F469309
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 613 | 280 | 611 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300049592|Ga0501076_0424471|Ga0501076_0424471_300_953 |
| Length | 217 |
| Sequence | MALIESRPPVAPGERAPEFTLPAIDRPESVSLADYRGRSALFLALFIGLWCPFCRRAIAQMSKIESSLKAAGVETLGVVATTPENARLYFKFRPTRLRLASDPELSTHRAYGLPKPELTPEFMQAMDTVRVNPFGEFAAPLTITEAARTMAAQDGYVENETDKAELDRQFPQLKGQFLIDRDGIVRWANIECAEGVAAVGKFPSEQEILAAARALPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 113 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 114 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 169 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 170 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 176 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 177 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 186 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 187 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 188 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 189 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 211 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 212 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 213 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 214 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 215 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 216 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 217 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 218 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 219 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 278 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.18 |
| Metatranscriptomes | 0.49 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.14 |
| Nodule | 1.47 |
| Rhizoplane | 1.31 |
| Rhizosphere | 94.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1017318 | 3300002987 | Bacteria | 1494 |
| 2 | Ga0055534_1001421 | 3300003784 | Bacteria | 9525 |
| 3 | Ga0065715_10155528 | 3300005293 | Bacteria | 1681 |
| 4 | Ga0065707_10160728 | 3300005295 | Bacteria | 1566 |
| 5 | Ga0070676_10002814 | 3300005328 | Bacteria | 8993 |
| 6 | Ga0070676_10019968 | 3300005328 | Bacteria | 3733 |
| 7 | Ga0070683_100131652 | 3300005329 | Bacteria | 2367 |
| 8 | Ga0070683_100158723 | 3300005329 | Bacteria | 2145 |
| 9 | Ga0070690_100034427 | 3300005330 | Bacteria | 3174 |
| 10 | Ga0068869_100000228 | 3300005334 | Bacteria | 29468 |
| 11 | Ga0068869_100037255 | 3300005334 | Bacteria | 3458 |
| 12 | Ga0070680_100001225 | 3300005336 | Bacteria | 18474 |
| 13 | Ga0070680_100394844 | 3300005336 | Bacteria | 1179 |
| 14 | Ga0070680_100694006 | 3300005336 | Bacteria | 876 |
| 15 | Ga0070682_100001200 | 3300005337 | Bacteria | 14755 |
| 16 | Ga0068868_100147977 | 3300005338 | Bacteria | 1932 |
| 17 | Ga0068868_100702049 | 3300005338 | Unclassified | 905 |
| 18 | Ga0070660_100000281 | 3300005339 | Bacteria | 33896 |
| 19 | Ga0070689_100016424 | 3300005340 | Bacteria | 5417 |
| 20 | Ga0070691_10029628 | 3300005341 | Bacteria | 2562 |
| 21 | Ga0070687_100032253 | 3300005343 | Bacteria | 2576 |
| 22 | Ga0070661_100015722 | 3300005344 | Bacteria | 5341 |
| 23 | Ga0070661_100126336 | 3300005344 | Bacteria | 1919 |
| 24 | Ga0070692_10002011 | 3300005345 | Bacteria | 7717 |
| 25 | Ga0070669_100550291 | 3300005353 | Bacteria | 962 |
| 26 | Ga0070671_100254429 | 3300005355 | Bacteria | 1492 |
| 27 | Ga0070671_100358633 | 3300005355 | Bacteria | 1245 |
| 28 | Ga0070674_100098794 | 3300005356 | Unclassified | 2122 |
| 29 | Ga0070673_100119857 | 3300005364 | Bacteria | 2193 |
| 30 | Ga0070659_100041894 | 3300005366 | Bacteria | 3580 |
| 31 | Ga0070667_100181142 | 3300005367 | Bacteria | 1863 |
| 32 | Ga0070667_100490120 | 3300005367 | Bacteria | 1126 |
| 33 | Ga0070703_10000633 | 3300005406 | Bacteria | 12378 |
| 34 | Ga0070703_10004012 | 3300005406 | Bacteria | 4161 |
| 35 | Ga0070703_10016100 | 3300005406 | Bacteria | 2143 |
| 36 | Ga0070709_10066103 | 3300005434 | Bacteria | 2318 |
| 37 | Ga0070713_100450987 | 3300005436 | Unclassified | 1208 |
| 38 | Ga0070701_10201675 | 3300005438 | Bacteria | 1176 |
| 39 | Ga0070705_100000209 | 3300005440 | Bacteria | 34614 |
| 40 | Ga0070705_100003105 | 3300005440 | Bacteria | 8169 |
| 41 | Ga0070705_100071605 | 3300005440 | Unclassified | 2097 |
| 42 | Ga0070705_100210021 | 3300005440 | Bacteria | 1341 |
| 43 | Ga0070694_100001135 | 3300005444 | Bacteria | 15257 |
| 44 | Ga0070694_100016158 | 3300005444 | Bacteria | 4697 |
| 45 | Ga0070694_100273488 | 3300005444 | Bacteria | 1285 |
| 46 | Ga0070708_100033393 | 3300005445 | Bacteria | 4470 |
| 47 | Ga0070708_100193769 | 3300005445 | Bacteria | 1901 |
| 48 | Ga0070708_100621420 | 3300005445 | Bacteria | 1018 |
| 49 | Ga0070663_100069022 | 3300005455 | Bacteria | 2567 |
| 50 | Ga0070663_100577038 | 3300005455 | Bacteria | 943 |
| 51 | Ga0070678_100921559 | 3300005456 | Bacteria | 800 |
| 52 | Ga0070662_100023687 | 3300005457 | Bacteria | 4220 |
| 53 | Ga0070662_100058269 | 3300005457 | Bacteria | 2810 |
| 54 | Ga0070662_100202847 | 3300005457 | Bacteria | 1574 |
| 55 | Ga0070662_100883675 | 3300005457 | Unclassified | 762 |
| 56 | Ga0070681_10054874 | 3300005458 | Bacteria | 3970 |
| 57 | Ga0070681_10349207 | 3300005458 | Bacteria | 1389 |
| 58 | Ga0068867_100001387 | 3300005459 | Bacteria | 16747 |
| 59 | Ga0068867_100002339 | 3300005459 | Bacteria | 13345 |
| 60 | Ga0068867_100086876 | 3300005459 | Bacteria | 2367 |
| 61 | Ga0068867_100304422 | 3300005459 | Bacteria | 1315 |
| 62 | Ga0068867_100592378 | 3300005459 | Unclassified | 966 |
| 63 | Ga0068867_100823125 | 3300005459 | Bacteria | 830 |
| 64 | Ga0070706_100060610 | 3300005467 | Bacteria | 3493 |
| 65 | Ga0070706_100261907 | 3300005467 | Bacteria | 1614 |
| 66 | Ga0070706_100454084 | 3300005467 | Unclassified | 1192 |
| 67 | Ga0070707_100117335 | 3300005468 | Bacteria | 2583 |
| 68 | Ga0070707_100420162 | 3300005468 | Bacteria | 1297 |
| 69 | Ga0070698_100007922 | 3300005471 | Bacteria | 11497 |
| 70 | Ga0070698_100028305 | 3300005471 | Bacteria | 5822 |
| 71 | Ga0070698_100071818 | 3300005471 | Bacteria | 3470 |
| 72 | Ga0070698_100295623 | 3300005471 | Bacteria | 1550 |
| 73 | Ga0070698_100603497 | 3300005471 | Bacteria | 1038 |
| 74 | Ga0070698_100787044 | 3300005471 | Bacteria | 895 |
| 75 | Ga0070699_100119424 | 3300005518 | Bacteria | 2317 |
| 76 | Ga0070699_100123238 | 3300005518 | Bacteria | 2280 |
| 77 | Ga0070699_100503395 | 3300005518 | Bacteria | 1100 |
| 78 | Ga0070679_100000384 | 3300005530 | Bacteria | 37636 |
| 79 | Ga0070684_100012681 | 3300005535 | Bacteria | 6762 |
| 80 | Ga0070697_100029267 | 3300005536 | Bacteria | 4414 |
| 81 | Ga0070697_100043485 | 3300005536 | Bacteria | 3638 |
| 82 | Ga0070697_100296124 | 3300005536 | Bacteria | 1390 |
| 83 | Ga0068853_100005645 | 3300005539 | Bacteria | 9832 |
| 84 | Ga0068853_100339222 | 3300005539 | Bacteria | 1396 |
| 85 | Ga0070672_100007475 | 3300005543 | Bacteria | 7417 |
| 86 | Ga0070672_100078247 | 3300005543 | Bacteria | 2646 |
| 87 | Ga0070695_100006033 | 3300005545 | Bacteria | 7155 |
| 88 | Ga0070695_100011071 | 3300005545 | Bacteria | 5391 |
| 89 | Ga0070695_100409901 | 3300005545 | Bacteria | 1029 |
| 90 | Ga0070696_100000432 | 3300005546 | Bacteria | 26336 |
| 91 | Ga0070696_100005303 | 3300005546 | Bacteria | 8594 |
| 92 | Ga0070693_100000049 | 3300005547 | Bacteria | 45536 |
| 93 | Ga0070665_100005547 | 3300005548 | Bacteria | 12974 |
| 94 | Ga0070665_100390171 | 3300005548 | Bacteria | 1400 |
| 95 | Ga0070704_100000798 | 3300005549 | Bacteria | 15591 |
| 96 | Ga0070704_100084926 | 3300005549 | Unclassified | 2341 |
| 97 | Ga0070704_100270097 | 3300005549 | Unclassified | 1405 |
| 98 | Ga0070704_100565307 | 3300005549 | Unclassified | 995 |
| 99 | Ga0070704_100848971 | 3300005549 | Unclassified | 818 |
| 100 | Ga0068855_100006053 | 3300005563 | Bacteria | 14753 |
| 101 | Ga0068855_100174475 | 3300005563 | Bacteria | 2433 |
| 102 | Ga0070664_100028901 | 3300005564 | Bacteria | 4617 |
| 103 | Ga0068857_100008279 | 3300005577 | Bacteria | 8985 |
| 104 | Ga0068857_100014260 | 3300005577 | Bacteria | 6924 |
| 105 | Ga0068857_100155337 | 3300005577 | Unclassified | 2074 |
| 106 | Ga0068857_101063994 | 3300005577 | Bacteria | 780 |
| 107 | Ga0068854_100053986 | 3300005578 | Bacteria | 2888 |
| 108 | Ga0068856_100002309 | 3300005614 | Bacteria | 19640 |
| 109 | Ga0068856_100005140 | 3300005614 | Bacteria | 12921 |
| 110 | Ga0070702_100505498 | 3300005615 | Bacteria | 888 |
| 111 | Ga0068852_100069153 | 3300005616 | Bacteria | 3093 |
| 112 | Ga0068852_100532752 | 3300005616 | Bacteria | 1173 |
| 113 | Ga0068859_100028623 | 3300005617 | Bacteria | 5587 |
| 114 | Ga0068859_100765546 | 3300005617 | Bacteria | 1054 |
| 115 | Ga0068864_100010526 | 3300005618 | Bacteria | 7643 |
| 116 | Ga0068864_100072247 | 3300005618 | Bacteria | 3006 |
| 117 | Ga0068861_100045224 | 3300005719 | Bacteria | 3314 |
| 118 | Ga0068861_100085740 | 3300005719 | Bacteria | 2474 |
| 119 | Ga0068870_10000058 | 3300005840 | Bacteria | 35575 |
| 120 | Ga0068870_10081427 | 3300005840 | Bacteria | 1791 |
| 121 | Ga0068870_10203432 | 3300005840 | Bacteria | 1202 |
| 122 | Ga0068863_100012852 | 3300005841 | Bacteria | 8074 |
| 123 | Ga0068863_100692235 | 3300005841 | Bacteria | 1013 |
| 124 | Ga0068858_100029779 | 3300005842 | Bacteria | 5071 |
| 125 | Ga0068858_100233404 | 3300005842 | Bacteria | 1744 |
| 126 | Ga0068860_100007602 | 3300005843 | Bacteria | 10846 |
| 127 | Ga0068862_100002587 | 3300005844 | Bacteria | 15978 |
| 128 | Ga0068862_100025663 | 3300005844 | Bacteria | 4948 |
| 129 | Ga0068862_100064953 | 3300005844 | Bacteria | 3142 |
| 130 | Ga0068862_101217674 | 3300005844 | Unclassified | 752 |
| 131 | Ga0081455_10000658 | 3300005937 | Bacteria | 44747 |
| 132 | Ga0081455_10506455 | 3300005937 | Unclassified | 809 |
| 133 | Ga0081540_1037400 | 3300005983 | Bacteria | 2574 |
| 134 | Ga0070716_100012162 | 3300006173 | Bacteria | 4355 |
| 135 | Ga0070712_100437454 | 3300006175 | Bacteria | 1087 |
| 136 | Ga0075362_10053809 | 3300006177 | Bacteria | 1808 |
| 137 | Ga0068871_100457295 | 3300006358 | Bacteria | 1145 |
| 138 | Ga0075428_100002400 | 3300006844 | Bacteria | 20345 |
| 139 | Ga0075428_100009400 | 3300006844 | Bacteria | 10845 |
| 140 | Ga0075428_100029033 | 3300006844 | Bacteria | 6120 |
| 141 | Ga0075428_100042157 | 3300006844 | Bacteria | 5020 |
| 142 | Ga0075428_100046664 | 3300006844 | Bacteria | 4758 |
| 143 | Ga0075428_100068421 | 3300006844 | Bacteria | 3884 |
| 144 | Ga0075428_100119345 | 3300006844 | Bacteria | 2872 |
| 145 | Ga0075428_100427415 | 3300006844 | Bacteria | 1419 |
| 146 | Ga0075428_100567287 | 3300006844 | Unclassified | 1213 |
| 147 | Ga0075428_100966407 | 3300006844 | Unclassified | 902 |
| 148 | Ga0075430_100000047 | 3300006846 | Bacteria | 63972 |
| 149 | Ga0075430_100005950 | 3300006846 | Bacteria | 10302 |
| 150 | Ga0075430_100007006 | 3300006846 | Bacteria | 9502 |
| 151 | Ga0075430_100029165 | 3300006846 | Bacteria | 4683 |
| 152 | Ga0075430_100196082 | 3300006846 | Bacteria | 1678 |
| 153 | Ga0075430_100342881 | 3300006846 | Unclassified | 1234 |
| 154 | Ga0075430_100412242 | 3300006846 | Bacteria | 1115 |
| 155 | Ga0075431_100000424 | 3300006847 | Bacteria | 34431 |
| 156 | Ga0075431_100015317 | 3300006847 | Bacteria | 7770 |
| 157 | Ga0075431_100015506 | 3300006847 | Bacteria | 7722 |
| 158 | Ga0075431_100070429 | 3300006847 | Bacteria | 3609 |
| 159 | Ga0075431_100080770 | 3300006847 | Bacteria | 3357 |
| 160 | Ga0075431_100081470 | 3300006847 | Plasmid | 3342 |
| 161 | Ga0075431_100098604 | 3300006847 | Bacteria | 3017 |
| 162 | Ga0075431_100172556 | 3300006847 | Bacteria | 2222 |
| 163 | Ga0075431_100218449 | 3300006847 | Bacteria | 1945 |
| 164 | Ga0075431_100331688 | 3300006847 | Unclassified | 1532 |
| 165 | Ga0075433_10000715 | 3300006852 | Bacteria | 22715 |
| 166 | Ga0075433_10014955 | 3300006852 | Bacteria | 6353 |
| 167 | Ga0075433_10035954 | 3300006852 | Bacteria | 4263 |
| 168 | Ga0075433_10052169 | 3300006852 | Bacteria | 3563 |
| 169 | Ga0075433_10089399 | 3300006852 | Unclassified | 2722 |
| 170 | Ga0075433_10098100 | 3300006852 | Bacteria | 2594 |
| 171 | Ga0075433_10118487 | 3300006852 | Bacteria | 2350 |
| 172 | Ga0075433_10472458 | 3300006852 | Unclassified | 1105 |
| 173 | Ga0075434_100000430 | 3300006871 | Bacteria | 31085 |
| 174 | Ga0075434_100002095 | 3300006871 | Bacteria | 17343 |
| 175 | Ga0075434_100012865 | 3300006871 | Bacteria | 7946 |
| 176 | Ga0075434_100081864 | 3300006871 | Bacteria | 3225 |
| 177 | Ga0075434_100091306 | 3300006871 | Bacteria | 3047 |
| 178 | Ga0075434_100179939 | 3300006871 | Bacteria | 2134 |
| 179 | Ga0075434_100184653 | 3300006871 | Unclassified | 2106 |
| 180 | Ga0075434_100194316 | 3300006871 | Bacteria | 2049 |
| 181 | Ga0075434_100277686 | 3300006871 | Bacteria | 1695 |
| 182 | Ga0075434_100642478 | 3300006871 | Bacteria | 1079 |
| 183 | Ga0075429_100001286 | 3300006880 | Bacteria | 20437 |
| 184 | Ga0075429_100002725 | 3300006880 | Bacteria | 14908 |
| 185 | Ga0075429_100025276 | 3300006880 | Bacteria | 5155 |
| 186 | Ga0075429_100039035 | 3300006880 | Bacteria | 4133 |
| 187 | Ga0075429_100044089 | 3300006880 | Bacteria | 3879 |
| 188 | Ga0075429_100281365 | 3300006880 | Bacteria | 1457 |
| 189 | Ga0075429_100301015 | 3300006880 | Bacteria | 1404 |
| 190 | Ga0075429_100630637 | 3300006880 | Unclassified | 939 |
| 191 | Ga0068865_100094183 | 3300006881 | Bacteria | 2179 |
| 192 | Ga0075436_100051694 | 3300006914 | Bacteria | 2835 |
| 193 | Ga0075436_100090946 | 3300006914 | Bacteria | 2121 |
| 194 | Ga0075436_100103286 | 3300006914 | Bacteria | 1986 |
| 195 | Ga0075436_100150074 | 3300006914 | Unclassified | 1640 |
| 196 | Ga0097620_100028624 | 3300006931 | Bacteria | 5587 |
| 197 | Ga0097620_100765607 | 3300006931 | Bacteria | 1054 |
| 198 | Ga0079104_1010200 | 3300006946 | Bacteria | 3112 |
| 199 | Ga0075435_100003005 | 3300007076 | Bacteria | 11352 |
| 200 | Ga0075435_100014083 | 3300007076 | Bacteria | 5965 |
| 201 | Ga0075435_100016145 | 3300007076 | Bacteria | 5625 |
| 202 | Ga0075435_100021878 | 3300007076 | Bacteria | 4928 |
| 203 | Ga0075435_100023001 | 3300007076 | Bacteria | 4813 |
| 204 | Ga0075435_100087344 | 3300007076 | Bacteria | 2569 |
| 205 | Ga0075435_100135696 | 3300007076 | Unclassified | 2061 |
| 206 | Ga0075435_100176241 | 3300007076 | Bacteria | 1805 |
| 207 | Ga0075435_100297143 | 3300007076 | Bacteria | 1381 |
| 208 | Ga0075435_100471357 | 3300007076 | Bacteria | 1084 |
| 209 | Ga0099794_10005130 | 3300007265 | Bacteria | 5225 |
| 210 | Ga0105240_10098611 | 3300009093 | Bacteria | 3558 |
| 211 | Ga0105240_10519201 | 3300009093 | Bacteria | 1322 |
| 212 | Ga0111539_10003941 | 3300009094 | Bacteria | 19514 |
| 213 | Ga0111539_10005060 | 3300009094 | Bacteria | 17122 |
| 214 | Ga0111539_10040200 | 3300009094 | Bacteria | 5631 |
| 215 | Ga0111539_10086857 | 3300009094 | Bacteria | 3675 |
| 216 | Ga0111539_10932484 | 3300009094 | Unclassified | 1010 |
| 217 | Ga0111539_10944703 | 3300009094 | Bacteria | 1002 |
| 218 | Ga0105245_10104108 | 3300009098 | Bacteria | 2631 |
| 219 | Ga0105245_10965750 | 3300009098 | Bacteria | 895 |
| 220 | Ga0114129_10007581 | 3300009147 | Bacteria | 15450 |
| 221 | Ga0114129_10015402 | 3300009147 | Bacteria | 10878 |
| 222 | Ga0114129_10015887 | 3300009147 | Bacteria | 10706 |
| 223 | Ga0114129_10021214 | 3300009147 | Bacteria | 9225 |
| 224 | Ga0114129_10025203 | 3300009147 | Bacteria | 8428 |
| 225 | Ga0114129_10028553 | 3300009147 | Bacteria | 7905 |
| 226 | Ga0114129_10053062 | 3300009147 | Bacteria | 5687 |
| 227 | Ga0114129_10058865 | 3300009147 | Bacteria | 5374 |
| 228 | Ga0114129_10070216 | 3300009147 | Bacteria | 4883 |
| 229 | Ga0114129_10081413 | 3300009147 | Bacteria | 4500 |
| 230 | Ga0114129_10091450 | 3300009147 | Bacteria | 4216 |
| 231 | Ga0114129_10103105 | 3300009147 | Bacteria | 3945 |
| 232 | Ga0114129_10106382 | 3300009147 | Bacteria | 3875 |
| 233 | Ga0114129_10163192 | 3300009147 | Bacteria | 3042 |
| 234 | Ga0114129_10200877 | 3300009147 | Bacteria | 2700 |
| 235 | Ga0114129_10427062 | 3300009147 | Bacteria | 1742 |
| 236 | Ga0114129_10437772 | 3300009147 | Bacteria | 1717 |
| 237 | Ga0114129_10866501 | 3300009147 | Archaea | 1147 |
| 238 | Ga0114129_10909733 | 3300009147 | Bacteria | 1114 |
| 239 | Ga0114129_11135377 | 3300009147 | Unclassified | 977 |
| 240 | Ga0114129_11404099 | 3300009147 | Bacteria | 861 |
| 241 | Ga0105243_10048073 | 3300009148 | Bacteria | 3361 |
| 242 | Ga0105243_10198043 | 3300009148 | Bacteria | 1760 |
| 243 | Ga0105241_10000194 | 3300009174 | Bacteria | 45709 |
| 244 | Ga0105241_10435942 | 3300009174 | Bacteria | 1156 |
| 245 | Ga0105242_10889866 | 3300009176 | Bacteria | 889 |
| 246 | Ga0105248_10079613 | 3300009177 | Bacteria | 3683 |
| 247 | Ga0105248_10371574 | 3300009177 | Bacteria | 1610 |
| 248 | Ga0105248_10696953 | 3300009177 | Unclassified | 1146 |
| 249 | Ga0105237_10514719 | 3300009545 | Bacteria | 1203 |
| 250 | Ga0105238_10375187 | 3300009551 | Bacteria | 1413 |
| 251 | Ga0105249_10274682 | 3300009553 | Unclassified | 1680 |
| 252 | Ga0105239_10158506 | 3300010375 | Bacteria | 2528 |
| 253 | Ga0105246_10018572 | 3300011119 | Bacteria | 4433 |
| 254 | Ga0105246_10142674 | 3300011119 | Bacteria | 1803 |
| 255 | Ga0105246_10345743 | 3300011119 | Bacteria | 1217 |
| 256 | Ga0157373_10000236 | 3300013100 | Bacteria | 45123 |
| 257 | Ga0157371_10177895 | 3300013102 | Bacteria | 1521 |
| 258 | Ga0157369_10032514 | 3300013105 | Bacteria | 5736 |
| 259 | Ga0157369_10111236 | 3300013105 | Bacteria | 2911 |
| 260 | Ga0157378_10596225 | 3300013297 | Bacteria | 1115 |
| 261 | Ga0163162_10590127 | 3300013306 | Bacteria | 1238 |
| 262 | Ga0157372_10004639 | 3300013307 | Bacteria | 14601 |
| 263 | Ga0157372_10177373 | 3300013307 | Bacteria | 2466 |
| 264 | Ga0157375_10119855 | 3300013308 | Bacteria | 2739 |
| 265 | Ga0157375_10647796 | 3300013308 | Unclassified | 1213 |
| 266 | Ga0157375_10878411 | 3300013308 | Bacteria | 1042 |
| 267 | Ga0163163_10181122 | 3300014325 | Bacteria | 2154 |
| 268 | Ga0157380_10183447 | 3300014326 | Unclassified | 1841 |
| 269 | Ga0182008_10047391 | 3300014497 | Bacteria | 2135 |
| 270 | Ga0157376_10718302 | 3300014969 | Bacteria | 1006 |
| 271 | Ga0157376_10856638 | 3300014969 | Bacteria | 924 |
| 272 | Ga0157376_11041723 | 3300014969 | Unclassified | 842 |
| 273 | Ga0163161_10040601 | 3300017792 | Bacteria | 3343 |
| 274 | Ga0163161_10354866 | 3300017792 | Unclassified | 1166 |
| 275 | Ga0206356_10482442 | 3300020070 | Bacteria | 1243 |
| 276 | Ga0206353_10020003 | 3300020082 | Bacteria | 2246 |
| 277 | Ga0206353_10074030 | 3300020082 | Bacteria | 2501 |
| 278 | Ga0228711_1000772 | 3300022739 | Bacteria | 42689 |
| 279 | Ga0228710_1000936 | 3300022740 | Bacteria | 41455 |
| 280 | Ga0209675_1010530 | 3300025291 | Bacteria | 3147 |
| 281 | Ga0209676_1007736 | 3300025292 | Bacteria | 4957 |
| 282 | Ga0209025_1038293 | 3300025294 | Bacteria | 2112 |
| 283 | Ga0207653_10000861 | 3300025885 | Bacteria | 10125 |
| 284 | Ga0207642_10533097 | 3300025899 | Bacteria | 723 |
| 285 | Ga0207688_10100092 | 3300025901 | Bacteria | 1673 |
| 286 | Ga0207680_10299560 | 3300025903 | Bacteria | 1120 |
| 287 | Ga0207699_10009472 | 3300025906 | Bacteria | 4852 |
| 288 | Ga0207645_10004529 | 3300025907 | Bacteria | 10263 |
| 289 | Ga0207645_10005678 | 3300025907 | Bacteria | 9014 |
| 290 | Ga0207643_10000214 | 3300025908 | Bacteria | 40483 |
| 291 | Ga0207643_10052275 | 3300025908 | Bacteria | 2320 |
| 292 | Ga0207705_10153819 | 3300025909 | Bacteria | 1725 |
| 293 | Ga0207684_10004470 | 3300025910 | Bacteria | 13164 |
| 294 | Ga0207684_10009147 | 3300025910 | Bacteria | 8768 |
| 295 | Ga0207684_10013221 | 3300025910 | Bacteria | 7145 |
| 296 | Ga0207684_10019719 | 3300025910 | Bacteria | 5767 |
| 297 | Ga0207684_10120310 | 3300025910 | Bacteria | 2251 |
| 298 | Ga0207684_10337852 | 3300025910 | Bacteria | 1297 |
| 299 | Ga0207654_10018803 | 3300025911 | Bacteria | 3632 |
| 300 | Ga0207707_10000056 | 3300025912 | Bacteria | 113344 |
| 301 | Ga0207707_10180919 | 3300025912 | Bacteria | 1841 |
| 302 | Ga0207695_10112636 | 3300025913 | Bacteria | 2698 |
| 303 | Ga0207695_10676429 | 3300025913 | Unclassified | 913 |
| 304 | Ga0207660_10011192 | 3300025917 | Bacteria | 5832 |
| 305 | Ga0207660_10174147 | 3300025917 | Bacteria | 1667 |
| 306 | Ga0207660_10211873 | 3300025917 | Bacteria | 1517 |
| 307 | Ga0207662_10072950 | 3300025918 | Bacteria | 2081 |
| 308 | Ga0207657_10000306 | 3300025919 | Bacteria | 51970 |
| 309 | Ga0207649_10148978 | 3300025920 | Bacteria | 1609 |
| 310 | Ga0207649_10507969 | 3300025920 | Bacteria | 917 |
| 311 | Ga0207652_10000532 | 3300025921 | Bacteria | 38675 |
| 312 | Ga0207646_10005923 | 3300025922 | Bacteria | 12753 |
| 313 | Ga0207646_10039786 | 3300025922 | Bacteria | 4230 |
| 314 | Ga0207646_10084261 | 3300025922 | Bacteria | 2844 |
| 315 | Ga0207681_10052258 | 3300025923 | Bacteria | 2771 |
| 316 | Ga0207650_10037076 | 3300025925 | Bacteria | 3551 |
| 317 | Ga0207659_10259307 | 3300025926 | Bacteria | 1413 |
| 318 | Ga0207644_10016103 | 3300025931 | Bacteria | 5029 |
| 319 | Ga0207644_10050925 | 3300025931 | Bacteria | 2970 |
| 320 | Ga0207644_10150521 | 3300025931 | Bacteria | 1800 |
| 321 | Ga0207690_10001831 | 3300025932 | Bacteria | 13051 |
| 322 | Ga0207690_10094902 | 3300025932 | Bacteria | 2118 |
| 323 | Ga0207706_10004233 | 3300025933 | Bacteria | 13521 |
| 324 | Ga0207706_10140746 | 3300025933 | Bacteria | 2123 |
| 325 | Ga0207686_10379113 | 3300025934 | Bacteria | 1072 |
| 326 | Ga0207709_10032207 | 3300025935 | Bacteria | 3068 |
| 327 | Ga0207670_10009764 | 3300025936 | Bacteria | 5492 |
| 328 | Ga0207669_10060150 | 3300025937 | Bacteria | 2327 |
| 329 | Ga0207704_10329198 | 3300025938 | Bacteria | 1181 |
| 330 | Ga0207665_10000418 | 3300025939 | Bacteria | 29273 |
| 331 | Ga0207691_10003291 | 3300025940 | Bacteria | 15739 |
| 332 | Ga0207691_10107746 | 3300025940 | Bacteria | 2480 |
| 333 | Ga0207691_10114388 | 3300025940 | Bacteria | 2397 |
| 334 | Ga0207711_10422286 | 3300025941 | Bacteria | 1240 |
| 335 | Ga0207711_10671430 | 3300025941 | Unclassified | 967 |
| 336 | Ga0207689_10000126 | 3300025942 | Bacteria | 64343 |
| 337 | Ga0207689_10008403 | 3300025942 | Bacteria | 8989 |
| 338 | Ga0207689_10008688 | 3300025942 | Bacteria | 8838 |
| 339 | Ga0207661_10019931 | 3300025944 | Bacteria | 5006 |
| 340 | Ga0207661_10095929 | 3300025944 | Bacteria | 2481 |
| 341 | Ga0207679_10127626 | 3300025945 | Bacteria | 2035 |
| 342 | Ga0207679_10193881 | 3300025945 | Bacteria | 1691 |
| 343 | Ga0207667_10002367 | 3300025949 | Bacteria | 23612 |
| 344 | Ga0207667_10076350 | 3300025949 | Bacteria | 3477 |
| 345 | Ga0207667_10695850 | 3300025949 | Bacteria | 1019 |
| 346 | Ga0207651_10045190 | 3300025960 | Bacteria | 2952 |
| 347 | Ga0207651_10373326 | 3300025960 | Bacteria | 1207 |
| 348 | Ga0207651_10596314 | 3300025960 | Bacteria | 965 |
| 349 | Ga0207651_10790863 | 3300025960 | Bacteria | 841 |
| 350 | Ga0207712_10056020 | 3300025961 | Bacteria | 2776 |
| 351 | Ga0207640_10041543 | 3300025981 | Bacteria | 2926 |
| 352 | Ga0207658_10855682 | 3300025986 | Bacteria | 827 |
| 353 | Ga0207703_10287061 | 3300026035 | Bacteria | 1496 |
| 354 | Ga0207703_10865784 | 3300026035 | Bacteria | 864 |
| 355 | Ga0207639_10032694 | 3300026041 | Bacteria | 3831 |
| 356 | Ga0207678_10000963 | 3300026067 | Bacteria | 26320 |
| 357 | Ga0207708_10386652 | 3300026075 | Archaea | 1155 |
| 358 | Ga0207708_10448893 | 3300026075 | Bacteria | 1074 |
| 359 | Ga0207702_10006723 | 3300026078 | Bacteria | 9883 |
| 360 | Ga0207702_10015062 | 3300026078 | Bacteria | 6412 |
| 361 | Ga0207641_10112923 | 3300026088 | Bacteria | 2411 |
| 362 | Ga0207648_10001171 | 3300026089 | Bacteria | 29341 |
| 363 | Ga0207648_10001548 | 3300026089 | Bacteria | 25313 |
| 364 | Ga0207648_10081826 | 3300026089 | Bacteria | 2816 |
| 365 | Ga0207648_10342691 | 3300026089 | Bacteria | 1346 |
| 366 | Ga0207674_10000270 | 3300026116 | Bacteria | 65461 |
| 367 | Ga0207674_10163488 | 3300026116 | Bacteria | 2180 |
| 368 | Ga0207674_10241233 | 3300026116 | Unclassified | 1754 |
| 369 | Ga0207675_100040347 | 3300026118 | Bacteria | 4359 |
| 370 | Ga0207683_10119521 | 3300026121 | Bacteria | 2364 |
| 371 | Ga0207683_10318262 | 3300026121 | Bacteria | 1425 |
| 372 | Ga0207683_10828675 | 3300026121 | Bacteria | 859 |
| 373 | Ga0207698_10017913 | 3300026142 | Bacteria | 4816 |
| 374 | Ga0207698_10458727 | 3300026142 | Bacteria | 1232 |
| 375 | Ga0209281_1000469 | 3300027111 | Bacteria | 56711 |
| 376 | Ga0209282_1000038 | 3300027666 | Bacteria | 128955 |
| 377 | Ga0209588_1005306 | 3300027671 | Bacteria | 3686 |
| 378 | Ga0207428_10000190 | 3300027907 | Bacteria | 85215 |
| 379 | Ga0207428_10123992 | 3300027907 | Unclassified | 1979 |
| 380 | Ga0207428_10153688 | 3300027907 | Bacteria | 1751 |
| 381 | Ga0268266_10024221 | 3300028379 | Bacteria | 5165 |
| 382 | Ga0268266_10173486 | 3300028379 | Bacteria | 1958 |
| 383 | Ga0268265_10019740 | 3300028380 | Bacteria | 4692 |
| 384 | Ga0268264_10071383 | 3300028381 | Bacteria | 2942 |
| 385 | Ga0307509_10092103 | 3300031507 | Bacteria | 3100 |
| 386 | Ga0307509_10092932 | 3300031507 | Bacteria | 3081 |
| 387 | Ga0307509_10146991 | 3300031507 | Bacteria | 2280 |
| 388 | Ga0307508_10078432 | 3300031616 | Bacteria | 2883 |
| 389 | Ga0307508_10098024 | 3300031616 | Bacteria | 2523 |
| 390 | Ga0307514_10071822 | 3300031649 | Bacteria | 2594 |
| 391 | Ga0307405_10234159 | 3300031731 | Unclassified | 1356 |
| 392 | Ga0307405_10321144 | 3300031731 | Bacteria | 1183 |
| 393 | Ga0307413_10832358 | 3300031824 | Bacteria | 778 |
| 394 | Ga0307406_10527458 | 3300031901 | Bacteria | 962 |
| 395 | Ga0315914_1000204 | 3300031967 | Bacteria | 62058 |
| 396 | Ga0307409_100614810 | 3300031995 | Unclassified | 1076 |
| 397 | Ga0307409_101156641 | 3300031995 | Bacteria | 796 |
| 398 | Ga0307416_101516103 | 3300032002 | Bacteria | 776 |
| 399 | Ga0307411_10125618 | 3300032005 | Bacteria | 1865 |
| 400 | Ga0307510_10109517 | 3300033180 | Bacteria | 2510 |
| 401 | Ga0315913_1002007 | 3300033430 | Bacteria | 23344 |
| 402 | Ga0315915_1000018 | 3300033464 | Bacteria | 129799 |
| 403 | Ga0373950_0073010 | 3300034818 | Bacteria | 706 |
| 404 | Ga0373959_0023487 | 3300034820 | Bacteria | 1199 |
| 405 | Ga0373928_0029632 | 3300035084 | Unclassified | 1204 |
| 406 | Ga0373940_0030656 | 3300035088 | Bacteria | 1431 |
| 407 | Ga0373949_0012274 | 3300035090 | Bacteria | 1893 |
| 408 | Ga0373949_0018253 | 3300035090 | Unclassified | 1588 |
| 409 | Ga0373932_0117966 | 3300035112 | Bacteria | 882 |
| 410 | Ga0373941_0057428 | 3300035115 | Bacteria | 1256 |
| 411 | Ga0373945_0075509 | 3300035116 | Unclassified | 1283 |
| 412 | Ga0373960_0017157 | 3300035121 | Unclassified | 1872 |
| 413 | Ga0373942_0006964 | 3300035207 | Bacteria | 2612 |
| 414 | Ga0373961_0017523 | 3300035241 | Bacteria | 1859 |
| 415 | Ga0373961_0045743 | 3300035241 | Unclassified | 1281 |
| 416 | Ga0373962_0015397 | 3300035242 | Unclassified | 1960 |
| 417 | Ga0373931_0001354 | 3300035691 | Bacteria | 10487 |
| 418 | Ga0373931_0007904 | 3300035691 | Bacteria | 5031 |
| 419 | Ga0373935_0060295 | 3300035692 | Bacteria | 2427 |
| 420 | Ga0373947_0195973 | 3300035725 | Unclassified | 1320 |
| 421 | Ga0373937_0012966 | 3300036401 | Bacteria | 7341 |
| 422 | Ga0373925_0107474 | 3300037068 | Bacteria | 2152 |
| 423 | Ga0395899_0014364 | 3300037312 | Bacteria | 6045 |
| 424 | Ga0395899_0090178 | 3300037312 | Bacteria | 2223 |
| 425 | Ga0395900_0120803 | 3300037418 | Bacteria | 2688 |
| 426 | Ga0395898_0026079 | 3300037466 | Bacteria | 5884 |
| 427 | Ga0395905_0064748 | 3300037471 | Bacteria | 3422 |
| 428 | Ga0395905_0203495 | 3300037471 | Bacteria | 1856 |
| 429 | Ga0395901_0017803 | 3300038443 | Bacteria | 7250 |
| 430 | Ga0395901_0096910 | 3300038443 | Bacteria | 3091 |
| 431 | Ga0242420_016693 | 3300038996 | Bacteria | 1280 |
| 432 | Ga0439465_0121468 | 3300041413 | Bacteria | 916 |
| 433 | Ga0439448_0017428 | 3300042005 | Bacteria | 2193 |
| 434 | Ga0439449_0011605 | 3300042007 | Bacteria | 3313 |
| 435 | Ga0439458_0004322 | 3300042157 | Bacteria | 3268 |
| 436 | Ga0439444_0055918 | 3300042437 | Unclassified | 813 |
| 437 | Ga0439460_0092056 | 3300042461 | Unclassified | 965 |
| 438 | Ga0451577_0003647 | 3300042876 | Bacteria | 16886 |
| 439 | Ga0451577_0014564 | 3300042876 | Bacteria | 7329 |
| 440 | Ga0451577_0036675 | 3300042876 | Bacteria | 4413 |
| 441 | Ga0451577_0109599 | 3300042876 | Bacteria | 2469 |
| 442 | Ga0453683_0015247 | 3300044673 | Bacteria | 4981 |
| 443 | Ga0453684_0009883 | 3300044712 | Bacteria | 16494 |
| 444 | Ga0451576_0007779 | 3300045051 | Bacteria | 12719 |
| 445 | Ga0451576_0016259 | 3300045051 | Bacteria | 8217 |
| 446 | Ga0451576_0276540 | 3300045051 | Bacteria | 1755 |
| 447 | Ga0451576_0423849 | 3300045051 | Bacteria | 1396 |
| 448 | Ga0466967_0003029 | 3300045976 | Bacteria | 10782 |
| 449 | Ga0495592_0000404 | 3300046454 | Bacteria | 32909 |
| 450 | Ga0495629_0065105 | 3300046459 | Bacteria | 2544 |
| 451 | Ga0495651_0160541 | 3300046462 | Bacteria | 1611 |
| 452 | Ga0495580_0002613 | 3300046472 | Bacteria | 15639 |
| 453 | Ga0495580_0025906 | 3300046472 | Bacteria | 4281 |
| 454 | Ga0495584_0143896 | 3300046491 | Bacteria | 1211 |
| 455 | Ga0495585_0093815 | 3300046492 | Bacteria | 1614 |
| 456 | Ga0495663_0095272 | 3300046525 | Bacteria | 974 |
| 457 | Ga0495666_0066506 | 3300046526 | Bacteria | 1718 |
| 458 | Ga0495642_0144879 | 3300046528 | Bacteria | 1026 |
| 459 | Ga0495656_0001040 | 3300046615 | Bacteria | 8959 |
| 460 | Ga0495656_0029405 | 3300046615 | Bacteria | 2212 |
| 461 | Ga0495625_0065109 | 3300046660 | Bacteria | 2570 |
| 462 | Ga0495658_0017250 | 3300046683 | Bacteria | 3727 |
| 463 | Ga0495658_0058552 | 3300046683 | Bacteria | 2204 |
| 464 | Ga0495613_0036147 | 3300046689 | Unclassified | 3663 |
| 465 | Ga0495636_0152968 | 3300047318 | Bacteria | 1036 |
| 466 | Ga0495673_0044908 | 3300047469 | Bacteria | 1968 |
| 467 | Ga0495684_0072723 | 3300047471 | Bacteria | 2612 |
| 468 | Ga0495615_0003476 | 3300048090 | Bacteria | 2644 |
| 469 | Ga0496101_0191242 | 3300048904 | Bacteria | 1580 |
| 470 | Ga0496101_0667573 | 3300048904 | Bacteria | 821 |
| 471 | Ga0496104_0059381 | 3300048907 | Bacteria | 3621 |
| 472 | Ga0496104_0683619 | 3300048907 | Bacteria | 934 |
| 473 | Ga0496108_0044701 | 3300048911 | Bacteria | 3697 |
| 474 | Ga0496109_0580189 | 3300048912 | Bacteria | 1057 |
| 475 | Ga0496112_0115705 | 3300048915 | Bacteria | 2652 |
| 476 | Ga0496113_0171595 | 3300048916 | Bacteria | 1718 |
| 477 | Ga0501037_0278955 | 3300049573 | Unclassified | 1165 |
| 478 | Ga0501038_0191780 | 3300049574 | Bacteria | 1644 |
| 479 | Ga0501039_0091285 | 3300049575 | Bacteria | 2374 |
| 480 | Ga0501039_0247478 | 3300049575 | Bacteria | 1402 |
| 481 | Ga0501040_0034862 | 3300049576 | Bacteria | 3410 |
| 482 | Ga0501040_0066597 | 3300049576 | Bacteria | 2482 |
| 483 | Ga0501040_0073753 | 3300049576 | Bacteria | 2359 |
| 484 | Ga0501040_0100466 | 3300049576 | Bacteria | 2017 |
| 485 | Ga0501041_0036689 | 3300049577 | Bacteria | 2969 |
| 486 | Ga0501041_0103789 | 3300049577 | Bacteria | 1761 |
| 487 | Ga0501042_0057714 | 3300049578 | Bacteria | 2770 |
| 488 | Ga0501042_0198713 | 3300049578 | Unclassified | 1446 |
| 489 | Ga0501043_0171110 | 3300049579 | Bacteria | 1695 |
| 490 | Ga0501068_0365313 | 3300049584 | Bacteria | 928 |
| 491 | Ga0501069_0061800 | 3300049585 | Bacteria | 2092 |
| 492 | Ga0501071_0084330 | 3300049587 | Bacteria | 2329 |
| 493 | Ga0501071_0186653 | 3300049587 | Bacteria | 1554 |
| 494 | Ga0501071_0217587 | 3300049587 | Bacteria | 1437 |
| 495 | Ga0501072_0014173 | 3300049588 | Bacteria | 6109 |
| 496 | Ga0501072_0023866 | 3300049588 | Bacteria | 4752 |
| 497 | Ga0501074_0077242 | 3300049590 | Bacteria | 2390 |
| 498 | Ga0501075_0010075 | 3300049591 | Bacteria | 6632 |
| 499 | Ga0501075_0110770 | 3300049591 | Bacteria | 2087 |
| 500 | Ga0501076_0006637 | 3300049592 | Bacteria | 8392 |
| 501 | Ga0501076_0047682 | 3300049592 | Bacteria | 3387 |
| 502 | Ga0501076_0096780 | 3300049592 | Bacteria | 2378 |
| 503 | Ga0501076_0098529 | 3300049592 | Bacteria | 2355 |
| 504 | Ga0501076_0260858 | 3300049592 | Bacteria | 1419 |
| 505 | Ga0501076_0424471 | 3300049592 | Bacteria | 1094 |
| 506 | Ga0501076_0442302 | 3300049592 | Unclassified | 1070 |
| 507 | Ga0501077_0012674 | 3300049593 | Bacteria | 5280 |
| 508 | Ga0501077_0185993 | 3300049593 | Bacteria | 1320 |
| 509 | Ga0501077_0277961 | 3300049593 | Bacteria | 1065 |
| 510 | Ga0501079_0018901 | 3300049741 | Bacteria | 5266 |
| 511 | Ga0501079_0030236 | 3300049741 | Bacteria | 4161 |
| 512 | Ga0501079_0086957 | 3300049741 | Bacteria | 2420 |
| 513 | Ga0501079_0675431 | 3300049741 | Unclassified | 813 |
| 514 | Ga0501080_0019290 | 3300049742 | Bacteria | 6318 |
| 515 | Ga0501080_0176508 | 3300049742 | Bacteria | 1968 |
| 516 | Ga0501080_0362419 | 3300049742 | Bacteria | 1308 |
| 517 | Ga0501081_0008099 | 3300049743 | Bacteria | 6819 |
| 518 | Ga0501081_0018852 | 3300049743 | Bacteria | 4584 |
| 519 | Ga0501081_0046986 | 3300049743 | Bacteria | 2969 |
| 520 | Ga0501081_0311522 | 3300049743 | Unclassified | 1156 |
| 521 | Ga0501044_0068764 | 3300049823 | Bacteria | 3607 |
| 522 | Ga0501045_0058299 | 3300049824 | Bacteria | 2827 |
| 523 | nmdc:mga05p37_101116_c1 | 3300050507 | Bacteria | 3551 |
| 524 | nmdc:mga05p37_13970_c1 | 3300050507 | Bacteria | 9629 |
| 525 | nmdc:mga05p37_15394_c1 | 3300050507 | Bacteria | 9188 |
| 526 | nmdc:mga05p37_15550_c1 | 3300050507 | Bacteria | 9146 |
| 527 | nmdc:mga05p37_18754_c1 | 3300050507 | Bacteria | 8360 |
| 528 | nmdc:mga05p37_189172_c1 | 3300050507 | Bacteria | 2501 |
| 529 | nmdc:mga05p37_413905_c1 | 3300050507 | Bacteria | 1571 |
| 530 | nmdc:mga05p37_49349_c1 | 3300050507 | Bacteria | 5176 |
| 531 | nmdc:mga05p37_541260_c1 | 3300050507 | Bacteria | 1328 |
| 532 | nmdc:mga05p37_599294_c1 | 3300050507 | Bacteria | 1244 |
| 533 | nmdc:mga05p37_648305_c1 | 3300050507 | Unclassified | 1183 |
| 534 | nmdc:mga05p37_714690_c1 | 3300050507 | Unclassified | 1111 |
| 535 | nmdc:mga05p37_725372_c1 | 3300050507 | Bacteria | 1100 |
| 536 | nmdc:mga05p37_90029_c1 | 3300050507 | Bacteria | 3782 |
| 537 | nmdc:mga09592_13093_c1 | 3300050508 | Bacteria | 6769 |
| 538 | nmdc:mga09592_16549_c1 | 3300050508 | Bacteria | 6034 |
| 539 | nmdc:mga09592_205965_c1 | 3300050508 | Bacteria | 1704 |
| 540 | nmdc:mga09592_389953_c1 | 3300050508 | Bacteria | 1204 |
| 541 | nmdc:mga09592_511_c1 | 3300050508 | Bacteria | 29376 |
| 542 | nmdc:mga09592_52975_c1 | 3300050508 | Bacteria | 3425 |
| 543 | nmdc:mga09592_575873_c1 | 3300050508 | Unclassified | 966 |
| 544 | nmdc:mga0qj67_11850_c1 | 3300050509 | Bacteria | 6546 |
| 545 | nmdc:mga0qj67_203_c1 | 3300050509 | Bacteria | 40147 |
| 546 | nmdc:mga0qj67_473634_c1 | 3300050509 | Unclassified | 1008 |
| 547 | nmdc:mga0qj67_747_c1 | 3300050509 | Bacteria | 22059 |
| 548 | nmdc:mga06r32_101495_c1 | 3300050510 | Bacteria | 2824 |
| 549 | nmdc:mga06r32_169993_c1 | 3300050510 | Unclassified | 2163 |
| 550 | nmdc:mga06r32_26305_c1 | 3300050510 | Bacteria | 5424 |
| 551 | nmdc:mga06r32_269518_c1 | 3300050510 | Bacteria | 1690 |
| 552 | nmdc:mga06r32_3064_c1 | 3300050510 | Bacteria | 14955 |
| 553 | nmdc:mga06r32_64807_c1 | 3300050510 | Bacteria | 3524 |
| 554 | nmdc:mga06r32_695493_c1 | 3300050510 | Unclassified | 983 |
| 555 | nmdc:mga06r32_815918_c1 | 3300050510 | Bacteria | 893 |
| 556 | nmdc:mga06r32_88857_c1 | 3300050510 | Plasmid | 3016 |
| 557 | nmdc:mga08y16_128790_c1 | 3300050511 | Unclassified | 2633 |
| 558 | nmdc:mga08y16_1951_c1 | 3300050511 | Bacteria | 21034 |
| 559 | nmdc:mga08y16_1952_c1 | 3300050511 | Bacteria | 21031 |
| 560 | nmdc:mga08y16_285618_c1 | 3300050511 | Bacteria | 1701 |
| 561 | nmdc:mga08y16_35481_c1 | 3300050511 | Bacteria | 5237 |
| 562 | nmdc:mga08y16_53865_c1 | 3300050511 | Bacteria | 4205 |
| 563 | nmdc:mga0n895_1262919_c1 | 3300050512 | Bacteria | 711 |
| 564 | nmdc:mga0n895_184911_c1 | 3300050512 | Bacteria | 2115 |
| 565 | nmdc:mga0n895_321580_c1 | 3300050512 | Bacteria | 1568 |
| 566 | nmdc:mga0n895_469395_c1 | 3300050512 | Bacteria | 1270 |
| 567 | nmdc:mga0n895_509624_c1 | 3300050512 | Bacteria | 1212 |
| 568 | nmdc:mga0n895_52345_c1 | 3300050512 | Bacteria | 4008 |
| 569 | nmdc:mga0n895_61577_c1 | 3300050512 | Bacteria | 3706 |
| 570 | nmdc:mga0n895_62932_c1 | 3300050512 | Unclassified | 3669 |
| 571 | nmdc:mga0n895_9928_c1 | 3300050512 | Bacteria | 8374 |
| 572 | nmdc:mga0rr50_16048_c1 | 3300050513 | Bacteria | 4962 |
| 573 | nmdc:mga0rr50_192338_c1 | 3300050513 | Bacteria | 1673 |
| 574 | nmdc:mga0rr50_20450_c1 | 3300050513 | Bacteria | 4497 |
| 575 | nmdc:mga0rr50_297875_c1 | 3300050513 | Bacteria | 1349 |
| 576 | nmdc:mga0rr50_299179_c1 | 3300050513 | Bacteria | 1346 |
| 577 | nmdc:mga0rr50_33438_c1 | 3300050513 | Bacteria | 3673 |
| 578 | nmdc:mga0rr50_40728_c1 | 3300050513 | Unclassified | 3379 |
| 579 | nmdc:mga0rr50_54408_c1 | 3300050513 | Bacteria | 2982 |
| 580 | nmdc:mga0rr50_68667_c1 | 3300050513 | Bacteria | 2696 |
| 581 | nmdc:mga08x19_14859_c1 | 3300050514 | Bacteria | 4728 |
| 582 | nmdc:mga08x19_29708_c1 | 3300050514 | Bacteria | 3429 |
| 583 | nmdc:mga08x19_41223_c1 | 3300050514 | Bacteria | 2940 |
| 584 | nmdc:mga08x19_4310_c1 | 3300050514 | Bacteria | 8426 |
| 585 | nmdc:mga08x19_487301_c1 | 3300050514 | Bacteria | 870 |
| 586 | nmdc:mga0a205_103790_c2 | 3300050515 | Unclassified | 1812 |
| 587 | nmdc:mga0a205_10877_c1 | 3300050515 | Bacteria | 8372 |
| 588 | nmdc:mga0a205_1214_c1 | 3300050515 | Bacteria | 21582 |
| 589 | nmdc:mga0a205_139966_c1 | 3300050515 | Bacteria | 2320 |
| 590 | nmdc:mga0a205_19486_c1 | 3300050515 | Bacteria | 6397 |
| 591 | nmdc:mga0a205_2135_c1 | 3300050515 | Bacteria | 17365 |
| 592 | nmdc:mga0a205_21654_c1 | 3300050515 | Bacteria | 6078 |
| 593 | nmdc:mga0a205_25739_c1 | 3300050515 | Bacteria | 5607 |
| 594 | nmdc:mga0a205_34641_c1 | 3300050515 | Bacteria | 4844 |
| 595 | nmdc:mga0a205_64330_c2 | 3300050515 | Bacteria | 3238 |
| 596 | Ga0495612_0054004 | 3300053078 | Unclassified | 1655 |
| 597 | Ga0495595_0049813 | 3300053084 | Unclassified | 1938 |
| 598 | Ga0495619_0031297 | 3300053085 | Bacteria | 3448 |
| 599 | Ga0500645_001329 | 3300053730 | Bacteria | 12797 |
| 600 | Ga0501084_0001636 | 3300054114 | Bacteria | 17786 |
| 601 | Ga0501084_0039097 | 3300054114 | Bacteria | 3968 |
| 602 | Ga0501084_0114813 | 3300054114 | Bacteria | 2264 |
| 603 | Ga0501084_0234988 | 3300054114 | Bacteria | 1547 |
| 604 | Ga0501084_0575689 | 3300054114 | Bacteria | 951 |
| 605 | Ga0501082_0014328 | 3300060353 | Bacteria | 6822 |
| 606 | Ga0501082_0028956 | 3300060353 | Bacteria | 4771 |
| 607 | Ga0501082_0463987 | 3300060353 | Bacteria | 1107 |
| 608 | Ga0501082_0520201 | 3300060353 | Bacteria | 1040 |
| 609 | Ga0530510_0097460 | 3300061734 | Bacteria | 2150 |
| 610 | Ga0530510_0241670 | 3300061734 | Bacteria | 1344 |
| 611 | Ga0530510_0244730 | 3300061734 | Unclassified | 1336 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028381 | Ga0268264_10071383 | Ga0268264_100713834 | 214 |
| 2 | iso_pu_bacteria | 2508501050 | 2508731245 | 215 |
| 3 | 3300005455 | Ga0070663_100577038 | Ga0070663_1005770381 | 216 |
| 4 | 3300005457 | Ga0070662_100058269 | Ga0070662_1000582692 | 216 |
| 5 | 3300005471 | Ga0070698_100603497 | Ga0070698_1006034972 | 216 |
| 6 | 3300005539 | Ga0068853_100339222 | Ga0068853_1003392222 | 216 |
| 7 | 3300005548 | Ga0070665_100390171 | Ga0070665_1003901712 | 216 |
| 8 | 3300005844 | Ga0068862_100064953 | Ga0068862_1000649532 | 216 |
| 9 | 3300006847 | Ga0075431_100218449 | Ga0075431_1002184492 | 216 |
| 10 | 3300006852 | Ga0075433_10052169 | Ga0075433_100521694 | 216 |
| 11 | 3300006871 | Ga0075434_100091306 | Ga0075434_1000913063 | 216 |
| 12 | 3300007076 | Ga0075435_100297143 | Ga0075435_1002971432 | 216 |
| 13 | iso_pu_bacteria | 2738543013 | 2739251186 | 216 |
| 14 | 3300005293 | Ga0065715_10155528 | Ga0065715_101555281 | 217 |
| 15 | 3300005328 | Ga0070676_10002814 | Ga0070676_100028147 | 217 |
| 16 | 3300005329 | Ga0070683_100131652 | Ga0070683_1001316522 | 217 |
| 17 | 3300005329 | Ga0070683_100158723 | Ga0070683_1001587232 | 217 |
| 18 | 3300005330 | Ga0070690_100034427 | Ga0070690_1000344272 | 217 |
| 19 | 3300005334 | Ga0068869_100000228 | Ga0068869_10000022813 | 217 |
| 20 | 3300005336 | Ga0070680_100001225 | Ga0070680_10000122510 | 217 |
| 21 | 3300005336 | Ga0070680_100394844 | Ga0070680_1003948441 | 217 |
| 22 | 3300005336 | Ga0070680_100694006 | Ga0070680_1006940061 | 217 |
| 23 | 3300005337 | Ga0070682_100001200 | Ga0070682_10000120012 | 217 |
| 24 | 3300005338 | Ga0068868_100702049 | Ga0068868_1007020492 | 217 |
| 25 | 3300005339 | Ga0070660_100000281 | Ga0070660_10000028118 | 217 |
| 26 | 3300005340 | Ga0070689_100016424 | Ga0070689_1000164242 | 217 |
| 27 | 3300005341 | Ga0070691_10029628 | Ga0070691_100296282 | 217 |
| 28 | 3300005343 | Ga0070687_100032253 | Ga0070687_1000322532 | 217 |
| 29 | 3300005344 | Ga0070661_100015722 | Ga0070661_1000157222 | 217 |
| 30 | 3300005344 | Ga0070661_100126336 | Ga0070661_1001263362 | 217 |
| 31 | 3300005345 | Ga0070692_10002011 | Ga0070692_100020118 | 217 |
| 32 | 3300005355 | Ga0070671_100358633 | Ga0070671_1003586332 | 217 |
| 33 | 3300005366 | Ga0070659_100041894 | Ga0070659_1000418942 | 217 |
| 34 | 3300005367 | Ga0070667_100181142 | Ga0070667_1001811422 | 217 |
| 35 | 3300005367 | Ga0070667_100490120 | Ga0070667_1004901202 | 217 |
| 36 | 3300005406 | Ga0070703_10000633 | Ga0070703_1000063310 | 217 |
| 37 | 3300005406 | Ga0070703_10004012 | Ga0070703_100040124 | 217 |
| 38 | 3300005434 | Ga0070709_10066103 | Ga0070709_100661033 | 217 |
| 39 | 3300005436 | Ga0070713_100450987 | Ga0070713_1004509873 | 217 |
| 40 | 3300005438 | Ga0070701_10201675 | Ga0070701_102016751 | 217 |
| 41 | 3300005440 | Ga0070705_100000209 | Ga0070705_10000020910 | 217 |
| 42 | 3300005440 | Ga0070705_100071605 | Ga0070705_1000716052 | 217 |
| 43 | 3300005444 | Ga0070694_100001135 | Ga0070694_10000113513 | 217 |
| 44 | 3300005444 | Ga0070694_100273488 | Ga0070694_1002734883 | 217 |
| 45 | 3300005445 | Ga0070708_100193769 | Ga0070708_1001937692 | 217 |
| 46 | 3300005455 | Ga0070663_100069022 | Ga0070663_1000690222 | 217 |
| 47 | 3300005456 | Ga0070678_100921559 | Ga0070678_1009215591 | 217 |
| 48 | 3300005457 | Ga0070662_100023687 | Ga0070662_1000236873 | 217 |
| 49 | 3300005457 | Ga0070662_100883675 | Ga0070662_1008836751 | 217 |
| 50 | 3300005458 | Ga0070681_10054874 | Ga0070681_100548745 | 217 |
| 51 | 3300005458 | Ga0070681_10349207 | Ga0070681_103492072 | 217 |
| 52 | 3300005459 | Ga0068867_100001387 | Ga0068867_10000138711 | 217 |
| 53 | 3300005459 | Ga0068867_100592378 | Ga0068867_1005923781 | 217 |
| 54 | 3300005467 | Ga0070706_100454084 | Ga0070706_1004540841 | 217 |
| 55 | 3300005468 | Ga0070707_100117335 | Ga0070707_1001173353 | 217 |
| 56 | 3300005468 | Ga0070707_100420162 | Ga0070707_1004201621 | 217 |
| 57 | 3300005471 | Ga0070698_100071818 | Ga0070698_1000718186 | 217 |
| 58 | 3300005471 | Ga0070698_100295623 | Ga0070698_1002956232 | 217 |
| 59 | 3300005518 | Ga0070699_100123238 | Ga0070699_1001232382 | 217 |
| 60 | 3300005530 | Ga0070679_100000384 | Ga0070679_10000038427 | 217 |
| 61 | 3300005535 | Ga0070684_100012681 | Ga0070684_1000126815 | 217 |
| 62 | 3300005536 | Ga0070697_100296124 | Ga0070697_1002961242 | 217 |
| 63 | 3300005539 | Ga0068853_100005645 | Ga0068853_1000056458 | 217 |
| 64 | 3300005543 | Ga0070672_100078247 | Ga0070672_1000782473 | 217 |
| 65 | 3300005545 | Ga0070695_100006033 | Ga0070695_1000060335 | 217 |
| 66 | 3300005545 | Ga0070695_100409901 | Ga0070695_1004099011 | 217 |
| 67 | 3300005546 | Ga0070696_100000432 | Ga0070696_10000043212 | 217 |
| 68 | 3300005547 | Ga0070693_100000049 | Ga0070693_10000004920 | 217 |
| 69 | 3300005548 | Ga0070665_100005547 | Ga0070665_1000055477 | 217 |
| 70 | 3300005549 | Ga0070704_100000798 | Ga0070704_10000079812 | 217 |
| 71 | 3300005549 | Ga0070704_100084926 | Ga0070704_1000849265 | 217 |
| 72 | 3300005549 | Ga0070704_100848971 | Ga0070704_1008489711 | 217 |
| 73 | 3300005563 | Ga0068855_100006053 | Ga0068855_1000060532 | 217 |
| 74 | 3300005563 | Ga0068855_100174475 | Ga0068855_1001744752 | 217 |
| 75 | 3300005564 | Ga0070664_100028901 | Ga0070664_1000289012 | 217 |
| 76 | 3300005577 | Ga0068857_100008279 | Ga0068857_1000082793 | 217 |
| 77 | 3300005577 | Ga0068857_100155337 | Ga0068857_1001553373 | 217 |
| 78 | 3300005578 | Ga0068854_100053986 | Ga0068854_1000539862 | 217 |
| 79 | 3300005614 | Ga0068856_100002309 | Ga0068856_1000023099 | 217 |
| 80 | 3300005614 | Ga0068856_100005140 | Ga0068856_1000051406 | 217 |
| 81 | 3300005615 | Ga0070702_100505498 | Ga0070702_1005054981 | 217 |
| 82 | 3300005616 | Ga0068852_100069153 | Ga0068852_1000691533 | 217 |
| 83 | 3300005616 | Ga0068852_100532752 | Ga0068852_1005327521 | 217 |
| 84 | 3300005617 | Ga0068859_100028623 | Ga0068859_1000286237 | 217 |
| 85 | 3300005617 | Ga0068859_100765546 | Ga0068859_1007655462 | 217 |
| 86 | 3300005618 | Ga0068864_100010526 | Ga0068864_1000105265 | 217 |
| 87 | 3300005618 | Ga0068864_100072247 | Ga0068864_1000722471 | 217 |
| 88 | 3300005719 | Ga0068861_100045224 | Ga0068861_1000452242 | 217 |
| 89 | 3300005840 | Ga0068870_10000058 | Ga0068870_1000005819 | 217 |
| 90 | 3300005840 | Ga0068870_10203432 | Ga0068870_102034322 | 217 |
| 91 | 3300005841 | Ga0068863_100012852 | Ga0068863_1000128527 | 217 |
| 92 | 3300005842 | Ga0068858_100029779 | Ga0068858_1000297792 | 217 |
| 93 | 3300005843 | Ga0068860_100007602 | Ga0068860_1000076024 | 217 |
| 94 | 3300005844 | Ga0068862_100002587 | Ga0068862_10000258712 | 217 |
| 95 | 3300005844 | Ga0068862_101217674 | Ga0068862_1012176741 | 217 |
| 96 | 3300005937 | Ga0081455_10506455 | Ga0081455_105064551 | 217 |
| 97 | 3300006173 | Ga0070716_100012162 | Ga0070716_1000121623 | 217 |
| 98 | 3300006175 | Ga0070712_100437454 | Ga0070712_1004374542 | 217 |
| 99 | 3300006177 | Ga0075362_10053809 | Ga0075362_100538092 | 217 |
| 100 | 3300006358 | Ga0068871_100457295 | Ga0068871_1004572952 | 217 |
| 101 | 3300006844 | Ga0075428_100029033 | Ga0075428_1000290333 | 217 |
| 102 | 3300006844 | Ga0075428_100119345 | Ga0075428_1001193455 | 217 |
| 103 | 3300006844 | Ga0075428_100966407 | Ga0075428_1009664072 | 217 |
| 104 | 3300006846 | Ga0075430_100196082 | Ga0075430_1001960822 | 217 |
| 105 | 3300006847 | Ga0075431_100080770 | Ga0075431_1000807703 | 217 |
| 106 | 3300006852 | Ga0075433_10000715 | Ga0075433_1000071518 | 217 |
| 107 | 3300006852 | Ga0075433_10098100 | Ga0075433_100981002 | 217 |
| 108 | 3300006871 | Ga0075434_100002095 | Ga0075434_1000020952 | 217 |
| 109 | 3300006871 | Ga0075434_100081864 | Ga0075434_1000818643 | 217 |
| 110 | 3300006871 | Ga0075434_100642478 | Ga0075434_1006424781 | 217 |
| 111 | 3300006880 | Ga0075429_100025276 | Ga0075429_1000252762 | 217 |
| 112 | 3300006881 | Ga0068865_100094183 | Ga0068865_1000941831 | 217 |
| 113 | 3300006914 | Ga0075436_100051694 | Ga0075436_1000516942 | 217 |
| 114 | 3300006931 | Ga0097620_100028624 | Ga0097620_1000286241 | 217 |
| 115 | 3300006931 | Ga0097620_100765607 | Ga0097620_1007656072 | 217 |
| 116 | 3300007076 | Ga0075435_100021878 | Ga0075435_1000218785 | 217 |
| 117 | 3300007076 | Ga0075435_100087344 | Ga0075435_1000873442 | 217 |
| 118 | 3300007076 | Ga0075435_100135696 | Ga0075435_1001356961 | 217 |
| 119 | 3300007265 | Ga0099794_10005130 | Ga0099794_100051301 | 217 |
| 120 | 3300009093 | Ga0105240_10098611 | Ga0105240_100986112 | 217 |
| 121 | 3300009093 | Ga0105240_10519201 | Ga0105240_105192012 | 217 |
| 122 | 3300009094 | Ga0111539_10040200 | Ga0111539_100402002 | 217 |
| 123 | 3300009094 | Ga0111539_10944703 | Ga0111539_109447031 | 217 |
| 124 | 3300009147 | Ga0114129_10025203 | Ga0114129_100252037 | 217 |
| 125 | 3300009147 | Ga0114129_10070216 | Ga0114129_100702162 | 217 |
| 126 | 3300009147 | Ga0114129_10081413 | Ga0114129_100814133 | 217 |
| 127 | 3300009147 | Ga0114129_10163192 | Ga0114129_101631922 | 217 |
| 128 | 3300009147 | Ga0114129_10200877 | Ga0114129_102008774 | 217 |
| 129 | 3300009147 | Ga0114129_11404099 | Ga0114129_114040991 | 217 |
| 130 | 3300009148 | Ga0105243_10198043 | Ga0105243_101980432 | 217 |
| 131 | 3300009174 | Ga0105241_10000194 | Ga0105241_1000019436 | 217 |
| 132 | 3300009174 | Ga0105241_10435942 | Ga0105241_104359421 | 217 |
| 133 | 3300009177 | Ga0105248_10079613 | Ga0105248_100796134 | 217 |
| 134 | 3300009177 | Ga0105248_10696953 | Ga0105248_106969532 | 217 |
| 135 | 3300009545 | Ga0105237_10514719 | Ga0105237_105147192 | 217 |
| 136 | 3300009551 | Ga0105238_10375187 | Ga0105238_103751872 | 217 |
| 137 | 3300009553 | Ga0105249_10274682 | Ga0105249_102746822 | 217 |
| 138 | 3300010375 | Ga0105239_10158506 | Ga0105239_101585061 | 217 |
| 139 | 3300011119 | Ga0105246_10018572 | Ga0105246_100185724 | 217 |
| 140 | 3300011119 | Ga0105246_10345743 | Ga0105246_103457431 | 217 |
| 141 | 3300013100 | Ga0157373_10000236 | Ga0157373_1000023637 | 217 |
| 142 | 3300013102 | Ga0157371_10177895 | Ga0157371_101778952 | 217 |
| 143 | 3300013105 | Ga0157369_10032514 | Ga0157369_100325145 | 217 |
| 144 | 3300013105 | Ga0157369_10111236 | Ga0157369_101112362 | 217 |
| 145 | 3300013297 | Ga0157378_10596225 | Ga0157378_105962251 | 217 |
| 146 | 3300013307 | Ga0157372_10004639 | Ga0157372_100046396 | 217 |
| 147 | 3300013307 | Ga0157372_10177373 | Ga0157372_101773732 | 217 |
| 148 | 3300013308 | Ga0157375_10119855 | Ga0157375_101198552 | 217 |
| 149 | 3300013308 | Ga0157375_10647796 | Ga0157375_106477962 | 217 |
| 150 | 3300014325 | Ga0163163_10181122 | Ga0163163_101811222 | 217 |
| 151 | 3300014497 | Ga0182008_10047391 | Ga0182008_100473912 | 217 |
| 152 | 3300014969 | Ga0157376_10856638 | Ga0157376_108566382 | 217 |
| 153 | 3300014969 | Ga0157376_11041723 | Ga0157376_110417232 | 217 |
| 154 | 3300017792 | Ga0163161_10040601 | Ga0163161_100406012 | 217 |
| 155 | 3300020070 | Ga0206356_10482442 | Ga0206356_104824422 | 217 |
| 156 | 3300020082 | Ga0206353_10020003 | Ga0206353_100200032 | 217 |
| 157 | 3300020082 | Ga0206353_10074030 | Ga0206353_100740302 | 217 |
| 158 | 3300025885 | Ga0207653_10000861 | Ga0207653_100008617 | 217 |
| 159 | 3300025901 | Ga0207688_10100092 | Ga0207688_101000922 | 217 |
| 160 | 3300025903 | Ga0207680_10299560 | Ga0207680_102995602 | 217 |
| 161 | 3300025906 | Ga0207699_10009472 | Ga0207699_100094724 | 217 |
| 162 | 3300025907 | Ga0207645_10005678 | Ga0207645_100056782 | 217 |
| 163 | 3300025908 | Ga0207643_10000214 | Ga0207643_1000021416 | 217 |
| 164 | 3300025909 | Ga0207705_10153819 | Ga0207705_101538192 | 217 |
| 165 | 3300025910 | Ga0207684_10004470 | Ga0207684_100044706 | 217 |
| 166 | 3300025910 | Ga0207684_10120310 | Ga0207684_101203102 | 217 |
| 167 | 3300025911 | Ga0207654_10018803 | Ga0207654_100188032 | 217 |
| 168 | 3300025912 | Ga0207707_10000056 | Ga0207707_1000005633 | 217 |
| 169 | 3300025912 | Ga0207707_10180919 | Ga0207707_101809192 | 217 |
| 170 | 3300025913 | Ga0207695_10112636 | Ga0207695_101126362 | 217 |
| 171 | 3300025913 | Ga0207695_10676429 | Ga0207695_106764292 | 217 |
| 172 | 3300025917 | Ga0207660_10011192 | Ga0207660_100111925 | 217 |
| 173 | 3300025917 | Ga0207660_10174147 | Ga0207660_101741472 | 217 |
| 174 | 3300025917 | Ga0207660_10211873 | Ga0207660_102118732 | 217 |
| 175 | 3300025918 | Ga0207662_10072950 | Ga0207662_100729502 | 217 |
| 176 | 3300025919 | Ga0207657_10000306 | Ga0207657_1000030632 | 217 |
| 177 | 3300025920 | Ga0207649_10148978 | Ga0207649_101489781 | 217 |
| 178 | 3300025920 | Ga0207649_10507969 | Ga0207649_105079691 | 217 |
| 179 | 3300025921 | Ga0207652_10000532 | Ga0207652_1000053218 | 217 |
| 180 | 3300025922 | Ga0207646_10039786 | Ga0207646_100397863 | 217 |
| 181 | 3300025923 | Ga0207681_10052258 | Ga0207681_100522582 | 217 |
| 182 | 3300025925 | Ga0207650_10037076 | Ga0207650_100370762 | 217 |
| 183 | 3300025931 | Ga0207644_10016103 | Ga0207644_100161033 | 217 |
| 184 | 3300025932 | Ga0207690_10001831 | Ga0207690_1000183113 | 217 |
| 185 | 3300025932 | Ga0207690_10094902 | Ga0207690_100949022 | 217 |
| 186 | 3300025933 | Ga0207706_10004233 | Ga0207706_100042336 | 217 |
| 187 | 3300025936 | Ga0207670_10009764 | Ga0207670_100097643 | 217 |
| 188 | 3300025938 | Ga0207704_10329198 | Ga0207704_103291982 | 217 |
| 189 | 3300025939 | Ga0207665_10000418 | Ga0207665_1000041820 | 217 |
| 190 | 3300025940 | Ga0207691_10107746 | Ga0207691_101077463 | 217 |
| 191 | 3300025941 | Ga0207711_10422286 | Ga0207711_104222861 | 217 |
| 192 | 3300025941 | Ga0207711_10671430 | Ga0207711_106714302 | 217 |
| 193 | 3300025942 | Ga0207689_10000126 | Ga0207689_1000012617 | 217 |
| 194 | 3300025944 | Ga0207661_10019931 | Ga0207661_100199312 | 217 |
| 195 | 3300025944 | Ga0207661_10095929 | Ga0207661_100959292 | 217 |
| 196 | 3300025945 | Ga0207679_10127626 | Ga0207679_101276262 | 217 |
| 197 | 3300025945 | Ga0207679_10193881 | Ga0207679_101938812 | 217 |
| 198 | 3300025949 | Ga0207667_10002367 | Ga0207667_1000236720 | 217 |
| 199 | 3300025949 | Ga0207667_10076350 | Ga0207667_100763502 | 217 |
| 200 | 3300025949 | Ga0207667_10695850 | Ga0207667_106958502 | 217 |
| 201 | 3300025960 | Ga0207651_10045190 | Ga0207651_100451902 | 217 |
| 202 | 3300025960 | Ga0207651_10373326 | Ga0207651_103733261 | 217 |
| 203 | 3300025960 | Ga0207651_10596314 | Ga0207651_105963142 | 217 |
| 204 | 3300025961 | Ga0207712_10056020 | Ga0207712_100560202 | 217 |
| 205 | 3300025981 | Ga0207640_10041543 | Ga0207640_100415433 | 217 |
| 206 | 3300025986 | Ga0207658_10855682 | Ga0207658_108556821 | 217 |
| 207 | 3300026035 | Ga0207703_10287061 | Ga0207703_102870612 | 217 |
| 208 | 3300026041 | Ga0207639_10032694 | Ga0207639_100326944 | 217 |
| 209 | 3300026067 | Ga0207678_10000963 | Ga0207678_100009632 | 217 |
| 210 | 3300026075 | Ga0207708_10386652 | Ga0207708_103866522 | 217 |
| 211 | 3300026075 | Ga0207708_10448893 | Ga0207708_104488932 | 217 |
| 212 | 3300026078 | Ga0207702_10006723 | Ga0207702_1000672310 | 217 |
| 213 | 3300026078 | Ga0207702_10015062 | Ga0207702_100150625 | 217 |
| 214 | 3300026088 | Ga0207641_10112923 | Ga0207641_101129231 | 217 |
| 215 | 3300026089 | Ga0207648_10001171 | Ga0207648_100011717 | 217 |
| 216 | 3300026089 | Ga0207648_10342691 | Ga0207648_103426912 | 217 |
| 217 | 3300026116 | Ga0207674_10000270 | Ga0207674_100002708 | 217 |
| 218 | 3300026116 | Ga0207674_10241233 | Ga0207674_102412331 | 217 |
| 219 | 3300026118 | Ga0207675_100040347 | Ga0207675_1000403474 | 217 |
| 220 | 3300026121 | Ga0207683_10318262 | Ga0207683_103182622 | 217 |
| 221 | 3300026121 | Ga0207683_10828675 | Ga0207683_108286751 | 217 |
| 222 | 3300026142 | Ga0207698_10017913 | Ga0207698_100179132 | 217 |
| 223 | 3300026142 | Ga0207698_10458727 | Ga0207698_104587272 | 217 |
| 224 | 3300027671 | Ga0209588_1005306 | Ga0209588_10053065 | 217 |
| 225 | 3300027907 | Ga0207428_10153688 | Ga0207428_101536883 | 217 |
| 226 | 3300028379 | Ga0268266_10173486 | Ga0268266_101734862 | 217 |
| 227 | 3300031507 | Ga0307509_10092103 | Ga0307509_100921033 | 217 |
| 228 | 3300031507 | Ga0307509_10092932 | Ga0307509_100929322 | 217 |
| 229 | 3300031507 | Ga0307509_10146991 | Ga0307509_101469913 | 217 |
| 230 | 3300031616 | Ga0307508_10078432 | Ga0307508_100784324 | 217 |
| 231 | 3300031616 | Ga0307508_10098024 | Ga0307508_100980242 | 217 |
| 232 | 3300031901 | Ga0307406_10527458 | Ga0307406_105274582 | 217 |
| 233 | 3300033180 | Ga0307510_10109517 | Ga0307510_101095172 | 217 |
| 234 | 3300034818 | Ga0373950_0073010 | Ga0373950_0073010_34_687 | 217 |
| 235 | 3300034820 | Ga0373959_0023487 | Ga0373959_0023487_61_714 | 217 |
| 236 | 3300035090 | Ga0373949_0012274 | Ga0373949_0012274_509_1162 | 217 |
| 237 | 3300035090 | Ga0373949_0018253 | Ga0373949_0018253_702_1355 | 217 |
| 238 | 3300035112 | Ga0373932_0117966 | Ga0373932_0117966_156_809 | 217 |
| 239 | 3300035121 | Ga0373960_0017157 | Ga0373960_0017157_646_1299 | 217 |
| 240 | 3300035207 | Ga0373942_0006964 | Ga0373942_0006964_1881_2534 | 217 |
| 241 | 3300035241 | Ga0373961_0017523 | Ga0373961_0017523_221_874 | 217 |
| 242 | 3300035242 | Ga0373962_0015397 | Ga0373962_0015397_805_1458 | 217 |
| 243 | 3300035691 | Ga0373931_0007904 | Ga0373931_0007904_2774_3427 | 217 |
| 244 | 3300037312 | Ga0395899_0014364 | Ga0395899_0014364_5294_5950 | 217 |
| 245 | 3300037312 | Ga0395899_0090178 | Ga0395899_0090178_306_962 | 217 |
| 246 | 3300037418 | Ga0395900_0120803 | Ga0395900_0120803_1493_2149 | 217 |
| 247 | 3300037466 | Ga0395898_0026079 | Ga0395898_0026079_1046_1702 | 217 |
| 248 | 3300037471 | Ga0395905_0064748 | Ga0395905_0064748_2103_2759 | 217 |
| 249 | 3300037471 | Ga0395905_0203495 | Ga0395905_0203495_660_1313 | 217 |
| 250 | 3300038443 | Ga0395901_0017803 | Ga0395901_0017803_1780_2436 | 217 |
| 251 | 3300038443 | Ga0395901_0096910 | Ga0395901_0096910_1261_1917 | 217 |
| 252 | 3300042005 | Ga0439448_0017428 | Ga0439448_0017428_227_880 | 217 |
| 253 | 3300042007 | Ga0439449_0011605 | Ga0439449_0011605_551_1204 | 217 |
| 254 | 3300042157 | Ga0439458_0004322 | Ga0439458_0004322_2406_3059 | 217 |
| 255 | 3300042437 | Ga0439444_0055918 | Ga0439444_0055918_20_673 | 217 |
| 256 | 3300042876 | Ga0451577_0014564 | Ga0451577_0014564_5680_6333 | 217 |
| 257 | 3300042876 | Ga0451577_0109599 | Ga0451577_0109599_375_1028 | 217 |
| 258 | 3300045051 | Ga0451576_0016259 | Ga0451576_0016259_7546_8199 | 217 |
| 259 | 3300045051 | Ga0451576_0276540 | Ga0451576_0276540_954_1607 | 217 |
| 260 | 3300045976 | Ga0466967_0003029 | Ga0466967_0003029_4370_5026 | 217 |
| 261 | 3300046462 | Ga0495651_0160541 | Ga0495651_0160541_93_746 | 217 |
| 262 | 3300046472 | Ga0495580_0025906 | Ga0495580_0025906_1595_2248 | 217 |
| 263 | 3300046491 | Ga0495584_0143896 | Ga0495584_0143896_420_1073 | 217 |
| 264 | 3300046492 | Ga0495585_0093815 | Ga0495585_0093815_792_1445 | 217 |
| 265 | 3300046525 | Ga0495663_0095272 | Ga0495663_0095272_180_833 | 217 |
| 266 | 3300046526 | Ga0495666_0066506 | Ga0495666_0066506_548_1201 | 217 |
| 267 | 3300046528 | Ga0495642_0144879 | Ga0495642_0144879_178_831 | 217 |
| 268 | 3300046615 | Ga0495656_0001040 | Ga0495656_0001040_5999_6652 | 217 |
| 269 | 3300046660 | Ga0495625_0065109 | Ga0495625_0065109_1531_2184 | 217 |
| 270 | 3300046683 | Ga0495658_0058552 | Ga0495658_0058552_1520_2173 | 217 |
| 271 | 3300047469 | Ga0495673_0044908 | Ga0495673_0044908_1258_1911 | 217 |
| 272 | 3300048090 | Ga0495615_0003476 | Ga0495615_0003476_1258_1911 | 217 |
| 273 | 3300048904 | Ga0496101_0191242 | Ga0496101_0191242_530_1183 | 217 |
| 274 | 3300048904 | Ga0496101_0667573 | Ga0496101_0667573_81_734 | 217 |
| 275 | 3300048907 | Ga0496104_0059381 | Ga0496104_0059381_297_950 | 217 |
| 276 | 3300048911 | Ga0496108_0044701 | Ga0496108_0044701_2000_2653 | 217 |
| 277 | 3300048912 | Ga0496109_0580189 | Ga0496109_0580189_56_709 | 217 |
| 278 | 3300048915 | Ga0496112_0115705 | Ga0496112_0115705_804_1457 | 217 |
| 279 | 3300048916 | Ga0496113_0171595 | Ga0496113_0171595_113_766 | 217 |
| 280 | 3300049592 | Ga0501076_0424471 | Ga0501076_0424471_300_953 | 217 |
| 281 | 3300049742 | Ga0501080_0176508 | Ga0501080_0176508_630_1283 | 217 |
| 282 | 3300050507 | nmdc:mga05p37_18754_c1 | nmdc:mga05p37_18754_c1_1167_1820 | 217 |
| 283 | 3300050507 | nmdc:mga05p37_189172_c1 | nmdc:mga05p37_189172_c1_1131_1784 | 217 |
| 284 | 3300050507 | nmdc:mga05p37_49349_c1 | nmdc:mga05p37_49349_c1_1922_2575 | 217 |
| 285 | 3300050507 | nmdc:mga05p37_599294_c1 | nmdc:mga05p37_599294_c1_385_1038 | 217 |
| 286 | 3300050508 | nmdc:mga09592_52975_c1 | nmdc:mga09592_52975_c1_1965_2618 | 217 |
| 287 | 3300050510 | nmdc:mga06r32_64807_c1 | nmdc:mga06r32_64807_c1_567_1220 | 217 |
| 288 | 3300050511 | nmdc:mga08y16_128790_c1 | nmdc:mga08y16_128790_c1_1741_2394 | 217 |
| 289 | 3300050512 | nmdc:mga0n895_1262919_c1 | nmdc:mga0n895_1262919_c1_43_696 | 217 |
| 290 | 3300050512 | nmdc:mga0n895_509624_c1 | nmdc:mga0n895_509624_c1_213_866 | 217 |
| 291 | 3300050512 | nmdc:mga0n895_61577_c1 | nmdc:mga0n895_61577_c1_2723_3376 | 217 |
| 292 | 3300050513 | nmdc:mga0rr50_16048_c1 | nmdc:mga0rr50_16048_c1_2638_3291 | 217 |
| 293 | 3300050513 | nmdc:mga0rr50_297875_c1 | nmdc:mga0rr50_297875_c1_206_859 | 217 |
| 294 | 3300050513 | nmdc:mga0rr50_299179_c1 | nmdc:mga0rr50_299179_c1_84_737 | 217 |
| 295 | 3300050513 | nmdc:mga0rr50_40728_c1 | nmdc:mga0rr50_40728_c1_1326_1979 | 217 |
| 296 | 3300050514 | nmdc:mga08x19_4310_c1 | nmdc:mga08x19_4310_c1_6094_6747 | 217 |
| 297 | 3300050514 | nmdc:mga08x19_487301_c1 | nmdc:mga08x19_487301_c1_16_669 | 217 |
| 298 | 3300050515 | nmdc:mga0a205_10877_c1 | nmdc:mga0a205_10877_c1_4764_5417 | 217 |
| 299 | 3300050515 | nmdc:mga0a205_1214_c1 | nmdc:mga0a205_1214_c1_20613_21266 | 217 |
| 300 | 3300050515 | nmdc:mga0a205_25739_c1 | nmdc:mga0a205_25739_c1_2927_3580 | 217 |
| 301 | 3300054114 | Ga0501084_0114813 | Ga0501084_0114813_993_1646 | 217 |
| 302 | 3300005328 | Ga0070676_10019968 | Ga0070676_100199684 | 218 |
| 303 | 3300005334 | Ga0068869_100037255 | Ga0068869_1000372553 | 218 |
| 304 | 3300005338 | Ga0068868_100147977 | Ga0068868_1001479772 | 218 |
| 305 | 3300005353 | Ga0070669_100550291 | Ga0070669_1005502912 | 218 |
| 306 | 3300005355 | Ga0070671_100254429 | Ga0070671_1002544291 | 218 |
| 307 | 3300005356 | Ga0070674_100098794 | Ga0070674_1000987941 | 218 |
| 308 | 3300005364 | Ga0070673_100119857 | Ga0070673_1001198572 | 218 |
| 309 | 3300005406 | Ga0070703_10016100 | Ga0070703_100161003 | 218 |
| 310 | 3300005444 | Ga0070694_100016158 | Ga0070694_1000161582 | 218 |
| 311 | 3300005445 | Ga0070708_100033393 | Ga0070708_1000333933 | 218 |
| 312 | 3300005457 | Ga0070662_100202847 | Ga0070662_1002028472 | 218 |
| 313 | 3300005459 | Ga0068867_100002339 | Ga0068867_1000023394 | 218 |
| 314 | 3300005459 | Ga0068867_100086876 | Ga0068867_1000868762 | 218 |
| 315 | 3300005459 | Ga0068867_100823125 | Ga0068867_1008231251 | 218 |
| 316 | 3300005467 | Ga0070706_100060610 | Ga0070706_1000606102 | 218 |
| 317 | 3300005471 | Ga0070698_100007922 | Ga0070698_1000079227 | 218 |
| 318 | 3300005471 | Ga0070698_100787044 | Ga0070698_1007870441 | 218 |
| 319 | 3300005518 | Ga0070699_100503395 | Ga0070699_1005033952 | 218 |
| 320 | 3300005536 | Ga0070697_100043485 | Ga0070697_1000434854 | 218 |
| 321 | 3300005543 | Ga0070672_100007475 | Ga0070672_1000074757 | 218 |
| 322 | 3300005545 | Ga0070695_100011071 | Ga0070695_1000110716 | 218 |
| 323 | 3300005546 | Ga0070696_100005303 | Ga0070696_1000053037 | 218 |
| 324 | 3300005577 | Ga0068857_100014260 | Ga0068857_1000142605 | 218 |
| 325 | 3300005577 | Ga0068857_101063994 | Ga0068857_1010639941 | 218 |
| 326 | 3300005719 | Ga0068861_100085740 | Ga0068861_1000857404 | 218 |
| 327 | 3300005840 | Ga0068870_10081427 | Ga0068870_100814272 | 218 |
| 328 | 3300005841 | Ga0068863_100692235 | Ga0068863_1006922351 | 218 |
| 329 | 3300005842 | Ga0068858_100233404 | Ga0068858_1002334042 | 218 |
| 330 | 3300005844 | Ga0068862_100025663 | Ga0068862_1000256636 | 218 |
| 331 | 3300005983 | Ga0081540_1037400 | Ga0081540_10374003 | 218 |
| 332 | 3300006844 | Ga0075428_100009400 | Ga0075428_1000094002 | 218 |
| 333 | 3300006844 | Ga0075428_100042157 | Ga0075428_1000421574 | 218 |
| 334 | 3300006844 | Ga0075428_100567287 | Ga0075428_1005672872 | 218 |
| 335 | 3300006846 | Ga0075430_100005950 | Ga0075430_1000059504 | 218 |
| 336 | 3300006846 | Ga0075430_100029165 | Ga0075430_1000291653 | 218 |
| 337 | 3300006846 | Ga0075430_100342881 | Ga0075430_1003428812 | 218 |
| 338 | 3300006846 | Ga0075430_100412242 | Ga0075430_1004122422 | 218 |
| 339 | 3300006847 | Ga0075431_100015506 | Ga0075431_1000155062 | 218 |
| 340 | 3300006847 | Ga0075431_100081470 | Ga0075431_1000814703 | 218 |
| 341 | 3300006847 | Ga0075431_100098604 | Ga0075431_1000986042 | 218 |
| 342 | 3300006847 | Ga0075431_100172556 | Ga0075431_1001725562 | 218 |
| 343 | 3300006847 | Ga0075431_100331688 | Ga0075431_1003316882 | 218 |
| 344 | 3300006852 | Ga0075433_10089399 | Ga0075433_100893992 | 218 |
| 345 | 3300006852 | Ga0075433_10118487 | Ga0075433_101184872 | 218 |
| 346 | 3300006852 | Ga0075433_10472458 | Ga0075433_104724582 | 218 |
| 347 | 3300006871 | Ga0075434_100000430 | Ga0075434_1000004303 | 218 |
| 348 | 3300006871 | Ga0075434_100184653 | Ga0075434_1001846532 | 218 |
| 349 | 3300006871 | Ga0075434_100277686 | Ga0075434_1002776863 | 218 |
| 350 | 3300006880 | Ga0075429_100002725 | Ga0075429_10000272512 | 218 |
| 351 | 3300006880 | Ga0075429_100044089 | Ga0075429_1000440892 | 218 |
| 352 | 3300006880 | Ga0075429_100281365 | Ga0075429_1002813652 | 218 |
| 353 | 3300006880 | Ga0075429_100301015 | Ga0075429_1003010152 | 218 |
| 354 | 3300006880 | Ga0075429_100630637 | Ga0075429_1006306372 | 218 |
| 355 | 3300006914 | Ga0075436_100103286 | Ga0075436_1001032862 | 218 |
| 356 | 3300006946 | Ga0079104_1010200 | Ga0079104_10102004 | 218 |
| 357 | 3300007076 | Ga0075435_100014083 | Ga0075435_1000140837 | 218 |
| 358 | 3300007076 | Ga0075435_100016145 | Ga0075435_1000161453 | 218 |
| 359 | 3300007076 | Ga0075435_100471357 | Ga0075435_1004713572 | 218 |
| 360 | 3300009094 | Ga0111539_10003941 | Ga0111539_1000394115 | 218 |
| 361 | 3300009094 | Ga0111539_10005060 | Ga0111539_100050607 | 218 |
| 362 | 3300009098 | Ga0105245_10104108 | Ga0105245_101041083 | 218 |
| 363 | 3300009098 | Ga0105245_10965750 | Ga0105245_109657501 | 218 |
| 364 | 3300009147 | Ga0114129_10007581 | Ga0114129_100075812 | 218 |
| 365 | 3300009147 | Ga0114129_10015887 | Ga0114129_100158875 | 218 |
| 366 | 3300009147 | Ga0114129_10053062 | Ga0114129_100530629 | 218 |
| 367 | 3300009147 | Ga0114129_10058865 | Ga0114129_100588652 | 218 |
| 368 | 3300009147 | Ga0114129_10103105 | Ga0114129_101031052 | 218 |
| 369 | 3300009147 | Ga0114129_10106382 | Ga0114129_101063822 | 218 |
| 370 | 3300009147 | Ga0114129_10866501 | Ga0114129_108665012 | 218 |
| 371 | 3300009147 | Ga0114129_10909733 | Ga0114129_109097332 | 218 |
| 372 | 3300009148 | Ga0105243_10048073 | Ga0105243_100480732 | 218 |
| 373 | 3300009176 | Ga0105242_10889866 | Ga0105242_108898662 | 218 |
| 374 | 3300009177 | Ga0105248_10371574 | Ga0105248_103715741 | 218 |
| 375 | 3300011119 | Ga0105246_10142674 | Ga0105246_101426742 | 218 |
| 376 | 3300013306 | Ga0163162_10590127 | Ga0163162_105901272 | 218 |
| 377 | 3300014969 | Ga0157376_10718302 | Ga0157376_107183021 | 218 |
| 378 | 3300017792 | Ga0163161_10354866 | Ga0163161_103548662 | 218 |
| 379 | 3300022739 | Ga0228711_1000772 | Ga0228711_100077236 | 218 |
| 380 | 3300022740 | Ga0228710_1000936 | Ga0228710_10009362 | 218 |
| 381 | 3300025899 | Ga0207642_10533097 | Ga0207642_105330971 | 218 |
| 382 | 3300025907 | Ga0207645_10004529 | Ga0207645_100045297 | 218 |
| 383 | 3300025908 | Ga0207643_10052275 | Ga0207643_100522752 | 218 |
| 384 | 3300025910 | Ga0207684_10013221 | Ga0207684_100132216 | 218 |
| 385 | 3300025922 | Ga0207646_10005923 | Ga0207646_1000592312 | 218 |
| 386 | 3300025926 | Ga0207659_10259307 | Ga0207659_102593071 | 218 |
| 387 | 3300025931 | Ga0207644_10050925 | Ga0207644_100509252 | 218 |
| 388 | 3300025931 | Ga0207644_10150521 | Ga0207644_101505211 | 218 |
| 389 | 3300025933 | Ga0207706_10140746 | Ga0207706_101407462 | 218 |
| 390 | 3300025934 | Ga0207686_10379113 | Ga0207686_103791131 | 218 |
| 391 | 3300025935 | Ga0207709_10032207 | Ga0207709_100322072 | 218 |
| 392 | 3300025937 | Ga0207669_10060150 | Ga0207669_100601502 | 218 |
| 393 | 3300025940 | Ga0207691_10003291 | Ga0207691_1000329116 | 218 |
| 394 | 3300025940 | Ga0207691_10114388 | Ga0207691_101143881 | 218 |
| 395 | 3300025942 | Ga0207689_10008403 | Ga0207689_100084032 | 218 |
| 396 | 3300025942 | Ga0207689_10008688 | Ga0207689_100086886 | 218 |
| 397 | 3300025960 | Ga0207651_10790863 | Ga0207651_107908632 | 218 |
| 398 | 3300026035 | Ga0207703_10865784 | Ga0207703_108657842 | 218 |
| 399 | 3300026089 | Ga0207648_10001548 | Ga0207648_1000154816 | 218 |
| 400 | 3300026089 | Ga0207648_10081826 | Ga0207648_100818262 | 218 |
| 401 | 3300026116 | Ga0207674_10163488 | Ga0207674_101634882 | 218 |
| 402 | 3300026121 | Ga0207683_10119521 | Ga0207683_101195212 | 218 |
| 403 | 3300027111 | Ga0209281_1000469 | Ga0209281_100046939 | 218 |
| 404 | 3300027666 | Ga0209282_1000038 | Ga0209282_100003839 | 218 |
| 405 | 3300027907 | Ga0207428_10000190 | Ga0207428_1000019036 | 218 |
| 406 | 3300027907 | Ga0207428_10123992 | Ga0207428_101239922 | 218 |
| 407 | 3300028379 | Ga0268266_10024221 | Ga0268266_100242212 | 218 |
| 408 | 3300031649 | Ga0307514_10071822 | Ga0307514_100718222 | 218 |
| 409 | 3300031731 | Ga0307405_10234159 | Ga0307405_102341592 | 218 |
| 410 | 3300031731 | Ga0307405_10321144 | Ga0307405_103211442 | 218 |
| 411 | 3300031824 | Ga0307413_10832358 | Ga0307413_108323581 | 218 |
| 412 | 3300031967 | Ga0315914_1000204 | Ga0315914_100020455 | 218 |
| 413 | 3300031995 | Ga0307409_100614810 | Ga0307409_1006148102 | 218 |
| 414 | 3300031995 | Ga0307409_101156641 | Ga0307409_1011566411 | 218 |
| 415 | 3300032002 | Ga0307416_101516103 | Ga0307416_1015161031 | 218 |
| 416 | 3300032005 | Ga0307411_10125618 | Ga0307411_101256182 | 218 |
| 417 | 3300033430 | Ga0315913_1002007 | Ga0315913_10020072 | 218 |
| 418 | 3300033464 | Ga0315915_1000018 | Ga0315915_100001839 | 218 |
| 419 | 3300035088 | Ga0373940_0030656 | Ga0373940_0030656_207_863 | 218 |
| 420 | 3300035115 | Ga0373941_0057428 | Ga0373941_0057428_462_1118 | 218 |
| 421 | 3300035116 | Ga0373945_0075509 | Ga0373945_0075509_615_1271 | 218 |
| 422 | 3300035692 | Ga0373935_0060295 | Ga0373935_0060295_1458_2114 | 218 |
| 423 | 3300035725 | Ga0373947_0195973 | Ga0373947_0195973_647_1303 | 218 |
| 424 | 3300036401 | Ga0373937_0012966 | Ga0373937_0012966_2040_2696 | 218 |
| 425 | 3300037068 | Ga0373925_0107474 | Ga0373925_0107474_1353_2009 | 218 |
| 426 | 3300038996 | Ga0242420_016693 | Ga0242420_016693_532_1197 | 218 |
| 427 | 3300042461 | Ga0439460_0092056 | Ga0439460_0092056_135_791 | 218 |
| 428 | 3300042876 | Ga0451577_0003647 | Ga0451577_0003647_1204_1869 | 218 |
| 429 | 3300042876 | Ga0451577_0036675 | Ga0451577_0036675_1470_2126 | 218 |
| 430 | 3300044673 | Ga0453683_0015247 | Ga0453683_0015247_1663_2328 | 218 |
| 431 | 3300044712 | Ga0453684_0009883 | Ga0453684_0009883_10622_11287 | 218 |
| 432 | 3300045051 | Ga0451576_0007779 | Ga0451576_0007779_10626_11291 | 218 |
| 433 | 3300045051 | Ga0451576_0423849 | Ga0451576_0423849_187_843 | 218 |
| 434 | 3300046454 | Ga0495592_0000404 | Ga0495592_0000404_30088_30744 | 218 |
| 435 | 3300046459 | Ga0495629_0065105 | Ga0495629_0065105_171_827 | 218 |
| 436 | 3300046683 | Ga0495658_0017250 | Ga0495658_0017250_1661_2317 | 218 |
| 437 | 3300046689 | Ga0495613_0036147 | Ga0495613_0036147_1696_2352 | 218 |
| 438 | 3300047318 | Ga0495636_0152968 | Ga0495636_0152968_187_843 | 218 |
| 439 | 3300047471 | Ga0495684_0072723 | Ga0495684_0072723_742_1398 | 218 |
| 440 | 3300049574 | Ga0501038_0191780 | Ga0501038_0191780_239_895 | 218 |
| 441 | 3300049575 | Ga0501039_0247478 | Ga0501039_0247478_26_682 | 218 |
| 442 | 3300049576 | Ga0501040_0034862 | Ga0501040_0034862_1068_1787 | 218 |
| 443 | 3300049576 | Ga0501040_0066597 | Ga0501040_0066597_1659_2315 | 218 |
| 444 | 3300049576 | Ga0501040_0073753 | Ga0501040_0073753_895_1551 | 218 |
| 445 | 3300049577 | Ga0501041_0036689 | Ga0501041_0036689_1875_2594 | 218 |
| 446 | 3300049577 | Ga0501041_0103789 | Ga0501041_0103789_382_1038 | 218 |
| 447 | 3300049578 | Ga0501042_0057714 | Ga0501042_0057714_506_1225 | 218 |
| 448 | 3300049578 | Ga0501042_0198713 | Ga0501042_0198713_58_714 | 218 |
| 449 | 3300049579 | Ga0501043_0171110 | Ga0501043_0171110_136_855 | 218 |
| 450 | 3300049584 | Ga0501068_0365313 | Ga0501068_0365313_72_791 | 218 |
| 451 | 3300049585 | Ga0501069_0061800 | Ga0501069_0061800_783_1439 | 218 |
| 452 | 3300049587 | Ga0501071_0186653 | Ga0501071_0186653_252_908 | 218 |
| 453 | 3300049587 | Ga0501071_0217587 | Ga0501071_0217587_686_1342 | 218 |
| 454 | 3300049588 | Ga0501072_0014173 | Ga0501072_0014173_4913_5569 | 218 |
| 455 | 3300049590 | Ga0501074_0077242 | Ga0501074_0077242_1623_2279 | 218 |
| 456 | 3300049591 | Ga0501075_0010075 | Ga0501075_0010075_5688_6407 | 218 |
| 457 | 3300049592 | Ga0501076_0047682 | Ga0501076_0047682_1602_2321 | 218 |
| 458 | 3300049592 | Ga0501076_0098529 | Ga0501076_0098529_1526_2182 | 218 |
| 459 | 3300049592 | Ga0501076_0260858 | Ga0501076_0260858_162_818 | 218 |
| 460 | 3300049593 | Ga0501077_0012674 | Ga0501077_0012674_3007_3726 | 218 |
| 461 | 3300049593 | Ga0501077_0185993 | Ga0501077_0185993_50_706 | 218 |
| 462 | 3300049593 | Ga0501077_0277961 | Ga0501077_0277961_53_709 | 218 |
| 463 | 3300049741 | Ga0501079_0018901 | Ga0501079_0018901_126_782 | 218 |
| 464 | 3300049741 | Ga0501079_0030236 | Ga0501079_0030236_1678_2397 | 218 |
| 465 | 3300049741 | Ga0501079_0675431 | Ga0501079_0675431_78_734 | 218 |
| 466 | 3300049742 | Ga0501080_0019290 | Ga0501080_0019290_365_1084 | 218 |
| 467 | 3300049743 | Ga0501081_0008099 | Ga0501081_0008099_2002_2721 | 218 |
| 468 | 3300049743 | Ga0501081_0018852 | Ga0501081_0018852_2450_3106 | 218 |
| 469 | 3300049743 | Ga0501081_0046986 | Ga0501081_0046986_1569_2225 | 218 |
| 470 | 3300049823 | Ga0501044_0068764 | Ga0501044_0068764_2384_3043 | 218 |
| 471 | 3300049824 | Ga0501045_0058299 | Ga0501045_0058299_1653_2372 | 218 |
| 472 | 3300050507 | nmdc:mga05p37_15550_c1 | nmdc:mga05p37_15550_c1_3134_3793 | 218 |
| 473 | 3300050507 | nmdc:mga05p37_413905_c1 | nmdc:mga05p37_413905_c1_66_722 | 218 |
| 474 | 3300050507 | nmdc:mga05p37_541260_c1 | nmdc:mga05p37_541260_c1_455_1111 | 218 |
| 475 | 3300050507 | nmdc:mga05p37_648305_c1 | nmdc:mga05p37_648305_c1_232_897 | 218 |
| 476 | 3300050507 | nmdc:mga05p37_90029_c1 | nmdc:mga05p37_90029_c1_1600_2256 | 218 |
| 477 | 3300050508 | nmdc:mga09592_13093_c1 | nmdc:mga09592_13093_c1_5852_6508 | 218 |
| 478 | 3300050508 | nmdc:mga09592_205965_c1 | nmdc:mga09592_205965_c1_856_1512 | 218 |
| 479 | 3300050508 | nmdc:mga09592_389953_c1 | nmdc:mga09592_389953_c1_168_824 | 218 |
| 480 | 3300050508 | nmdc:mga09592_575873_c1 | nmdc:mga09592_575873_c1_81_737 | 218 |
| 481 | 3300050509 | nmdc:mga0qj67_11850_c1 | nmdc:mga0qj67_11850_c1_2232_2888 | 218 |
| 482 | 3300050509 | nmdc:mga0qj67_473634_c1 | nmdc:mga0qj67_473634_c1_234_890 | 218 |
| 483 | 3300050510 | nmdc:mga06r32_101495_c1 | nmdc:mga06r32_101495_c1_2108_2764 | 218 |
| 484 | 3300050510 | nmdc:mga06r32_169993_c1 | nmdc:mga06r32_169993_c1_1205_1861 | 218 |
| 485 | 3300050510 | nmdc:mga06r32_695493_c1 | nmdc:mga06r32_695493_c1_195_851 | 218 |
| 486 | 3300050510 | nmdc:mga06r32_815918_c1 | nmdc:mga06r32_815918_c1_162_818 | 218 |
| 487 | 3300050510 | nmdc:mga06r32_88857_c1 | nmdc:mga06r32_88857_c1_1090_1746 | 218 |
| 488 | 3300050511 | nmdc:mga08y16_1951_c1 | nmdc:mga08y16_1951_c1_15678_16334 | 218 |
| 489 | 3300050511 | nmdc:mga08y16_1952_c1 | nmdc:mga08y16_1952_c1_1600_2265 | 218 |
| 490 | 3300050511 | nmdc:mga08y16_285618_c1 | nmdc:mga08y16_285618_c1_487_1170 | 218 |
| 491 | 3300050511 | nmdc:mga08y16_53865_c1 | nmdc:mga08y16_53865_c1_2894_3550 | 218 |
| 492 | 3300050512 | nmdc:mga0n895_184911_c1 | nmdc:mga0n895_184911_c1_562_1218 | 218 |
| 493 | 3300050512 | nmdc:mga0n895_9928_c1 | nmdc:mga0n895_9928_c1_3111_3776 | 218 |
| 494 | 3300050513 | nmdc:mga0rr50_54408_c1 | nmdc:mga0rr50_54408_c1_1568_2224 | 218 |
| 495 | 3300050514 | nmdc:mga08x19_14859_c1 | nmdc:mga08x19_14859_c1_575_1231 | 218 |
| 496 | 3300050515 | nmdc:mga0a205_103790_c2 | nmdc:mga0a205_103790_c2_191_850 | 218 |
| 497 | 3300050515 | nmdc:mga0a205_139966_c1 | nmdc:mga0a205_139966_c1_1595_2251 | 218 |
| 498 | 3300050515 | nmdc:mga0a205_2135_c1 | nmdc:mga0a205_2135_c1_1242_1907 | 218 |
| 499 | 3300053078 | Ga0495612_0054004 | Ga0495612_0054004_381_1037 | 218 |
| 500 | 3300053084 | Ga0495595_0049813 | Ga0495595_0049813_616_1272 | 218 |
| 501 | 3300053085 | Ga0495619_0031297 | Ga0495619_0031297_2662_3318 | 218 |
| 502 | 3300054114 | Ga0501084_0001636 | Ga0501084_0001636_2132_2851 | 218 |
| 503 | 3300054114 | Ga0501084_0039097 | Ga0501084_0039097_1881_2537 | 218 |
| 504 | 3300054114 | Ga0501084_0575689 | Ga0501084_0575689_113_769 | 218 |
| 505 | 3300060353 | Ga0501082_0014328 | Ga0501082_0014328_2263_2982 | 218 |
| 506 | 3300060353 | Ga0501082_0028956 | Ga0501082_0028956_2248_2904 | 218 |
| 507 | 3300060353 | Ga0501082_0520201 | Ga0501082_0520201_192_848 | 218 |
| 508 | 3300061734 | Ga0530510_0241670 | Ga0530510_0241670_151_807 | 218 |
| 509 | 3300005295 | Ga0065707_10160728 | Ga0065707_101607282 | 219 |
| 510 | 3300005440 | Ga0070705_100003105 | Ga0070705_1000031052 | 219 |
| 511 | 3300005440 | Ga0070705_100210021 | Ga0070705_1002100212 | 219 |
| 512 | 3300005445 | Ga0070708_100621420 | Ga0070708_1006214202 | 219 |
| 513 | 3300005459 | Ga0068867_100304422 | Ga0068867_1003044222 | 219 |
| 514 | 3300005467 | Ga0070706_100261907 | Ga0070706_1002619072 | 219 |
| 515 | 3300005471 | Ga0070698_100028305 | Ga0070698_1000283053 | 219 |
| 516 | 3300005518 | Ga0070699_100119424 | Ga0070699_1001194242 | 219 |
| 517 | 3300005536 | Ga0070697_100029267 | Ga0070697_1000292675 | 219 |
| 518 | 3300005549 | Ga0070704_100270097 | Ga0070704_1002700971 | 219 |
| 519 | 3300005549 | Ga0070704_100565307 | Ga0070704_1005653071 | 219 |
| 520 | 3300005937 | Ga0081455_10000658 | Ga0081455_1000065816 | 219 |
| 521 | 3300006844 | Ga0075428_100002400 | Ga0075428_10000240014 | 219 |
| 522 | 3300006844 | Ga0075428_100046664 | Ga0075428_1000466644 | 219 |
| 523 | 3300006844 | Ga0075428_100068421 | Ga0075428_1000684214 | 219 |
| 524 | 3300006844 | Ga0075428_100427415 | Ga0075428_1004274152 | 219 |
| 525 | 3300006846 | Ga0075430_100000047 | Ga0075430_10000004754 | 219 |
| 526 | 3300006846 | Ga0075430_100007006 | Ga0075430_1000070065 | 219 |
| 527 | 3300006847 | Ga0075431_100000424 | Ga0075431_1000004242 | 219 |
| 528 | 3300006847 | Ga0075431_100015317 | Ga0075431_1000153174 | 219 |
| 529 | 3300006847 | Ga0075431_100070429 | Ga0075431_1000704294 | 219 |
| 530 | 3300006852 | Ga0075433_10014955 | Ga0075433_100149556 | 219 |
| 531 | 3300006852 | Ga0075433_10035954 | Ga0075433_100359542 | 219 |
| 532 | 3300006871 | Ga0075434_100012865 | Ga0075434_1000128652 | 219 |
| 533 | 3300006871 | Ga0075434_100179939 | Ga0075434_1001799392 | 219 |
| 534 | 3300006871 | Ga0075434_100194316 | Ga0075434_1001943162 | 219 |
| 535 | 3300006880 | Ga0075429_100001286 | Ga0075429_1000012863 | 219 |
| 536 | 3300006880 | Ga0075429_100039035 | Ga0075429_1000390353 | 219 |
| 537 | 3300006914 | Ga0075436_100090946 | Ga0075436_1000909463 | 219 |
| 538 | 3300006914 | Ga0075436_100150074 | Ga0075436_1001500742 | 219 |
| 539 | 3300007076 | Ga0075435_100003005 | Ga0075435_10000300512 | 219 |
| 540 | 3300007076 | Ga0075435_100023001 | Ga0075435_1000230012 | 219 |
| 541 | 3300007076 | Ga0075435_100176241 | Ga0075435_1001762412 | 219 |
| 542 | 3300009094 | Ga0111539_10086857 | Ga0111539_100868572 | 219 |
| 543 | 3300009094 | Ga0111539_10932484 | Ga0111539_109324842 | 219 |
| 544 | 3300009147 | Ga0114129_10015402 | Ga0114129_100154029 | 219 |
| 545 | 3300009147 | Ga0114129_10021214 | Ga0114129_100212142 | 219 |
| 546 | 3300009147 | Ga0114129_10028553 | Ga0114129_100285533 | 219 |
| 547 | 3300009147 | Ga0114129_10091450 | Ga0114129_100914503 | 219 |
| 548 | 3300009147 | Ga0114129_10427062 | Ga0114129_104270622 | 219 |
| 549 | 3300009147 | Ga0114129_10437772 | Ga0114129_104377723 | 219 |
| 550 | 3300009147 | Ga0114129_11135377 | Ga0114129_111353772 | 219 |
| 551 | 3300013308 | Ga0157375_10878411 | Ga0157375_108784111 | 219 |
| 552 | 3300014326 | Ga0157380_10183447 | Ga0157380_101834472 | 219 |
| 553 | 3300025910 | Ga0207684_10009147 | Ga0207684_100091472 | 219 |
| 554 | 3300025910 | Ga0207684_10019719 | Ga0207684_100197192 | 219 |
| 555 | 3300025910 | Ga0207684_10337852 | Ga0207684_103378522 | 219 |
| 556 | 3300025922 | Ga0207646_10084261 | Ga0207646_100842612 | 219 |
| 557 | 3300028380 | Ga0268265_10019740 | Ga0268265_100197402 | 219 |
| 558 | 3300035084 | Ga0373928_0029632 | Ga0373928_0029632_301_960 | 219 |
| 559 | 3300035241 | Ga0373961_0045743 | Ga0373961_0045743_573_1232 | 219 |
| 560 | 3300035691 | Ga0373931_0001354 | Ga0373931_0001354_8512_9171 | 219 |
| 561 | 3300041413 | Ga0439465_0121468 | Ga0439465_0121468_120_788 | 219 |
| 562 | 3300046472 | Ga0495580_0002613 | Ga0495580_0002613_8544_9203 | 219 |
| 563 | 3300046615 | Ga0495656_0029405 | Ga0495656_0029405_1040_1699 | 219 |
| 564 | 3300048907 | Ga0496104_0683619 | Ga0496104_0683619_189_848 | 219 |
| 565 | 3300049573 | Ga0501037_0278955 | Ga0501037_0278955_287_946 | 219 |
| 566 | 3300049575 | Ga0501039_0091285 | Ga0501039_0091285_1035_1694 | 219 |
| 567 | 3300049576 | Ga0501040_0100466 | Ga0501040_0100466_855_1514 | 219 |
| 568 | 3300049587 | Ga0501071_0084330 | Ga0501071_0084330_332_991 | 219 |
| 569 | 3300049588 | Ga0501072_0023866 | Ga0501072_0023866_3272_3931 | 219 |
| 570 | 3300049591 | Ga0501075_0110770 | Ga0501075_0110770_1126_1785 | 219 |
| 571 | 3300049592 | Ga0501076_0006637 | Ga0501076_0006637_2207_2866 | 219 |
| 572 | 3300049592 | Ga0501076_0096780 | Ga0501076_0096780_1605_2270 | 219 |
| 573 | 3300049592 | Ga0501076_0442302 | Ga0501076_0442302_28_687 | 219 |
| 574 | 3300049741 | Ga0501079_0086957 | Ga0501079_0086957_963_1622 | 219 |
| 575 | 3300049742 | Ga0501080_0362419 | Ga0501080_0362419_632_1291 | 219 |
| 576 | 3300049743 | Ga0501081_0311522 | Ga0501081_0311522_53_868 | 219 |
| 577 | 3300050507 | nmdc:mga05p37_101116_c1 | nmdc:mga05p37_101116_c1_1688_2347 | 219 |
| 578 | 3300050507 | nmdc:mga05p37_13970_c1 | nmdc:mga05p37_13970_c1_4928_5587 | 219 |
| 579 | 3300050507 | nmdc:mga05p37_15394_c1 | nmdc:mga05p37_15394_c1_2448_3107 | 219 |
| 580 | 3300050507 | nmdc:mga05p37_714690_c1 | nmdc:mga05p37_714690_c1_199_858 | 219 |
| 581 | 3300050507 | nmdc:mga05p37_725372_c1 | nmdc:mga05p37_725372_c1_283_942 | 219 |
| 582 | 3300050508 | nmdc:mga09592_16549_c1 | nmdc:mga09592_16549_c1_2971_3630 | 219 |
| 583 | 3300050508 | nmdc:mga09592_511_c1 | nmdc:mga09592_511_c1_17812_18471 | 219 |
| 584 | 3300050509 | nmdc:mga0qj67_203_c1 | nmdc:mga0qj67_203_c1_22869_23528 | 219 |
| 585 | 3300050509 | nmdc:mga0qj67_747_c1 | nmdc:mga0qj67_747_c1_2743_3402 | 219 |
| 586 | 3300050510 | nmdc:mga06r32_26305_c1 | nmdc:mga06r32_26305_c1_678_1337 | 219 |
| 587 | 3300050510 | nmdc:mga06r32_269518_c1 | nmdc:mga06r32_269518_c1_697_1356 | 219 |
| 588 | 3300050510 | nmdc:mga06r32_3064_c1 | nmdc:mga06r32_3064_c1_2068_2727 | 219 |
| 589 | 3300050511 | nmdc:mga08y16_35481_c1 | nmdc:mga08y16_35481_c1_1087_1746 | 219 |
| 590 | 3300050512 | nmdc:mga0n895_321580_c1 | nmdc:mga0n895_321580_c1_602_1261 | 219 |
| 591 | 3300050512 | nmdc:mga0n895_469395_c1 | nmdc:mga0n895_469395_c1_363_1022 | 219 |
| 592 | 3300050512 | nmdc:mga0n895_52345_c1 | nmdc:mga0n895_52345_c1_1127_1786 | 219 |
| 593 | 3300050512 | nmdc:mga0n895_62932_c1 | nmdc:mga0n895_62932_c1_1608_2267 | 219 |
| 594 | 3300050513 | nmdc:mga0rr50_192338_c1 | nmdc:mga0rr50_192338_c1_966_1625 | 219 |
| 595 | 3300050513 | nmdc:mga0rr50_20450_c1 | nmdc:mga0rr50_20450_c1_3295_3954 | 219 |
| 596 | 3300050513 | nmdc:mga0rr50_33438_c1 | nmdc:mga0rr50_33438_c1_2667_3326 | 219 |
| 597 | 3300050513 | nmdc:mga0rr50_68667_c1 | nmdc:mga0rr50_68667_c1_1597_2256 | 219 |
| 598 | 3300050514 | nmdc:mga08x19_29708_c1 | nmdc:mga08x19_29708_c1_1343_2002 | 219 |
| 599 | 3300050514 | nmdc:mga08x19_41223_c1 | nmdc:mga08x19_41223_c1_244_903 | 219 |
| 600 | 3300050515 | nmdc:mga0a205_19486_c1 | nmdc:mga0a205_19486_c1_2554_3213 | 219 |
| 601 | 3300050515 | nmdc:mga0a205_21654_c1 | nmdc:mga0a205_21654_c1_4154_4813 | 219 |
| 602 | 3300050515 | nmdc:mga0a205_34641_c1 | nmdc:mga0a205_34641_c1_3440_4099 | 219 |
| 603 | 3300050515 | nmdc:mga0a205_64330_c2 | nmdc:mga0a205_64330_c2_244_903 | 219 |
| 604 | 3300053730 | Ga0500645_001329 | Ga0500645_001329_4099_4770 | 219 |
| 605 | 3300054114 | Ga0501084_0234988 | Ga0501084_0234988_192_851 | 219 |
| 606 | 3300060353 | Ga0501082_0463987 | Ga0501082_0463987_96_761 | 219 |
| 607 | 3300061734 | Ga0530510_0097460 | Ga0530510_0097460_1425_2090 | 219 |
| 608 | 3300061734 | Ga0530510_0244730 | Ga0530510_0244730_454_1113 | 219 |
| 609 | 3300002987 | JGI25159J45721_1017318 | JGI25159J45721_10173181 | 220 |
| 610 | 3300003784 | Ga0055534_1001421 | Ga0055534_10014219 | 220 |
| 611 | 3300025291 | Ga0209675_1010530 | Ga0209675_10105302 | 220 |
| 612 | 3300025292 | Ga0209676_1007736 | Ga0209676_10077365 | 220 |
| 613 | 3300025294 | Ga0209025_1038293 | Ga0209025_10382932 | 220 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hjp-assembly2.cif.gz_D | the crystal structure of bcp4 from sulfolobus solfataricus | 0.8471 | 11 | 220 |
| 1st9-assembly2.cif.gz_B | crystal structure of a soluble domain of resa in the oxidised form | 0.8458 | 15 | 217 |
| 2h1b-assembly2.cif.gz_B | resa e80q | 0.8401 | 14 | 217 |
| 3hjp-assembly2.cif.gz_D | the crystal structure of bcp4 from sulfolobus solfataricus | 0.8371 | 11 | 220 |
| 2h19-assembly2.cif.gz_B | crystal structure of resa cys77ala variant | 0.8365 | 15 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WIE1_7_157_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8744 | 11 | 191 | 3.40.30.10 |
| af_Q54W30_4_152_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8426 | 9 | 220 | 3.40.30.10 |
| af_Q54W30_4_152_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8373 | 9 | 220 | 3.40.30.10 |
| af_I1MS47_66_213_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8317 | 11 | 220 | 3.40.30.10 |
| af_Q559T9_1_157_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8315 | 11 | 220 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529IE62-F1-model_v4 | AhpC/TSA family protein | 0.9586 | 10 | 118 |
GO:0016209
GO:0016491 |
| AF-A0A529GK77-F1-model_v4 | AhpC/TSA family protein | 0.9173 | 10 | 180 |
GO:0016209
GO:0016491 |
| AF-A0A2Z3G7S6-F1-model_v4 | deleted | 0.9105 | 31 | 217 |
|
| AF-A0A523TGT1-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9101 | 11 | 114 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A554IUS4-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9046 | 14 | 114 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar