Ga0070703_10004012 Ga0070703_100040124 217
38 3300005434 Ga0070709_10066103 Ga0070709_100661033 217
39 3300005436 Ga0070713_100450987 Ga0070713_1004509873 217
40 3300005438 Ga0070701_10201675 Ga0070701_102016751 217
41 3300005440 Ga0070705_100000209 Ga0070705_10000020910 217
42 3300005440 Ga0070705_100071605 Ga0070705_1000716052 217
43 3300005444 Ga0070694_100001135 Ga0070694_10000113513 217
44 3300005444 Ga0070694_100273488 Ga0070694_1002734883 217
45 3300005445 Ga0070708_100193769 Ga0070708_1001937692 217
46 3300005455 Ga0070663_100069022 Ga0070663_1000690222 217
47 3300005456 Ga0070678_100921559 Ga0070678_1009215591 217
48 3300005457 Ga0070662_100023687 Ga0070662_1000236873 217
49 3300005457 Ga0070662_100883675 Ga0070662_1008836751 217
50 3300005458 Ga0070681_10054874 Ga0070681_100548745 217
51 3300005458 Ga0070681_10349207 Ga0070681_103492072 217
52 3300005459 Ga0068867_100001387 Ga0068867_10000138711 217
53 3300005459 Ga0068867_100592378 Ga0068867_1005923781 217
54 3300005467 Ga0070706_100454084 Ga0070706_1004540841 217
55 3300005468 Ga0070707_100117335 Ga0070707_1001173353 217
56 3300005468 Ga0070707_100420162 Ga0070707_1004201621 217
57 3300005471 Ga0070698_100071818 Ga0070698_1000718186 217
58 3300005471 Ga0070698_100295623 Ga0070698_1002956232 217
59 3300005518 Ga0070699_100123238 Ga0070699_1001232382 217
60 3300005530 Ga0070679_100000384 Ga0070679_10000038427 217
61 3300005535 Ga0070684_100012681 Ga0070684_1000126815 217
62 3300005536 Ga0070697_100296124 Ga0070697_1002961242 217
63 3300005539 Ga0068853_100005645 Ga0068853_1000056458 217
64 3300005543 Ga0070672_100078247 Ga0070672_1000782473 217
65 3300005545 Ga0070695_100006033 Ga0070695_1000060335 217
66 3300005545 Ga0070695_100409901 Ga0070695_1004099011 217
67 3300005546 Ga0070696_100000432 Ga0070696_10000043212 217
68 3300005547 Ga0070693_100000049 Ga0070693_10000004920 217
69 3300005548 Ga0070665_100005547 Ga0070665_1000055477 217
70 3300005549 Ga0070704_100000798 Ga0070704_10000079812 217
71 3300005549 Ga0070704_100084926 Ga0070704_1000849265 217
72 3300005549 Ga0070704_100848971 Ga0070704_1008489711 217
73 3300005563 Ga0068855_100006053 Ga0068855_1000060532 217
74 3300005563 Ga0068855_100174475 Ga0068855_1001744752 217
75 3300005564 Ga0070664_100028901 Ga0070664_1000289012 217
76 3300005577 Ga0068857_100008279 Ga0068857_1000082793 217
77 3300005577 Ga0068857_100155337 Ga0068857_1001553373 217
78 3300005578 Ga0068854_100053986 Ga0068854_1000539862 217
79 3300005614 Ga0068856_100002309 Ga0068856_1000023099 217
80 3300005614 Ga0068856_100005140 Ga0068856_1000051406 217
81 3300005615 Ga0070702_100505498 Ga0070702_1005054981 217
82 3300005616 Ga0068852_100069153 Ga0068852_1000691533 217
83 3300005616 Ga0068852_100532752 Ga0068852_1005327521 217
84 3300005617 Ga0068859_100028623 Ga0068859_1000286237 217
85 3300005617 Ga0068859_100765546 Ga0068859_1007655462 217
86 3300005618 Ga0068864_100010526 Ga0068864_1000105265 217
87 3300005618 Ga0068864_100072247 Ga0068864_1000722471 217
88 3300005719 Ga0068861_100045224 Ga0068861_1000452242 217
89 3300005840 Ga0068870_10000058 Ga0068870_1000005819 217
90 3300005840 Ga0068870_10203432 Ga0068870_102034322 217
91 3300005841 Ga0068863_100012852 Ga0068863_1000128527 217
92 3300005842 Ga0068858_100029779 Ga0068858_1000297792 217
93 3300005843 Ga0068860_100007602 Ga0068860_1000076024 217
94 3300005844 Ga0068862_100002587 Ga0068862_10000258712 217
95 3300005844 Ga0068862_101217674 Ga0068862_1012176741 217
96 3300005937 Ga0081455_10506455 Ga0081455_105064551 217
97 3300006173 Ga0070716_100012162 Ga0070716_1000121623 217
98 3300006175 Ga0070712_100437454 Ga0070712_1004374542 217
99 3300006177 Ga0075362_10053809 Ga0075362_100538092 217
100 3300006358 Ga0068871_100457295 Ga0068871_1004572952 217
101 3300006844 Ga0075428_100029033 Ga0075428_1000290333 217
102 3300006844 Ga0075428_100119345 Ga0075428_1001193455 217
103 3300006844 Ga0075428_100966407 Ga0075428_1009664072 217
104 3300006846 Ga0075430_100196082 Ga0075430_1001960822 217
105 3300006847 Ga0075431_100080770 Ga0075431_1000807703 217
106 3300006852 Ga0075433_10000715 Ga0075433_1000071518 217
107 3300006852 Ga0075433_10098100 Ga0075433_100981002 217
108 3300006871 Ga0075434_100002095 Ga0075434_1000020952 217
109 3300006871 Ga0075434_100081864 Ga0075434_1000818643 217
110 3300006871 Ga0075434_100642478 Ga0075434_1006424781 217
111 3300006880 Ga0075429_100025276 Ga0075429_1000252762 217
112 3300006881 Ga0068865_100094183 Ga0068865_1000941831 217
113 3300006914 Ga0075436_100051694 Ga0075436_1000516942 217
114 3300006931 Ga0097620_100028624 Ga0097620_1000286241 217
115 3300006931 Ga0097620_100765607 Ga0097620_1007656072 217
116 3300007076 Ga0075435_100021878 Ga0075435_1000218785 217
117 3300007076 Ga0075435_100087344 Ga0075435_1000873442 217
118 3300007076 Ga0075435_100135696 Ga0075435_1001356961 217
119 3300007265 Ga0099794_10005130 Ga0099794_100051301 217
120 3300009093 Ga0105240_10098611 Ga0105240_100986112 217
121 3300009093 Ga0105240_10519201 Ga0105240_105192012 217
122 3300009094 Ga0111539_10040200 Ga0111539_100402002 217
123 3300009094 Ga0111539_10944703 Ga0111539_109447031 217
124 3300009147 Ga0114129_10025203 Ga0114129_100252037 217
125 3300009147 Ga0114129_10070216 Ga0114129_100702162 217
126 3300009147 Ga0114129_10081413 Ga0114129_100814133 217
127 3300009147 Ga0114129_10163192 Ga0114129_101631922 217
128 3300009147 Ga0114129_10200877 Ga0114129_102008774 217
129 3300009147 Ga0114129_11404099 Ga0114129_114040991 217
130 3300009148 Ga0105243_10198043 Ga0105243_101980432 217
131 3300009174 Ga0105241_10000194 Ga0105241_1000019436 217
132 3300009174 Ga0105241_10435942 Ga0105241_104359421 217
133 3300009177 Ga0105248_10079613 Ga0105248_100796134 217
134 3300009177 Ga0105248_10696953 Ga0105248_106969532 217
135 3300009545 Ga0105237_10514719 Ga0105237_105147192 217
136 3300009551 Ga0105238_10375187 Ga0105238_103751872 217
137 3300009553 Ga0105249_10274682 Ga0105249_102746822 217
138 3300010375 Ga0105239_10158506 Ga0105239_101585061 217
139 3300011119 Ga0105246_10018572 Ga0105246_100185724 217
140 3300011119 Ga0105246_10345743 Ga0105246_103457431 217
141 3300013100 Ga0157373_10000236 Ga0157373_1000023637 217
142 3300013102 Ga0157371_10177895 Ga0157371_101778952 217
143 3300013105 Ga0157369_10032514 Ga0157369_100325145 217
144 3300013105 Ga0157369_10111236 Ga0157369_101112362 217
145 3300013297 Ga0157378_10596225 Ga0157378_105962251 217
146 3300013307 Ga0157372_10004639 Ga0157372_100046396 217
147 3300013307 Ga0157372_10177373 Ga0157372_101773732 217
148 3300013308 Ga0157375_10119855 Ga0157375_101198552 217
149 3300013308 Ga0157375_10647796 Ga0157375_106477962 217
150 3300014325 Ga0163163_10181122 Ga0163163_101811222 217
151 3300014497 Ga0182008_10047391 Ga0182008_100473912 217
152 3300014969 Ga0157376_10856638 Ga0157376_108566382 217
153 3300014969 Ga0157376_11041723 Ga0157376_110417232 217
154 3300017792 Ga0163161_10040601 Ga0163161_100406012 217
155 3300020070 Ga0206356_10482442 Ga0206356_104824422 217
156 3300020082 Ga0206353_10020003 Ga0206353_100200032 217
157 3300020082 Ga0206353_10074030 Ga0206353_100740302 217
158 3300025885 Ga0207653_10000861 Ga0207653_100008617 217
159 3300025901 Ga0207688_10100092 Ga0207688_101000922 217
160 3300025903 Ga0207680_10299560 Ga0207680_102995602 217
161 3300025906 Ga0207699_10009472 Ga0207699_100094724 217
162 3300025907 Ga0207645_10005678 Ga0207645_100056782 217
163 3300025908 Ga0207643_10000214 Ga0207643_1000021416 217
164 3300025909 Ga0207705_10153819 Ga0207705_101538192 217
165 3300025910 Ga0207684_10004470 Ga0207684_100044706 217
166 3300025910 Ga0207684_10120310 Ga0207684_101203102 217
167 3300025911 Ga0207654_10018803 Ga0207654_100188032 217
168 3300025912 Ga0207707_10000056 Ga0207707_1000005633 217
169 3300025912 Ga0207707_10180919 Ga0207707_101809192 217
170 3300025913 Ga0207695_10112636 Ga0207695_101126362 217
171 3300025913 Ga0207695_10676429 Ga0207695_106764292 217
172 3300025917 Ga0207660_10011192 Ga0207660_100111925 217
173 3300025917 Ga0207660_10174147 Ga0207660_101741472 217
174 3300025917 Ga0207660_10211873 Ga0207660_102118732 217
175 3300025918 Ga0207662_10072950 Ga0207662_100729502 217
176 3300025919 Ga0207657_10000306 Ga0207657_1000030632 217
177 3300025920 Ga0207649_10148978 Ga0207649_101489781 217
178 3300025920 Ga0207649_10507969 Ga0207649_105079691 217
179 3300025921 Ga0207652_10000532 Ga0207652_1000053218 217
180 3300025922 Ga0207646_10039786 Ga0207646_100397863 217
181 3300025923 Ga0207681_10052258 Ga0207681_100522582 217
182 3300025925 Ga0207650_10037076 Ga0207650_100370762 217
183 3300025931 Ga0207644_10016103 Ga0207644_100161033 217
184 3300025932 Ga0207690_10001831 Ga0207690_1000183113 217
185 3300025932 Ga0207690_10094902 Ga0207690_100949022 217
186 3300025933 Ga0207706_10004233 Ga0207706_100042336 217
187 3300025936 Ga0207670_10009764 Ga0207670_100097643 217
188 3300025938 Ga0207704_10329198 Ga0207704_103291982 217
189 3300025939 Ga0207665_10000418 Ga0207665_1000041820 217
190 3300025940 Ga0207691_10107746 Ga0207691_101077463 217
191 3300025941 Ga0207711_10422286 Ga0207711_104222861 217
192 3300025941 Ga0207711_10671430 Ga0207711_106714302 217
193 3300025942 Ga0207689_10000126 Ga0207689_1000012617 217
194 3300025944 Ga0207661_10019931 Ga0207661_100199312 217
195 3300025944 Ga0207661_10095929 Ga0207661_100959292 217
196 3300025945 Ga0207679_10127626 Ga0207679_101276262 217
197 3300025945 Ga0207679_10193881 Ga0207679_101938812 217
198 3300025949 Ga0207667_10002367 Ga0207667_1000236720 217
199 3300025949 Ga0207667_10076350 Ga0207667_100763502 217
200 3300025949 Ga0207667_10695850 Ga0207667_106958502 217
201 3300025960 Ga0207651_10045190 Ga0207651_100451902 217
202 3300025960 Ga0207651_10373326 Ga0207651_103733261 217
203 3300025960 Ga0207651_10596314 Ga0207651_105963142 217
204 3300025961 Ga0207712_10056020 Ga0207712_100560202 217
205 3300025981 Ga0207640_10041543 Ga0207640_100415433 217
206 3300025986 Ga0207658_10855682 Ga0207658_108556821 217
207 3300026035 Ga0207703_10287061 Ga0207703_102870612 217
208 3300026041 Ga0207639_10032694 Ga0207639_100326944 217
209 3300026067 Ga0207678_10000963 Ga0207678_100009632 217
210 3300026075 Ga0207708_10386652 Ga0207708_103866522 217
211 3300026075 Ga0207708_10448893 Ga0207708_104488932 217
212 3300026078 Ga0207702_10006723 Ga0207702_1000672310 217
213 3300026078 Ga0207702_10015062 Ga0207702_100150625 217
214 3300026088 Ga0207641_10112923 Ga0207641_101129231 217
215 3300026089 Ga0207648_10001171 Ga0207648_100011717 217
216 3300026089 Ga0207648_10342691 Ga0207648_103426912 217
217 3300026116 Ga0207674_10000270 Ga0207674_100002708 217
218 3300026116 Ga0207674_10241233 Ga0207674_102412331 217
219 3300026118 Ga0207675_100040347 Ga0207675_1000403474 217
220 3300026121 Ga0207683_10318262 Ga0207683_103182622 217
221 3300026121 Ga0207683_10828675 Ga0207683_108286751 217
222 3300026142 Ga0207698_10017913 Ga0207698_100179132 217
223 3300026142 Ga0207698_10458727 Ga0207698_104587272 217
224 3300027671 Ga0209588_1005306 Ga0209588_10053065 217
225 3300027907 Ga0207428_10153688 Ga0207428_101536883 217
226 3300028379 Ga0268266_10173486 Ga0268266_101734862 217
227 3300031507 Ga0307509_10092103 Ga0307509_100921033 217
228 3300031507 Ga0307509_10092932 Ga0307509_100929322 217
229 3300031507 Ga0307509_10146991 Ga0307509_101469913 217
230 3300031616 Ga0307508_10078432 Ga0307508_100784324 217
231 3300031616 Ga0307508_10098024 Ga0307508_100980242 217
232 3300031901 Ga0307406_10527458 Ga0307406_105274582 217
233 3300033180 Ga0307510_10109517 Ga0307510_101095172 217
234 3300034818 Ga0373950_0073010 Ga0373950_0073010_34_687 217
235 3300034820 Ga0373959_0023487 Ga0373959_0023487_61_714 217
236 3300035090 Ga0373949_0012274 Ga0373949_0012274_509_1162 217
237 3300035090 Ga0373949_0018253 Ga0373949_0018253_702_1355 217
238 3300035112 Ga0373932_0117966 Ga0373932_0117966_156_809 217
239 3300035121 Ga0373960_0017157 Ga0373960_0017157_646_1299 217
240 3300035207 Ga0373942_0006964 Ga0373942_0006964_1881_2534 217
241 3300035241 Ga0373961_0017523 Ga0373961_0017523_221_874 217
242 3300035242 Ga0373962_0015397 Ga0373962_0015397_805_1458 217
243 3300035691 Ga0373931_0007904 Ga0373931_0007904_2774_3427 217
244 3300037312 Ga0395899_0014364 Ga0395899_0014364_5294_5950 217
245 3300037312 Ga0395899_0090178 Ga0395899_0090178_306_962 217
246 3300037418 Ga0395900_0120803 Ga0395900_0120803_1493_2149 217
247 3300037466 Ga0395898_0026079 Ga0395898_0026079_1046_1702 217
248 3300037471 Ga0395905_0064748 Ga0395905_0064748_2103_2759 217
249 3300037471 Ga0395905_0203495 Ga0395905_0203495_660_1313 217
250 3300038443 Ga0395901_0017803 Ga0395901_0017803_1780_2436 217
251 3300038443 Ga0395901_0096910 Ga0395901_0096910_1261_1917 217
252 3300042005 Ga0439448_0017428 Ga0439448_0017428_227_880 217
253 3300042007 Ga0439449_0011605 Ga0439449_0011605_551_1204 217
254 3300042157 Ga0439458_0004322 Ga0439458_0004322_2406_3059 217
255 3300042437 Ga0439444_0055918 Ga0439444_0055918_20_673 217
256 3300042876 Ga0451577_0014564 Ga0451577_0014564_5680_6333 217
257 3300042876 Ga0451577_0109599 Ga0451577_0109599_375_1028 217
258 3300045051 Ga0451576_0016259 Ga0451576_0016259_7546_8199 217
259 3300045051 Ga0451576_0276540 Ga0451576_0276540_954_1607 217
260 3300045976 Ga0466967_0003029 Ga0466967_0003029_4370_5026 217
261 3300046462 Ga0495651_0160541 Ga0495651_0160541_93_746 217
262 3300046472 Ga0495580_0025906 Ga0495580_0025906_1595_2248 217
263 3300046491 Ga0495584_0143896 Ga0495584_0143896_420_1073 217
264 3300046492 Ga0495585_0093815 Ga0495585_0093815_792_1445 217
265 3300046525 Ga0495663_0095272 Ga0495663_0095272_180_833 217
266 3300046526 Ga0495666_0066506 Ga0495666_0066506_548_1201 217
267 3300046528 Ga0495642_0144879 Ga0495642_0144879_178_831 217
268 3300046615 Ga0495656_0001040 Ga0495656_0001040_5999_6652 217
269 3300046660 Ga0495625_0065109 Ga0495625_0065109_1531_2184 217
270 3300046683 Ga0495658_0058552 Ga0495658_0058552_1520_2173 217
271 3300047469 Ga0495673_0044908 Ga0495673_0044908_1258_1911 217
272 3300048090 Ga0495615_0003476 Ga0495615_0003476_1258_1911 217
273 3300048904 Ga0496101_0191242 Ga0496101_0191242_530_1183 217
274 3300048904 Ga0496101_0667573 Ga0496101_0667573_81_734 217
275 3300048907 Ga0496104_0059381 Ga0496104_0059381_297_950 217
276 3300048911 Ga0496108_0044701 Ga0496108_0044701_2000_2653 217
277 3300048912 Ga0496109_0580189 Ga0496109_0580189_56_709 217
278 3300048915 Ga0496112_0115705 Ga0496112_0115705_804_1457 217
279 3300048916 Ga0496113_0171595 Ga0496113_0171595_113_766 217
280 3300049592 Ga0501076_0424471 Ga0501076_0424471_300_953 217
281 3300049742 Ga0501080_0176508 Ga0501080_0176508_630_1283 217
282 3300050507 nmdc:mga05p37_18754_c1 nmdc:mga05p37_18754_c1_1167_1820 217
283 3300050507 nmdc:mga05p37_189172_c1 nmdc:mga05p37_189172_c1_1131_1784 217
284 3300050507 nmdc:mga05p37_49349_c1 nmdc:mga05p37_49349_c1_1922_2575 217
285 3300050507 nmdc:mga05p37_599294_c1 nmdc:mga05p37_599294_c1_385_1038 217
286 3300050508 nmdc:mga09592_52975_c1 nmdc:mga09592_52975_c1_1965_2618 217
287 3300050510 nmdc:mga06r32_64807_c1 nmdc:mga06r32_64807_c1_567_1220 217
288 3300050511 nmdc:mga08y16_128790_c1 nmdc:mga08y16_128790_c1_1741_2394 217
289 3300050512 nmdc:mga0n895_1262919_c1 nmdc:mga0n895_1262919_c1_43_696 217
290 3300050512 nmdc:mga0n895_509624_c1 nmdc:mga0n895_509624_c1_213_866 217
291 3300050512 nmdc:mga0n895_61577_c1 nmdc:mga0n895_61577_c1_2723_3376 217
292 3300050513 nmdc:mga0rr50_16048_c1 nmdc:mga0rr50_16048_c1_2638_3291 217
293 3300050513 nmdc:mga0rr50_297875_c1 nmdc:mga0rr50_297875_c1_206_859 217
294 3300050513 nmdc:mga0rr50_299179_c1 nmdc:mga0rr50_299179_c1_84_737 217
295 3300050513 nmdc:mga0rr50_40728_c1 nmdc:mga0rr50_40728_c1_1326_1979 217
296 3300050514 nmdc:mga08x19_4310_c1 nmdc:mga08x19_4310_c1_6094_6747 217
297 3300050514 nmdc:mga08x19_487301_c1 nmdc:mga08x19_487301_c1_16_669 217
298 3300050515 nmdc:mga0a205_10877_c1 nmdc:mga0a205_10877_c1_4764_5417 217
299 3300050515 nmdc:mga0a205_1214_c1 nmdc:mga0a205_1214_c1_20613_21266 217
300 3300050515 nmdc:mga0a205_25739_c1 nmdc:mga0a205_25739_c1_2927_3580 217
301 3300054114 Ga0501084_0114813 Ga0501084_0114813_993_1646 217
302 3300005328 Ga0070676_10019968 Ga0070676_100199684 218
303 3300005334 Ga0068869_100037255 Ga0068869_1000372553 218
304 3300005338 Ga0068868_100147977 Ga0068868_1001479772 218
305 3300005353 Ga0070669_100550291 Ga0070669_1005502912 218
306 3300005355 Ga0070671_100254429 Ga0070671_1002544291 218
307 3300005356 Ga0070674_100098794 Ga0070674_1000987941 218
308 3300005364 Ga0070673_100119857 Ga0070673_1001198572 218
309 3300005406 Ga0070703_10016100 Ga0070703_100161003 218
310 3300005444 Ga0070694_100016158 Ga0070694_1000161582 218
311 3300005445 Ga0070708_100033393 Ga0070708_1000333933 218
312 3300005457 Ga0070662_100202847 Ga0070662_1002028472 218
313 3300005459 Ga0068867_100002339 Ga0068867_1000023394 218
314 3300005459 Ga0068867_100086876 Ga0068867_1000868762 218
315 3300005459 Ga0068867_100823125 Ga0068867_1008231251 218
316 3300005467 Ga0070706_100060610 Ga0070706_1000606102 218
317 3300005471 Ga0070698_100007922 Ga0070698_1000079227 218
318 3300005471 Ga0070698_100787044 Ga0070698_1007870441 218
319 3300005518 Ga0070699_100503395 Ga0070699_1005033952 218
320 3300005536 Ga0070697_100043485 Ga0070697_1000434854 218
321 3300005543 Ga0070672_100007475 Ga0070672_1000074757 218
322 3300005545 Ga0070695_100011071 Ga0070695_1000110716 218
323 3300005546 Ga0070696_100005303 Ga0070696_1000053037 218
324 3300005577 Ga0068857_100014260 Ga0068857_1000142605 218
325 3300005577 Ga0068857_101063994 Ga0068857_1010639941 218
326 3300005719 Ga0068861_100085740 Ga0068861_1000857404 218
327 3300005840 Ga0068870_10081427 Ga0068870_100814272 218
328 3300005841 Ga0068863_100692235 Ga0068863_1006922351 218
329 3300005842 Ga0068858_100233404 Ga0068858_1002334042 218
330 3300005844 Ga0068862_100025663 Ga0068862_1000256636 218
331 3300005983 Ga0081540_1037400 Ga0081540_10374003 218
332 3300006844 Ga0075428_100009400 Ga0075428_1000094002 218
333 3300006844 Ga0075428_100042157 Ga0075428_1000421574 218
334 3300006844 Ga0075428_100567287 Ga0075428_1005672872 218
335 3300006846 Ga0075430_100005950 Ga0075430_1000059504 218
336 3300006846 Ga0075430_100029165 Ga0075430_1000291653 218
337 3300006846 Ga0075430_100342881 Ga0075430_1003428812 218
338 3300006846 Ga0075430_100412242 Ga0075430_1004122422 218
339 3300006847 Ga0075431_100015506 Ga0075431_1000155062 218
340 3300006847 Ga0075431_100081470 Ga0075431_1000814703 218
341 3300006847 Ga0075431_100098604 Ga0075431_1000986042 218
342 3300006847 Ga0075431_100172556 Ga0075431_1001725562 218
343 3300006847 Ga0075431_100331688 Ga0075431_1003316882 218
344 3300006852 Ga0075433_10089399 Ga0075433_100893992 218
345 3300006852 Ga0075433_10118487 Ga0075433_101184872 218
346 3300006852 Ga0075433_10472458 Ga0075433_104724582 218
347 3300006871 Ga0075434_100000430 Ga0075434_1000004303 218
348 3300006871 Ga0075434_100184653 Ga0075434_1001846532 218
349 3300006871 Ga0075434_100277686 Ga0075434_1002776863 218
350 3300006880 Ga0075429_100002725 Ga0075429_10000272512 218
351 3300006880 Ga0075429_100044089 Ga0075429_1000440892 218
352 3300006880 Ga0075429_100281365 Ga0075429_1002813652 218
353 3300006880 Ga0075429_100301015 Ga0075429_1003010152 218
354 3300006880 Ga0075429_100630637 Ga0075429_1006306372 218
355 3300006914 Ga0075436_100103286 Ga0075436_1001032862 218
356 3300006946 Ga0079104_1010200 Ga0079104_10102004 218
357 3300007076 Ga0075435_100014083 Ga0075435_1000140837 218
358 3300007076 Ga0075435_100016145 Ga0075435_1000161453 218
359 3300007076 Ga0075435_100471357 Ga0075435_1004713572 218
360 3300009094 Ga0111539_10003941 Ga0111539_1000394115 218
361 3300009094 Ga0111539_10005060 Ga0111539_100050607 218
362 3300009098 Ga0105245_10104108 Ga0105245_101041083 218
363 3300009098 Ga0105245_10965750 Ga0105245_109657501 218
364 3300009147 Ga0114129_10007581 Ga0114129_100075812 218
365 3300009147 Ga0114129_10015887 Ga0114129_100158875 218
366 3300009147 Ga0114129_10053062 Ga0114129_100530629 218
367 3300009147 Ga0114129_10058865 Ga0114129_100588652 218
368 3300009147 Ga0114129_10103105 Ga0114129_101031052 218
369 3300009147 Ga0114129_10106382 Ga0114129_101063822 218
370 3300009147 Ga0114129_10866501 Ga0114129_108665012 218
371 3300009147 Ga0114129_10909733 Ga0114129_109097332 218
372 3300009148 Ga0105243_10048073 Ga0105243_100480732 218
373 3300009176 Ga0105242_10889866 Ga0105242_108898662 218
374 3300009177 Ga0105248_10371574 Ga0105248_103715741 218
375 3300011119 Ga0105246_10142674 Ga0105246_101426742 218
376 3300013306 Ga0163162_10590127 Ga0163162_105901272 218
377 3300014969 Ga0157376_10718302 Ga0157376_107183021 218
378 3300017792 Ga0163161_10354866 Ga0163161_103548662 218
379 3300022739 Ga0228711_1000772 Ga0228711_100077236 218
380 3300022740 Ga0228710_1000936 Ga0228710_10009362 218
381 3300025899 Ga0207642_10533097 Ga0207642_105330971 218
382 3300025907 Ga0207645_10004529 Ga0207645_100045297 218
383 3300025908 Ga0207643_10052275 Ga0207643_100522752 218
384 3300025910 Ga0207684_10013221 Ga0207684_100132216 218
385 3300025922 Ga0207646_10005923 Ga0207646_1000592312 218
386 3300025926 Ga0207659_10259307 Ga0207659_102593071 218
387 3300025931 Ga0207644_10050925 Ga0207644_100509252 218
388 3300025931 Ga0207644_10150521 Ga0207644_101505211 218
389 3300025933 Ga0207706_10140746 Ga0207706_101407462 218
390 3300025934 Ga0207686_10379113 Ga0207686_103791131 218
391 3300025935 Ga0207709_10032207 Ga0207709_100322072 218
392 3300025937 Ga0207669_10060150 Ga0207669_100601502 218
393 3300025940 Ga0207691_10003291 Ga0207691_1000329116 218
394 3300025940 Ga0207691_10114388 Ga0207691_101143881 218
395 3300025942 Ga0207689_10008403 Ga0207689_100084032 218
396 3300025942 Ga0207689_10008688 Ga0207689_100086886 218
397 3300025960 Ga0207651_10790863 Ga0207651_107908632 218
398 3300026035 Ga0207703_10865784 Ga0207703_108657842 218
399 3300026089 Ga0207648_10001548 Ga0207648_1000154816 218
400 3300026089 Ga0207648_10081826 Ga0207648_100818262 218
401 3300026116 Ga0207674_10163488 Ga0207674_101634882 218
402 3300026121 Ga0207683_10119521 Ga0207683_101195212 218
403 3300027111 Ga0209281_1000469 Ga0209281_100046939 218
404 3300027666 Ga0209282_1000038 Ga0209282_100003839 218
405 3300027907 Ga0207428_10000190 Ga0207428_1000019036 218
406 3300027907 Ga0207428_10123992 Ga0207428_101239922 218
407 3300028379 Ga0268266_10024221 Ga0268266_100242212 218
408 3300031649 Ga0307514_10071822 Ga0307514_100718222 218
409 3300031731 Ga0307405_10234159 Ga0307405_102341592 218
410 3300031731 Ga0307405_10321144 Ga0307405_103211442 218
411 3300031824 Ga0307413_10832358 Ga0307413_108323581 218
412 3300031967 Ga0315914_1000204 Ga0315914_100020455 218
413 3300031995 Ga0307409_100614810 Ga0307409_1006148102 218
414 3300031995 Ga0307409_101156641 Ga0307409_1011566411 218
415 3300032002 Ga0307416_101516103 Ga0307416_1015161031 218
416 3300032005 Ga0307411_10125618 Ga0307411_101256182 218
417 3300033430 Ga0315913_1002007 Ga0315913_10020072 218
418 3300033464 Ga0315915_1000018 Ga0315915_100001839 218
419 3300035088 Ga0373940_0030656 Ga0373940_0030656_207_863 218
420 3300035115 Ga0373941_0057428 Ga0373941_0057428_462_1118 218
421 3300035116 Ga0373945_0075509 Ga0373945_0075509_615_1271 218
422 3300035692 Ga0373935_0060295 Ga0373935_0060295_1458_2114 218
423 3300035725 Ga0373947_0195973 Ga0373947_0195973_647_1303 218
424 3300036401 Ga0373937_0012966 Ga0373937_0012966_2040_2696 218
425 3300037068 Ga0373925_0107474 Ga0373925_0107474_1353_2009 218
426 3300038996 Ga0242420_016693 Ga0242420_016693_532_1197 218
427 3300042461 Ga0439460_0092056 Ga0439460_0092056_135_791 218
428 3300042876 Ga0451577_0003647 Ga0451577_0003647_1204_1869 218
429 3300042876 Ga0451577_0036675 Ga0451577_0036675_1470_2126 218
430 3300044673 Ga0453683_0015247 Ga0453683_0015247_1663_2328 218
431 3300044712 Ga0453684_0009883 Ga0453684_0009883_10622_11287 218
432 3300045051 Ga0451576_0007779 Ga0451576_0007779_10626_11291 218
433 3300045051 Ga0451576_0423849 Ga0451576_0423849_187_843 218
434 3300046454 Ga0495592_0000404 Ga0495592_0000404_30088_30744 218
435 3300046459 Ga0495629_0065105 Ga0495629_0065105_171_827 218
436 3300046683 Ga0495658_0017250 Ga0495658_0017250_1661_2317 218
437 3300046689 Ga0495613_0036147 Ga0495613_0036147_1696_2352 218
438 3300047318 Ga0495636_0152968 Ga0495636_0152968_187_843 218
439 3300047471 Ga0495684_0072723 Ga0495684_0072723_742_1398 218
440 3300049574 Ga0501038_0191780 Ga0501038_0191780_239_895 218
441 3300049575 Ga0501039_0247478 Ga0501039_0247478_26_682 218
442 3300049576 Ga0501040_0034862 Ga0501040_0034862_1068_1787 218
443 3300049576 Ga0501040_0066597 Ga0501040_0066597_1659_2315 218
444 3300049576 Ga0501040_0073753 Ga0501040_0073753_895_1551 218
445 3300049577 Ga0501041_0036689 Ga0501041_0036689_1875_2594 218
446 3300049577 Ga0501041_0103789 Ga0501041_0103789_382_1038 218
447 3300049578 Ga0501042_0057714 Ga0501042_0057714_506_1225 218
448 3300049578 Ga0501042_0198713 Ga0501042_0198713_58_714 218
449 3300049579 Ga0501043_0171110 Ga0501043_0171110_136_855 218
450 3300049584 Ga0501068_0365313 Ga0501068_0365313_72_791 218
451 3300049585 Ga0501069_0061800 Ga0501069_0061800_783_1439 218
452 3300049587 Ga0501071_0186653 Ga0501071_0186653_252_908 218
453 3300049587 Ga0501071_0217587 Ga0501071_0217587_686_1342 218
454 3300049588 Ga0501072_0014173 Ga0501072_0014173_4913_5569 218
455 3300049590 Ga0501074_0077242 Ga0501074_0077242_1623_2279 218
456 3300049591 Ga0501075_0010075 Ga0501075_0010075_5688_6407 218
457 3300049592 Ga0501076_0047682 Ga0501076_0047682_1602_2321 218
458 3300049592 Ga0501076_0098529 Ga0501076_0098529_1526_2182 218
459 3300049592 Ga0501076_0260858 Ga0501076_0260858_162_818 218
460 3300049593 Ga0501077_0012674 Ga0501077_0012674_3007_3726 218
461 3300049593 Ga0501077_0185993 Ga0501077_0185993_50_706 218
462 3300049593 Ga0501077_0277961 Ga0501077_0277961_53_709 218
463 3300049741 Ga0501079_0018901 Ga0501079_0018901_126_782 218
464 3300049741 Ga0501079_0030236 Ga0501079_0030236_1678_2397 218
465 3300049741 Ga0501079_0675431 Ga0501079_0675431_78_734 218
466 3300049742 Ga0501080_0019290 Ga0501080_0019290_365_1084 218
467 3300049743 Ga0501081_0008099 Ga0501081_0008099_2002_2721 218
468 3300049743 Ga0501081_0018852 Ga0501081_0018852_2450_3106 218
469 3300049743 Ga0501081_0046986 Ga0501081_0046986_1569_2225 218
470 3300049823 Ga0501044_0068764 Ga0501044_0068764_2384_3043 218
471 3300049824 Ga0501045_0058299 Ga0501045_0058299_1653_2372 218
472 3300050507 nmdc:mga05p37_15550_c1 nmdc:mga05p37_15550_c1_3134_3793 218
473 3300050507 nmdc:mga05p37_413905_c1 nmdc:mga05p37_413905_c1_66_722 218
474 3300050507 nmdc:mga05p37_541260_c1 nmdc:mga05p37_541260_c1_455_1111 218
475 3300050507 nmdc:mga05p37_648305_c1 nmdc:mga05p37_648305_c1_232_897 218
476 3300050507 nmdc:mga05p37_90029_c1 nmdc:mga05p37_90029_c1_1600_2256 218
477 3300050508 nmdc:mga09592_13093_c1 nmdc:mga09592_13093_c1_5852_6508 218
478 3300050508 nmdc:mga09592_205965_c1 nmdc:mga09592_205965_c1_856_1512 218
479 3300050508 nmdc:mga09592_389953_c1 nmdc:mga09592_389953_c1_168_824 218
480 3300050508 nmdc:mga09592_575873_c1 nmdc:mga09592_575873_c1_81_737 218
481 3300050509 nmdc:mga0qj67_11850_c1 nmdc:mga0qj67_11850_c1_2232_2888 218
482 3300050509 nmdc:mga0qj67_473634_c1 nmdc:mga0qj67_473634_c1_234_890 218
483 3300050510 nmdc:mga06r32_101495_c1 nmdc:mga06r32_101495_c1_2108_2764 218
484 3300050510 nmdc:mga06r32_169993_c1 nmdc:mga06r32_169993_c1_1205_1861 218
485 3300050510 nmdc:mga06r32_695493_c1 nmdc:mga06r32_695493_c1_195_851 218
486 3300050510 nmdc:mga06r32_815918_c1 nmdc:mga06r32_815918_c1_162_818 218
487 3300050510 nmdc:mga06r32_88857_c1 nmdc:mga06r32_88857_c1_1090_1746 218
488 3300050511 nmdc:mga08y16_1951_c1 nmdc:mga08y16_1951_c1_15678_16334 218
489 3300050511 nmdc:mga08y16_1952_c1 nmdc:mga08y16_1952_c1_1600_2265 218
490 3300050511 nmdc:mga08y16_285618_c1 nmdc:mga08y16_285618_c1_487_1170 218
491 3300050511 nmdc:mga08y16_53865_c1 nmdc:mga08y16_53865_c1_2894_3550 218
492 3300050512 nmdc:mga0n895_184911_c1 nmdc:mga0n895_184911_c1_562_1218 218
493 3300050512 nmdc:mga0n895_9928_c1 nmdc:mga0n895_9928_c1_3111_3776 218
494 3300050513 nmdc:mga0rr50_54408_c1 nmdc:mga0rr50_54408_c1_1568_2224 218
495 3300050514 nmdc:mga08x19_14859_c1 nmdc:mga08x19_14859_c1_575_1231 218
496 3300050515 nmdc:mga0a205_103790_c2 nmdc:mga0a205_103790_c2_191_850 218
497 3300050515 nmdc:mga0a205_139966_c1 nmdc:mga0a205_139966_c1_1595_2251 218
498 3300050515 nmdc:mga0a205_2135_c1 nmdc:mga0a205_2135_c1_1242_1907 218
499 3300053078 Ga0495612_0054004 Ga0495612_0054004_381_1037 218
500 3300053084 Ga0495595_0049813 Ga0495595_0049813_616_1272 218
501 3300053085 Ga0495619_0031297 Ga0495619_0031297_2662_3318 218
502 3300054114 Ga0501084_0001636 Ga0501084_0001636_2132_2851 218
503 3300054114 Ga0501084_0039097 Ga0501084_0039097_1881_2537 218
504 3300054114 Ga0501084_0575689 Ga0501084_0575689_113_769 218
505 3300060353 Ga0501082_0014328 Ga0501082_0014328_2263_2982 218
506 3300060353 Ga0501082_0028956 Ga0501082_0028956_2248_2904 218
507 3300060353 Ga0501082_0520201 Ga0501082_0520201_192_848 218
508 3300061734 Ga0530510_0241670 Ga0530510_0241670_151_807 218
509 3300005295 Ga0065707_10160728 Ga0065707_101607282 219
510 3300005440 Ga0070705_100003105 Ga0070705_1000031052 219
511 3300005440 Ga0070705_100210021 Ga0070705_1002100212 219
512 3300005445 Ga0070708_100621420 Ga0070708_1006214202 219
513 3300005459 Ga0068867_100304422 Ga0068867_1003044222 219
514 3300005467 Ga0070706_100261907 Ga0070706_1002619072 219
515 3300005471 Ga0070698_100028305 Ga0070698_1000283053 219
516 3300005518 Ga0070699_100119424 Ga0070699_1001194242 219
517 3300005536 Ga0070697_100029267 Ga0070697_1000292675 219
518 3300005549 Ga0070704_100270097 Ga0070704_1002700971 219
519 3300005549 Ga0070704_100565307 Ga0070704_1005653071 219
520 3300005937 Ga0081455_10000658 Ga0081455_1000065816 219
521 3300006844 Ga0075428_100002400 Ga0075428_10000240014 219
522 3300006844 Ga0075428_100046664 Ga0075428_1000466644 219
523 3300006844 Ga0075428_100068421 Ga0075428_1000684214 219
524 3300006844 Ga0075428_100427415 Ga0075428_1004274152 219
525 3300006846 Ga0075430_100000047 Ga0075430_10000004754 219
526 3300006846 Ga0075430_100007006 Ga0075430_1000070065 219
527 3300006847 Ga0075431_100000424 Ga0075431_1000004242 219
528 3300006847 Ga0075431_100015317 Ga0075431_1000153174 219
529 3300006847 Ga0075431_100070429 Ga0075431_1000704294 219
530 3300006852 Ga0075433_10014955 Ga0075433_100149556 219
531 3300006852 Ga0075433_10035954 Ga0075433_100359542 219
532 3300006871 Ga0075434_100012865 Ga0075434_1000128652 219
533 3300006871 Ga0075434_100179939 Ga0075434_1001799392 219
534 3300006871 Ga0075434_100194316 Ga0075434_1001943162 219
535 3300006880 Ga0075429_100001286 Ga0075429_1000012863 219
536 3300006880 Ga0075429_100039035 Ga0075429_1000390353 219
537 3300006914 Ga0075436_100090946 Ga0075436_1000909463 219
538 3300006914 Ga0075436_100150074 Ga0075436_1001500742 219
539 3300007076 Ga0075435_100003005 Ga0075435_10000300512 219
540 3300007076 Ga0075435_100023001 Ga0075435_1000230012 219
541 3300007076 Ga0075435_100176241 Ga0075435_1001762412 219
542 3300009094 Ga0111539_10086857 Ga0111539_100868572 219
543 3300009094 Ga0111539_10932484 Ga0111539_109324842 219
544 3300009147 Ga0114129_10015402 Ga0114129_100154029 219
545 3300009147 Ga0114129_10021214 Ga0114129_100212142 219
546 3300009147 Ga0114129_10028553 Ga0114129_100285533 219
547 3300009147 Ga0114129_10091450 Ga0114129_100914503 219
548 3300009147 Ga0114129_10427062 Ga0114129_104270622 219
549 3300009147 Ga0114129_10437772 Ga0114129_104377723 219
550 3300009147 Ga0114129_11135377 Ga0114129_111353772 219
551 3300013308 Ga0157375_10878411 Ga0157375_108784111 219
552 3300014326 Ga0157380_10183447 Ga0157380_101834472 219
553 3300025910 Ga0207684_10009147 Ga0207684_100091472 219
554 3300025910 Ga0207684_10019719 Ga0207684_100197192 219
555 3300025910 Ga0207684_10337852 Ga0207684_103378522 219
556 3300025922 Ga0207646_10084261 Ga0207646_100842612 219
557 3300028380 Ga0268265_10019740 Ga0268265_100197402 219
558 3300035084 Ga0373928_0029632 Ga0373928_0029632_301_960 219
559 3300035241 Ga0373961_0045743 Ga0373961_0045743_573_1232 219
560 3300035691 Ga0373931_0001354 Ga0373931_0001354_8512_9171 219
561 3300041413 Ga0439465_0121468 Ga0439465_0121468_120_788 219
562 3300046472 Ga0495580_0002613 Ga0495580_0002613_8544_9203 219
563 3300046615 Ga0495656_0029405 Ga0495656_0029405_1040_1699 219
564 3300048907 Ga0496104_0683619 Ga0496104_0683619_189_848 219
565 3300049573 Ga0501037_0278955 Ga0501037_0278955_287_946 219
566 3300049575 Ga0501039_0091285 Ga0501039_0091285_1035_1694 219
567 3300049576 Ga0501040_0100466 Ga0501040_0100466_855_1514 219
568 3300049587 Ga0501071_0084330 Ga0501071_0084330_332_991 219
569 3300049588 Ga0501072_0023866 Ga0501072_0023866_3272_3931 219
570 3300049591 Ga0501075_0110770 Ga0501075_0110770_1126_1785 219
571 3300049592 Ga0501076_0006637 Ga0501076_0006637_2207_2866 219
572 3300049592 Ga0501076_0096780 Ga0501076_0096780_1605_2270 219
573 3300049592 Ga0501076_0442302 Ga0501076_0442302_28_687 219
574 3300049741 Ga0501079_0086957 Ga0501079_0086957_963_1622 219
575 3300049742 Ga0501080_0362419 Ga0501080_0362419_632_1291 219
576 3300049743 Ga0501081_0311522 Ga0501081_0311522_53_868 219
577 3300050507 nmdc:mga05p37_101116_c1 nmdc:mga05p37_101116_c1_1688_2347 219
578 3300050507 nmdc:mga05p37_13970_c1 nmdc:mga05p37_13970_c1_4928_5587 219
579 3300050507 nmdc:mga05p37_15394_c1 nmdc:mga05p37_15394_c1_2448_3107 219
580 3300050507 nmdc:mga05p37_714690_c1 nmdc:mga05p37_714690_c1_199_858 219
581 3300050507 nmdc:mga05p37_725372_c1 nmdc:mga05p37_725372_c1_283_942 219
582 3300050508 nmdc:mga09592_16549_c1 nmdc:mga09592_16549_c1_2971_3630 219
583 3300050508 nmdc:mga09592_511_c1 nmdc:mga09592_511_c1_17812_18471 219
584 3300050509 nmdc:mga0qj67_203_c1 nmdc:mga0qj67_203_c1_22869_23528 219
585 3300050509 nmdc:mga0qj67_747_c1 nmdc:mga0qj67_747_c1_2743_3402 219
586 3300050510 nmdc:mga06r32_26305_c1 nmdc:mga06r32_26305_c1_678_1337 219
587 3300050510 nmdc:mga06r32_269518_c1 nmdc:mga06r32_269518_c1_697_1356 219
588 3300050510 nmdc:mga06r32_3064_c1 nmdc:mga06r32_3064_c1_2068_2727 219
589 3300050511 nmdc:mga08y16_35481_c1 nmdc:mga08y16_35481_c1_1087_1746 219
590 3300050512 nmdc:mga0n895_321580_c1 nmdc:mga0n895_321580_c1_602_1261 219
591 3300050512 nmdc:mga0n895_469395_c1 nmdc:mga0n895_469395_c1_363_1022 219
592 3300050512 nmdc:mga0n895_52345_c1 nmdc:mga0n895_52345_c1_1127_1786 219
593 3300050512 nmdc:mga0n895_62932_c1 nmdc:mga0n895_62932_c1_1608_2267 219
594 3300050513 nmdc:mga0rr50_192338_c1 nmdc:mga0rr50_192338_c1_966_1625 219
595 3300050513 nmdc:mga0rr50_20450_c1 nmdc:mga0rr50_20450_c1_3295_3954 219
596 3300050513 nmdc:mga0rr50_33438_c1 nmdc:mga0rr50_33438_c1_2667_3326 219
597 3300050513 nmdc:mga0rr50_68667_c1 nmdc:mga0rr50_68667_c1_1597_2256 219
598 3300050514 nmdc:mga08x19_29708_c1 nmdc:mga08x19_29708_c1_1343_2002 219
599 3300050514 nmdc:mga08x19_41223_c1 nmdc:mga08x19_41223_c1_244_903 219
600 3300050515 nmdc:mga0a205_19486_c1 nmdc:mga0a205_19486_c1_2554_3213 219
601 3300050515 nmdc:mga0a205_21654_c1 nmdc:mga0a205_21654_c1_4154_4813 219
602 3300050515 nmdc:mga0a205_34641_c1 nmdc:mga0a205_34641_c1_3440_4099 219
603 3300050515 nmdc:mga0a205_64330_c2 nmdc:mga0a205_64330_c2_244_903 219
604 3300053730 Ga0500645_001329 Ga0500645_001329_4099_4770 219
605 3300054114 Ga0501084_0234988 Ga0501084_0234988_192_851 219
606 3300060353 Ga0501082_0463987 Ga0501082_0463987_96_761 219
607 3300061734 Ga0530510_0097460 Ga0530510_0097460_1425_2090 219
608 3300061734 Ga0530510_0244730 Ga0530510_0244730_454_1113 219
609 3300002987 JGI25159J45721_1017318 JGI25159J45721_10173181 220
610 3300003784 Ga0055534_1001421 Ga0055534_10014219 220
611 3300025291 Ga0209675_1010530 Ga0209675_10105302 220
612 3300025292 Ga0209676_1007736 Ga0209676_10077365 220
613 3300025294 Ga0209025_1038293 Ga0209025_10382932 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

12

188

0.95

PF08534

Redoxin

Redoxin

11

131

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.8471 11 220
1st9-assembly2.cif.gz_B crystal structure of a soluble domain of resa in the oxidised form 0.8458 15 217
2h1b-assembly2.cif.gz_B resa e80q 0.8401 14 217
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.8371 11 220
2h19-assembly2.cif.gz_B crystal structure of resa cys77ala variant 0.8365 15 217
ID Description Score Start End Superfamily
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8744 11 191 3.40.30.10
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8426 9 220 3.40.30.10
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8373 9 220 3.40.30.10
af_I1MS47_66_213_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8317 11 220 3.40.30.10
af_Q559T9_1_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8315 11 220 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A529IE62-F1-model_v4 AhpC/TSA family protein 0.9586 10 118 GO:0016209
GO:0016491
AF-A0A529GK77-F1-model_v4 AhpC/TSA family protein 0.9173 10 180 GO:0016209
GO:0016491
AF-A0A2Z3G7S6-F1-model_v4 deleted 0.9105 31 217
AF-A0A523TGT1-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9101 11 114 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A554IUS4-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9046 14 114 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Feature Viewer

pLDDT pTM Quality
93.97 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map