F469293

General Info

Members Datasets Scaffolds Average Seq Length
613 257 547 357

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0000912|Ga0495668_0000912_21599_22849
Length 416
Sequence MEFFEKLASLAAKVRLQSAAIQTEEATKNAFVMPFISTVLGYDVFDPTEVTPEFVCDVGTKKGEKIDYAIMKGGEVQILIECKKIGEPLHINHASQLFRYFHVTSARISILTNGQVYKFFTDLDAPNKMDEKPFLELDLLDIDEYSVPELVKLTKSAFDVDSIINAAGELKYVSQIKKVIAAQVSKPDDDFVKVFASRVYDGVITQKVREQFHELTRKAVAQFLNDQINERLKSAMSGAIAQALVPVPTASGGTDPLVPGDESDDKIITTLEELEGYHIVRALVRSVVDAKRIVQRDTQSYFGILLDDNNRKPICRLHFNRSQKYIGIFDEEKNETRHPISTVDDIYEYSDHLKKRLGTTPDNKPALGGRFFIAYSVISMPTVQLKYPTASHCWFTSMKLNSHCSTPIPFAVQAQK

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231016 Pseudomonas sp. GM50 Isolate Nodule
5 2511231023 Pseudomonas sp. GM80 Isolate Nodule
6 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
7 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
8 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
9 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
10 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
11 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
12 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
13 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
14 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
15 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
16 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
17 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
18 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
19 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
20 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
21 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
22 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
23 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
24 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
25 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
26 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
27 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
28 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
29 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
30 2739367653 Kocuria sp. OV113 Isolate Unclassified
31 2773857670 Pseudomonas sp. 478 Isolate Unclassified
32 2784132063 Pseudomonas sp. 424 Isolate Unclassified
33 2784132072 Pseudomonas sp. 460 Isolate Unclassified
34 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
35 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
36 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
37 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
38 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
39 2865014394 Pantoea sp. R-71966 Isolate Unclassified
40 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
41 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
42 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
43 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
44 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
45 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
46 2919150387 Rahnella aceris 1817 Isolate Unclassified
47 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
48 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
49 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
50 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
51 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
52 2927143783 Rahnella sp. 2050 Isolate Unclassified
53 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
54 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
55 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
56 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
57 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
58 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
59 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
60 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
61 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
62 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
63 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
64 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
65 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
66 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
67 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
68 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
69 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
70 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
71 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
72 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
73 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
74 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
75 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
76 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
77 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
78 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
79 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
80 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
129 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
134 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
135 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
136 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
147 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
148 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
149 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
152 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
153 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
154 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
155 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
156 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
157 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
158 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
159 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
160 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
161 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
162 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
163 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
164 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
165 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
166 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
167 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
168 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
169 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
170 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
171 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
172 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
173 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
176 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
179 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
184 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
187 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
188 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
192 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
195 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
200 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
223 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
224 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
225 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
226 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
227 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
245 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
246 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
247 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
250 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
251 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
252 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
253 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
254 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
255 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
256 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
257 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.23
Metatranscriptomes 0
Isolates 10.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.53
Nodule 1.79
Rhizoplane 3.1
Rhizosphere 69.49
Stem 0
Stem Tuber 0
Unclassified 19.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_9794 2124908027 Bacteria 1432
2 SwRhRL2b_contig_1005263 2162886007 Bacteria 10829
3 SwRhRL2b_contig_3072008 2162886007 Bacteria 2560
4 SwRhRL2b_contig_3949486 2162886007 Bacteria 15614
5 JGI25158J39367_1010157 3300002739 Bacteria 1275
6 JGI25159J45721_1020436 3300002987 Bacteria 1275
7 rootH2_10097397 3300003320 Bacteria 1598
8 rootL2_10048779 3300003322 Bacteria 10944
9 JGI25160J50197_1033941 3300003354 Bacteria 1275
10 JGI25161J50226_1010185 3300003374 Bacteria 1275
11 Ga0055536_1000043 3300003781 Bacteria 124663
12 Ga0055536_1000227 3300003781 Bacteria 45421
13 Ga0055530_10000031 3300003791 Bacteria 122117
14 Ga0055530_10000094 3300003791 Bacteria 76102
15 Ga0055530_10003114 3300003791 Bacteria 9819
16 Ga0055530_10009354 3300003791 Bacteria 3777
17 Ga0055540_1000130 3300003792 Bacteria 76102
18 Ga0055540_1000161 3300003792 Bacteria 66740
19 Ga0055540_1000442 3300003792 Bacteria 32585
20 Ga0055531_10002314 3300003794 Bacteria 12876
21 Ga0055531_10036799 3300003794 Bacteria 1501
22 Ga0058692_1013240 3300003856 Bacteria 1927
23 Ga0055543_1018187 3300004625 Bacteria 1313
24 Ga0065165_1043736 3300005262 Bacteria 1313
25 Ga0065714_10074817 3300005288 Bacteria 2984
26 Ga0065704_10001369 3300005289 Bacteria 18211
27 Ga0065704_10070477 3300005289 Bacteria 23323
28 Ga0065704_10070553 3300005289 Bacteria 20806
29 Ga0065704_10141131 3300005289 Bacteria 1517
30 Ga0065704_10157362 3300005289 Bacteria 1381
31 Ga0070658_10096114 3300005327 Bacteria 2446
32 Ga0070668_100105264 3300005347 Bacteria 2240
33 Ga0070669_100002540 3300005353 Bacteria 13189
34 Ga0070662_100005940 3300005457 Bacteria 7828
35 Ga0070686_100000055 3300005544 Bacteria 89101
36 Ga0070665_100148574 3300005548 Bacteria 2346
37 Ga0068854_100004716 3300005578 Bacteria 8591
38 Ga0068856_100115611 3300005614 Bacteria 2683
39 Ga0068856_100218934 3300005614 Bacteria 1919
40 Ga0081539_10000132 3300005985 Bacteria 175454
41 Ga0075364_10047485 3300006051 Bacteria 2797
42 Ga0075364_10096578 3300006051 Bacteria 1965
43 Ga0075364_10129909 3300006051 Bacteria 1690
44 Ga0075436_100169880 3300006914 Bacteria 1540
45 Ga0079104_1000059 3300006946 Bacteria 162642
46 Ga0079104_1003509 3300006946 Bacteria 7240
47 Ga0079104_1014022 3300006946 Bacteria 2439
48 Ga0105251_10000018 3300009011 Bacteria 142493
49 Ga0105251_10002673 3300009011 Bacteria 13730
50 Ga0105251_10004093 3300009011 Bacteria 10210
51 Ga0105251_10005208 3300009011 Bacteria 8572
52 Ga0105251_10013525 3300009011 Bacteria 4561
53 Ga0105251_10025143 3300009011 Bacteria 3050
54 Ga0105251_10050311 3300009011 Bacteria 1991
55 Ga0105251_10064115 3300009011 Bacteria 1723
56 Ga0105251_10065790 3300009011 Bacteria 1696
57 Ga0105251_10077312 3300009011 Bacteria 1543
58 Ga0105244_10020404 3300009036 Bacteria 3683
59 Ga0105244_10023005 3300009036 Bacteria 3424
60 Ga0105244_10034456 3300009036 Bacteria 2665
61 Ga0105244_10038057 3300009036 Bacteria 2510
62 Ga0105244_10042277 3300009036 Bacteria 2357
63 Ga0105244_10066366 3300009036 Bacteria 1806
64 Ga0105244_10068372 3300009036 Bacteria 1775
65 Ga0105244_10086097 3300009036 Bacteria 1550
66 Ga0105250_10002104 3300009092 Bacteria 10222
67 Ga0105250_10003350 3300009092 Bacteria 7614
68 Ga0105250_10008209 3300009092 Bacteria 4445
69 Ga0105250_10013409 3300009092 Bacteria 3376
70 Ga0105250_10045069 3300009092 Bacteria 1768
71 Ga0105250_10053992 3300009092 Bacteria 1611
72 Ga0105250_10057323 3300009092 Bacteria 1563
73 Ga0105250_10057832 3300009092 Bacteria 1556
74 Ga0105250_10075534 3300009092 Bacteria 1363
75 Ga0105247_10030070 3300009101 Bacteria 3293
76 Ga0105243_10000196 3300009148 Bacteria 71069
77 Ga0105248_10023148 3300009177 Bacteria 6899
78 Ga0105239_10071346 3300010375 Bacteria 3816
79 Ga0105246_10084034 3300011119 Bacteria 2276
80 Ga0157373_10010108 3300013100 Bacteria 6951
81 Ga0157373_10015814 3300013100 Bacteria 5509
82 Ga0157373_10019922 3300013100 Bacteria 4880
83 Ga0157373_10021580 3300013100 Bacteria 4676
84 Ga0157373_10055505 3300013100 Bacteria 2814
85 Ga0157373_10131247 3300013100 Bacteria 1762
86 Ga0157371_10000044 3300013102 Bacteria 194689
87 Ga0157371_10024651 3300013102 Bacteria 4390
88 Ga0157371_10046556 3300013102 Bacteria 3085
89 Ga0157371_10083121 3300013102 Bacteria 2267
90 Ga0157371_10116206 3300013102 Bacteria 1901
91 Ga0157371_10146160 3300013102 Bacteria 1685
92 Ga0157370_10036532 3300013104 Bacteria 4767
93 Ga0157370_10164421 3300013104 Bacteria 2064
94 Ga0157370_10208633 3300013104 Bacteria 1811
95 Ga0157370_10373829 3300013104 Bacteria 1313
96 Ga0157369_10015985 3300013105 Bacteria 8444
97 Ga0157369_10072450 3300013105 Unclassified 3698
98 Ga0157369_10089027 3300013105 Bacteria 3296
99 Ga0157369_10164169 3300013105 Bacteria 2343
100 Ga0163162_10183455 3300013306 Bacteria 2219
101 Ga0163162_10203791 3300013306 Bacteria 2107
102 Ga0163162_10309922 3300013306 Bacteria 1711
103 Ga0157372_10001040 3300013307 Bacteria 30363
104 Ga0157372_10033066 3300013307 Bacteria 5677
105 Ga0157372_10039970 3300013307 Bacteria 5179
106 Ga0157372_10044327 3300013307 Bacteria 4928
107 Ga0157372_10295859 3300013307 Bacteria 1883
108 Ga0182008_10006185 3300014497 Bacteria 6727
109 Ga0182008_10110299 3300014497 Bacteria 1363
110 Ga0182006_1004345 3300015261 Bacteria 7007
111 Ga0182006_1034341 3300015261 Bacteria 2029
112 Ga0182006_1039090 3300015261 Bacteria 1874
113 Ga0182006_1050282 3300015261 Bacteria 1606
114 Ga0182006_1050738 3300015261 Bacteria 1598
115 Ga0182006_1057056 3300015261 Bacteria 1486
116 Ga0182007_10045959 3300015262 Bacteria 1446
117 Ga0182007_10051157 3300015262 Bacteria 1363
118 Ga0182005_1025302 3300015265 Bacteria 1620
119 Ga0182005_1025554 3300015265 Bacteria 1612
120 Ga0163161_10000522 3300017792 Bacteria 31370
121 Ga0163161_10019422 3300017792 Bacteria 4767
122 Ga0163161_10024826 3300017792 Bacteria 4237
123 Ga0163161_10034810 3300017792 Bacteria 3603
124 Ga0163161_10125147 3300017792 Bacteria 1935
125 Ga0163161_10150498 3300017792 Bacteria 1768
126 Ga0163161_10181253 3300017792 Bacteria 1615
127 Ga0209436_113554 3300025208 Bacteria 1327
128 Ga0209130_1024229 3300025284 Bacteria 1327
129 Ga0209676_1000016 3300025292 Bacteria 655561
130 Ga0209676_1000080 3300025292 Bacteria 287400
131 Ga0209676_1003039 3300025292 Bacteria 10848
132 Ga0209050_1000036 3300025298 Bacteria 423070
133 Ga0209050_1000079 3300025298 Bacteria 277803
134 Ga0209050_1000117 3300025298 Bacteria 202979
135 Ga0209050_1024119 3300025298 Bacteria 2117
136 Ga0209050_1033293 3300025298 Bacteria 1565
137 Ga0207426_1045871 3300025302 Bacteria 1327
138 Ga0209051_1000054 3300025303 Bacteria 280804
139 Ga0209051_1000077 3300025303 Bacteria 202959
140 Ga0209051_1000094 3300025303 Bacteria 168538
141 Ga0209257_1000173 3300025304 Bacteria 166678
142 Ga0209257_1007132 3300025304 Bacteria 6874
143 Ga0207696_1000083 3300025711 Bacteria 197352
144 Ga0207696_1000743 3300025711 Bacteria 21773
145 Ga0207696_1001411 3300025711 Bacteria 13119
146 Ga0207696_1013861 3300025711 Bacteria 2785
147 Ga0207696_1016192 3300025711 Bacteria 2501
148 Ga0207696_1017157 3300025711 Bacteria 2404
149 Ga0207696_1031031 3300025711 Bacteria 1619
150 Ga0207696_1031891 3300025711 Bacteria 1590
151 Ga0207696_1032936 3300025711 Bacteria 1556
152 Ga0207696_1041765 3300025711 Bacteria 1339
153 Ga0207655_1001403 3300025728 Bacteria 22459
154 Ga0207655_1011841 3300025728 Bacteria 5153
155 Ga0207655_1032478 3300025728 Bacteria 2384
156 Ga0207655_1035622 3300025728 Bacteria 2219
157 Ga0207655_1037386 3300025728 Bacteria 2138
158 Ga0207655_1055445 3300025728 Bacteria 1569
159 Ga0207713_1000156 3300025735 Bacteria 102640
160 Ga0207713_1002302 3300025735 Bacteria 14047
161 Ga0207713_1002375 3300025735 Bacteria 13763
162 Ga0207713_1003752 3300025735 Bacteria 10202
163 Ga0207713_1007149 3300025735 Bacteria 6660
164 Ga0207713_1019263 3300025735 Bacteria 3346
165 Ga0207713_1031916 3300025735 Bacteria 2321
166 Ga0207713_1042771 3300025735 Bacteria 1878
167 Ga0207710_10015947 3300025900 Bacteria 3177
168 Ga0207705_10053797 3300025909 Bacteria 2901
169 Ga0207681_10000386 3300025923 Bacteria 30907
170 Ga0207706_10000056 3300025933 Bacteria 113022
171 Ga0207709_10273025 3300025935 Bacteria 1245
172 Ga0207711_10075864 3300025941 Bacteria 2927
173 Ga0207668_10206358 3300025972 Bacteria 1568
174 Ga0207640_10040147 3300025981 Bacteria 2966
175 Ga0207702_10087537 3300026078 Bacteria 2719
176 Ga0209281_1000065 3300027111 Bacteria 285579
177 Ga0209281_1000774 3300027111 Bacteria 30468
178 Ga0209281_1001095 3300027111 Bacteria 19831
179 Ga0209281_1013296 3300027111 Bacteria 1781
180 Ga0209371_1004524 3300027312 Bacteria 5980
181 Ga0207428_10037980 3300027907 Bacteria 3918
182 Ga0207428_10087366 3300027907 Bacteria 2426
183 Ga0207428_10147699 3300027907 Bacteria 1791
184 Ga0268266_10028121 3300028379 Bacteria 4780
185 Ga0307515_10007850 3300028794 Bacteria 20974
186 Ga0268256_1002736 3300030500 Bacteria 8617
187 Ga0307512_10005973 3300030522 Bacteria 12497
188 Ga0316179_1110150 3300030734 Bacteria 4866
189 Ga0316183_1130390 3300030742 Bacteria 4308
190 Ga0265331_10071876 3300031250 Bacteria 1617
191 Ga0265327_10000027 3300031251 Bacteria 364541
192 Ga0307408_100021721 3300031548 Bacteria 4347
193 Ga0307408_100139095 3300031548 Bacteria 1904
194 Ga0307408_100244184 3300031548 Bacteria 1477
195 Ga0307405_10052513 3300031731 Bacteria 2535
196 Ga0307412_10134311 3300031911 Bacteria 1802
197 Ga0307412_10136999 3300031911 Bacteria 1787
198 Ga0307416_100207862 3300032002 Bacteria 1864
199 Ga0307414_10138002 3300032004 Bacteria 1904
200 Ga0307510_10000338 3300033180 Bacteria 43774
201 Ga0373925_0008930 3300037068 Bacteria 7302
202 Ga0237819_00554 3300038705 Bacteria 12547
203 Ga0400488_22115 3300038741 Bacteria 2576
204 Ga0400483_090640 3300039062 Bacteria 2178
205 Ga0400487_00700 3300039110 Viruses 1379
206 Ga0436365_0192868 3300039437 Unclassified 1236
207 Ga0439438_000005 3300041405 Bacteria 408610
208 Ga0439438_000184 3300041405 Bacteria 28007
209 Ga0439438_000885 3300041405 Bacteria 13347
210 Ga0439438_000924 3300041405 Bacteria 13114
211 Ga0439438_001047 3300041405 Bacteria 12316
212 Ga0439438_002883 3300041405 Bacteria 7148
213 Ga0439438_009382 3300041405 Bacteria 3170
214 Ga0439438_026376 3300041405 Bacteria 1575
215 Ga0439438_031273 3300041405 Bacteria 1415
216 Ga0439447_001821 3300041407 Bacteria 7815
217 Ga0439447_002560 3300041407 Bacteria 6614
218 Ga0439447_008514 3300041407 Bacteria 3170
219 Ga0439447_020958 3300041407 Bacteria 1726
220 Ga0439447_029690 3300041407 Bacteria 1382
221 Ga0439466_0001623 3300041411 Bacteria 8788
222 Ga0439466_0001754 3300041411 Bacteria 8488
223 Ga0439466_0008936 3300041411 Bacteria 3766
224 Ga0439466_0012203 3300041411 Bacteria 3170
225 Ga0439466_0041683 3300041411 Bacteria 1530
226 Ga0439466_0046282 3300041411 Bacteria 1437
227 Ga0439431_0000041 3300041997 Bacteria 18802
228 Ga0439432_001733 3300042006 Bacteria 8167
229 Ga0439432_010745 3300042006 Bacteria 3165
230 Ga0439432_023362 3300042006 Bacteria 2037
231 Ga0439432_036324 3300042006 Bacteria 1576
232 Ga0439451_001507 3300042009 Bacteria 4595
233 Ga0439451_014899 3300042009 Bacteria 1568
234 Ga0439452_001380 3300042010 Bacteria 10001
235 Ga0439452_002007 3300042010 Bacteria 7786
236 Ga0439452_008144 3300042010 Bacteria 3170
237 Ga0439452_023712 3300042010 Bacteria 1576
238 Ga0439456_015828 3300042013 Bacteria 1576
239 Ga0439463_025361 3300042016 Bacteria 1487
240 Ga0450911_000245 3300042115 Bacteria 20565
241 Ga0450920_000596 3300042122 Bacteria 5776
242 Ga0450922_000143 3300042124 Bacteria 7452
243 Ga0450923_007593 3300042125 Bacteria 1840
244 Ga0450890_000068 3300042127 Bacteria 18424
245 Ga0450902_001595 3300042137 Bacteria 3114
246 Ga0450903_008948 3300042138 Bacteria 1636
247 Ga0450906_008647 3300042145 Bacteria 1963
248 Ga0450906_012847 3300042145 Bacteria 1549
249 Ga0450907_000007 3300042146 Bacteria 111445
250 Ga0450907_000041 3300042146 Bacteria 56455
251 Ga0450907_000756 3300042146 Bacteria 8178
252 Ga0450908_007783 3300042184 Bacteria 2013
253 Ga0450909_000107 3300042185 Bacteria 8225
254 Ga0450909_001186 3300042185 Bacteria 3618
255 Ga0439434_0000029 3300042435 Bacteria 35254
256 Ga0439464_0013526 3300042439 Bacteria 2186
257 Ga0439460_0031142 3300042461 Bacteria 1520
258 Ga0453684_0087962 3300044712 Bacteria 3848
259 Ga0495617_002507 3300046452 Bacteria 7276
260 Ga0495617_013335 3300046452 Bacteria 2796
261 Ga0495617_052904 3300046452 Bacteria 1348
262 Ga0495627_000004 3300046453 Bacteria 640612
263 Ga0495627_001368 3300046453 Bacteria 14562
264 Ga0495603_0036482 3300046455 Bacteria 2952
265 Ga0495603_0054772 3300046455 Bacteria 2363
266 Ga0495603_0061474 3300046455 Bacteria 2218
267 Ga0495590_0014217 3300046457 Bacteria 2909
268 Ga0495591_000831 3300046458 Bacteria 21826
269 Ga0495591_030883 3300046458 Bacteria 1613
270 Ga0495638_0001131 3300046460 Bacteria 25808
271 Ga0495638_0001939 3300046460 Bacteria 17744
272 Ga0495638_0004663 3300046460 Bacteria 10367
273 Ga0495638_0005491 3300046460 Bacteria 9425
274 Ga0495638_0043347 3300046460 Bacteria 2838
275 Ga0495638_0139333 3300046460 Bacteria 1417
276 Ga0495653_0021455 3300046463 Bacteria 5232
277 Ga0495650_0000039 3300046471 Bacteria 375501
278 Ga0495650_0000062 3300046471 Bacteria 277977
279 Ga0495650_0000816 3300046471 Bacteria 37924
280 Ga0495650_0001935 3300046471 Bacteria 18335
281 Ga0495650_0002360 3300046471 Bacteria 15511
282 Ga0495650_0008277 3300046471 Bacteria 6092
283 Ga0495650_0008585 3300046471 Bacteria 5934
284 Ga0495650_0008766 3300046471 Bacteria 5852
285 Ga0495650_0024018 3300046471 Bacteria 2888
286 Ga0495605_0000462 3300046474 Bacteria 36406
287 Ga0495605_0001071 3300046474 Bacteria 18244
288 Ga0495605_0022596 3300046474 Bacteria 3319
289 Ga0495605_0027577 3300046474 Bacteria 2942
290 Ga0495584_0007251 3300046491 Bacteria 5785
291 Ga0495584_0011458 3300046491 Bacteria 4541
292 Ga0495585_0000700 3300046492 Bacteria 30394
293 Ga0495585_0004622 3300046492 Bacteria 8888
294 Ga0495585_0015009 3300046492 Bacteria 4503
295 Ga0495585_0016684 3300046492 Bacteria 4254
296 Ga0495596_0000075 3300046500 Bacteria 69681
297 Ga0495596_0027193 3300046500 Bacteria 2301
298 Ga0495596_0036399 3300046500 Bacteria 1949
299 Ga0495607_0009695 3300046501 Bacteria 6501
300 Ga0495607_0017442 3300046501 Bacteria 4608
301 Ga0495607_0056504 3300046501 Bacteria 2253
302 Ga0495607_0075710 3300046501 Bacteria 1864
303 Ga0495607_0105234 3300046501 Bacteria 1504
304 Ga0495583_0009215 3300046506 Bacteria 5920
305 Ga0495583_0034634 3300046506 Bacteria 2416
306 Ga0495606_0000042 3300046507 Bacteria 215099
307 Ga0495606_0000740 3300046507 Bacteria 50470
308 Ga0495606_0001625 3300046507 Bacteria 29285
309 Ga0495606_0005303 3300046507 Bacteria 12414
310 Ga0495606_0008195 3300046507 Bacteria 9142
311 Ga0495610_0002069 3300046512 Bacteria 17119
312 Ga0495610_0021524 3300046512 Bacteria 3545
313 Ga0495616_0003396 3300046513 Bacteria 10208
314 Ga0495620_0000517 3300046515 Bacteria 24926
315 Ga0495631_0014295 3300046518 Bacteria 3835
316 Ga0495632_0000341 3300046519 Bacteria 44339
317 Ga0495632_0003301 3300046519 Bacteria 11512
318 Ga0495632_0011627 3300046519 Bacteria 5126
319 Ga0495632_0017012 3300046519 Bacteria 4027
320 Ga0495632_0052568 3300046519 Bacteria 2002
321 Ga0495637_0000580 3300046520 Bacteria 26042
322 Ga0495637_0003015 3300046520 Bacteria 9028
323 Ga0495637_0003021 3300046520 Bacteria 9022
324 Ga0495637_0003198 3300046520 Bacteria 8740
325 Ga0495637_0018560 3300046520 Bacteria 3225
326 Ga0495637_0042764 3300046520 Bacteria 1937
327 Ga0495643_0019970 3300046522 Bacteria 3870
328 Ga0495643_0038900 3300046522 Bacteria 2602
329 Ga0495643_0050158 3300046522 Bacteria 2248
330 Ga0495643_0088949 3300046522 Bacteria 1595
331 Ga0495648_0000314 3300046524 Bacteria 53429
332 Ga0495648_0001666 3300046524 Bacteria 21528
333 Ga0495648_0013206 3300046524 Bacteria 6121
334 Ga0495648_0043728 3300046524 Bacteria 2804
335 Ga0495648_0096684 3300046524 Bacteria 1640
336 Ga0495648_0099588 3300046524 Bacteria 1607
337 Ga0495654_0000675 3300046530 Bacteria 26908
338 Ga0495654_0002824 3300046530 Bacteria 10915
339 Ga0495654_0005902 3300046530 Bacteria 7043
340 Ga0495654_0009990 3300046530 Bacteria 5183
341 Ga0495654_0013066 3300046530 Bacteria 4448
342 Ga0495654_0016270 3300046530 Bacteria 3936
343 Ga0495654_0019402 3300046530 Bacteria 3556
344 Ga0495654_0026620 3300046530 Bacteria 2971
345 Ga0495654_0053951 3300046530 Bacteria 1951
346 Ga0495654_0059454 3300046530 Bacteria 1840
347 Ga0495654_0087111 3300046530 Bacteria 1454
348 Ga0495609_0041257 3300046538 Bacteria 2074
349 Ga0495609_0052735 3300046538 Bacteria 1809
350 Ga0495597_0000832 3300046542 Bacteria 24275
351 Ga0495597_0032994 3300046542 Bacteria 2347
352 Ga0495597_0064653 3300046542 Bacteria 1588
353 Ga0495622_0000441 3300046557 Bacteria 26822
354 Ga0495622_0055220 3300046557 Bacteria 1842
355 Ga0495622_0065299 3300046557 Bacteria 1682
356 Ga0495622_0068462 3300046557 Bacteria 1639
357 Ga0495633_0000443 3300046558 Bacteria 42796
358 Ga0495633_0001797 3300046558 Bacteria 15826
359 Ga0495633_0006287 3300046558 Bacteria 7076
360 Ga0495656_0006368 3300046615 Bacteria 4139
361 Ga0495668_0000195 3300046616 Bacteria 89153
362 Ga0495668_0000912 3300046616 Bacteria 33069
363 Ga0495668_0072747 3300046616 Bacteria 1888
364 Ga0495634_0001010 3300046642 Bacteria 26441
365 Ga0495611_0066639 3300046648 Bacteria 1642
366 Ga0495625_0011256 3300046660 Bacteria 7315
367 Ga0495625_0030955 3300046660 Bacteria 3985
368 Ga0495625_0057807 3300046660 Bacteria 2757
369 Ga0495625_0126720 3300046660 Bacteria 1732
370 Ga0495661_0001080 3300046665 Bacteria 23989
371 Ga0495661_0013577 3300046665 Bacteria 5467
372 Ga0495646_0037110 3300046680 Bacteria 3017
373 Ga0495669_0004460 3300046684 Bacteria 5782
374 Ga0495613_0006736 3300046689 Bacteria 8579
375 Ga0495670_0000132 3300046691 Bacteria 32251
376 Ga0495670_0000533 3300046691 Bacteria 18075
377 Ga0495670_0002962 3300046691 Bacteria 8379
378 Ga0495670_0010627 3300046691 Bacteria 4523
379 Ga0495671_0008074 3300046692 Bacteria 5942
380 Ga0495671_0012558 3300046692 Bacteria 4621
381 Ga0495671_0020654 3300046692 Bacteria 3468
382 Ga0495649_0000601 3300046694 Bacteria 29997
383 Ga0495649_0004465 3300046694 Bacteria 9141
384 Ga0495649_0004494 3300046694 Bacteria 9102
385 Ga0495649_0008493 3300046694 Bacteria 6172
386 Ga0495649_0009591 3300046694 Bacteria 5740
387 Ga0495649_0028318 3300046694 Bacteria 3105
388 Ga0495649_0035581 3300046694 Bacteria 2739
389 Ga0495649_0069870 3300046694 Bacteria 1883
390 Ga0495649_0084628 3300046694 Bacteria 1693
391 Ga0495649_0116169 3300046694 Bacteria 1416
392 Ga0495589_0009643 3300046794 Bacteria 5019
393 Ga0495589_0016301 3300046794 Bacteria 3819
394 Ga0495589_0018848 3300046794 Bacteria 3538
395 Ga0495589_0030018 3300046794 Bacteria 2739
396 Ga0495589_0070295 3300046794 Bacteria 1711
397 Ga0495600_0016587 3300046809 Bacteria 4677
398 Ga0495660_0000023 3300046810 Bacteria 272605
399 Ga0495660_0001485 3300046810 Bacteria 15910
400 Ga0495660_0001575 3300046810 Bacteria 15325
401 Ga0495660_0006210 3300046810 Bacteria 7088
402 Ga0495660_0022046 3300046810 Bacteria 3640
403 Ga0495660_0031638 3300046810 Bacteria 2974
404 Ga0495660_0051560 3300046810 Bacteria 2238
405 Ga0495660_0066268 3300046810 Bacteria 1926
406 Ga0495660_0068246 3300046810 Bacteria 1892
407 Ga0495604_0034209 3300047317 Bacteria 4021
408 Ga0495636_0031142 3300047318 Bacteria 2185
409 Ga0495672_0000011 3300047320 Bacteria 535362
410 Ga0495672_0000040 3300047320 Bacteria 268573
411 Ga0495672_0004581 3300047320 Bacteria 11236
412 Ga0495672_0005408 3300047320 Bacteria 10141
413 Ga0495672_0006402 3300047320 Bacteria 9138
414 Ga0495672_0013359 3300047320 Bacteria 5670
415 Ga0495680_0099303 3300047322 Bacteria 2171
416 Ga0495680_0181572 3300047322 Bacteria 1518
417 Ga0495683_0011030 3300047323 Bacteria 4765
418 Ga0495683_0027714 3300047323 Bacteria 2896
419 Ga0495683_0038662 3300047323 Bacteria 2415
420 Ga0495683_0053665 3300047323 Bacteria 2010
421 Ga0495683_0092195 3300047323 Bacteria 1466
422 Ga0495687_003347 3300047443 Bacteria 11716
423 Ga0495687_008029 3300047443 Bacteria 6100
424 Ga0495677_0000197 3300047445 Bacteria 27861
425 Ga0495679_000016 3300047446 Bacteria 282024
426 Ga0495679_001724 3300047446 Bacteria 12087
427 Ga0495679_027265 3300047446 Bacteria 1888
428 Ga0495673_0000128 3300047469 Bacteria 139672
429 Ga0495673_0000535 3300047469 Bacteria 39346
430 Ga0495673_0003340 3300047469 Bacteria 10624
431 Ga0495673_0008062 3300047469 Bacteria 5968
432 Ga0495673_0010611 3300047469 Bacteria 4999
433 Ga0495673_0023571 3300047469 Bacteria 2991
434 Ga0495681_0001336 3300047470 Bacteria 18599
435 Ga0495681_0031690 3300047470 Bacteria 2672
436 Ga0495681_0071721 3300047470 Bacteria 1567
437 Ga0495686_0011529 3300047472 Bacteria 6226
438 Ga0495686_0032512 3300047472 Bacteria 3376
439 Ga0495626_0000724 3300048091 Bacteria 30862
440 Ga0495626_0001079 3300048091 Bacteria 23225
441 Ga0495626_0006789 3300048091 Bacteria 6469
442 Ga0495626_0011234 3300048091 Bacteria 4743
443 Ga0495626_0012066 3300048091 Bacteria 4546
444 Ga0495626_0044571 3300048091 Bacteria 2074
445 Ga0496104_0000219 3300048907 Bacteria 50064
446 Ga0496110_0455239 3300048913 Viruses 1166
447 Ga0496114_0026083 3300048917 Bacteria 4782
448 Ga0496116_0000126 3300048919 Bacteria 160425
449 Ga0496116_0000917 3300048919 Bacteria 36435
450 Ga0496116_0002322 3300048919 Bacteria 20140
451 Ga0496116_0031758 3300048919 Bacteria 3774
452 Ga0496116_0055569 3300048919 Bacteria 2599
453 Ga0496117_0000623 3300048920 Bacteria 57364
454 Ga0496117_0001894 3300048920 Bacteria 28078
455 Ga0496117_0002812 3300048920 Bacteria 21197
456 Ga0496117_0003267 3300048920 Bacteria 19056
457 Ga0496117_0006508 3300048920 Bacteria 11779
458 Ga0496117_0014842 3300048920 Bacteria 6684
459 Ga0496117_0030304 3300048920 Bacteria 4154
460 Ga0496117_0047327 3300048920 Bacteria 3084
461 Ga0496117_0060838 3300048920 Bacteria 2599
462 Ga0496117_0077044 3300048920 Bacteria 2208
463 Ga0496118_0000684 3300048921 Bacteria 55100
464 Ga0496118_0002921 3300048921 Bacteria 22204
465 Ga0496118_0018165 3300048921 Bacteria 6354
466 Ga0496118_0024582 3300048921 Bacteria 5195
467 Ga0496118_0024735 3300048921 Bacteria 5172
468 Ga0496118_0035528 3300048921 Bacteria 4044
469 Ga0496118_0073296 3300048921 Bacteria 2453
470 Ga0496118_0087208 3300048921 Bacteria 2165
471 Ga0496118_0141078 3300048921 Bacteria 1527
472 Ga0496119_0005609 3300048922 Bacteria 11934
473 Ga0496119_0023365 3300048922 Bacteria 4388
474 Ga0496119_0028163 3300048922 Bacteria 3841
475 Ga0496119_0031604 3300048922 Bacteria 3545
476 Ga0496119_0053682 3300048922 Bacteria 2459
477 Ga0496119_0063175 3300048922 Bacteria 2203
478 Ga0496119_0094724 3300048922 Bacteria 1688
479 Ga0496120_0011119 3300048923 Bacteria 6212
480 Ga0496120_0014868 3300048923 Bacteria 5161
481 Ga0496120_0049105 3300048923 Bacteria 2423
482 Ga0496120_0095202 3300048923 Bacteria 1583
483 Ga0496120_0108003 3300048923 Bacteria 1458
484 Ga0496121_0000142 3300048924 Bacteria 160072
485 Ga0496121_0001953 3300048924 Bacteria 32867
486 Ga0496121_0002695 3300048924 Bacteria 26553
487 Ga0496121_0002876 3300048924 Bacteria 25361
488 Ga0496121_0021741 3300048924 Bacteria 6268
489 Ga0496121_0037332 3300048924 Bacteria 4316
490 Ga0496121_0069120 3300048924 Bacteria 2852
491 Ga0496121_0107575 3300048924 Bacteria 2135
492 Ga0496121_0111843 3300048924 Bacteria 2081
493 Ga0496122_0000067 3300048925 Bacteria 231365
494 Ga0496122_0030111 3300048925 Bacteria 4557
495 Ga0496122_0032105 3300048925 Bacteria 4349
496 Ga0496122_0045063 3300048925 Bacteria 3432
497 Ga0496122_0048097 3300048925 Bacteria 3284
498 Ga0496122_0049728 3300048925 Bacteria 3205
499 Ga0496122_0062428 3300048925 Bacteria 2727
500 Ga0496122_0090762 3300048925 Bacteria 2083
501 Ga0496122_0132471 3300048925 Bacteria 1580
502 Ga0496123_0000056 3300048926 Bacteria 231365
503 Ga0496123_0036238 3300048926 Bacteria 3501
504 Ga0496123_0036286 3300048926 Bacteria 3498
505 Ga0496123_0044396 3300048926 Bacteria 3040
506 Ga0496123_0048318 3300048926 Bacteria 2863
507 Ga0496123_0078730 3300048926 Bacteria 2017
508 Ga0496123_0105311 3300048926 Bacteria 1628
509 Ga0496124_0000251 3300048927 Bacteria 103690
510 Ga0496124_0002208 3300048927 Bacteria 25928
511 Ga0496124_0003628 3300048927 Bacteria 18738
512 Ga0496124_0055658 3300048927 Bacteria 3341
513 Ga0496124_0063002 3300048927 Bacteria 3100
514 Ga0496124_0069474 3300048927 Bacteria 2924
515 Ga0496124_0109298 3300048927 Bacteria 2228
516 Ga0496124_0197210 3300048927 Bacteria 1534
517 Ga0496124_0281381 3300048927 Bacteria 1212
518 Ga0496125_0000183 3300048928 Bacteria 137652
519 Ga0496125_0013810 3300048928 Bacteria 7910
520 Ga0496125_0014700 3300048928 Bacteria 7607
521 Ga0496125_0017357 3300048928 Bacteria 6865
522 Ga0496125_0018757 3300048928 Bacteria 6556
523 Ga0496125_0024596 3300048928 Bacteria 5533
524 Ga0496125_0029031 3300048928 Bacteria 4979
525 Ga0496125_0055869 3300048928 Bacteria 3211
526 Ga0496125_0077437 3300048928 Bacteria 2563
527 Ga0496126_0008717 3300048929 Bacteria 10892
528 Ga0496126_0032838 3300048929 Bacteria 4885
529 Ga0496126_0092289 3300048929 Bacteria 2660
530 Ga0496126_0101234 3300048929 Bacteria 2520
531 Ga0496126_0293587 3300048929 Bacteria 1343
532 Ga0495678_003266 3300049459 Bacteria 10133
533 Ga0495678_008130 3300049459 Bacteria 5340
534 Ga0495678_009503 3300049459 Bacteria 4808
535 Ga0495678_011583 3300049459 Bacteria 4214
536 Ga0495678_025147 3300049459 Bacteria 2561
537 Ga0495678_030760 3300049459 Bacteria 2243
538 Ga0495678_041828 3300049459 Bacteria 1830
539 Ga0495682_0000005 3300049460 Bacteria 360387
540 Ga0495682_0044831 3300049460 Bacteria 1617
541 Ga0495682_0070167 3300049460 Bacteria 1261
542 Ga0501223_010448 3300049663 Bacteria 1867
543 Ga0501269_000661 3300049766 Bacteria 5926
544 nmdc:mga00v17_86554_c1 3300050491 Bacteria 1964
545 Ga0500621_024312 3300053126 Bacteria 2358
546 Ga0500659_0002792 3300053135 Bacteria 10437
547 Ga0500634_0000039 3300053161 Bacteria 62173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002739 JGI25158J39367_1010157 JGI25158J39367_10101571 292
2 3300002987 JGI25159J45721_1020436 JGI25159J45721_10204361 292
3 3300003354 JGI25160J50197_1033941 JGI25160J50197_10339411 292
4 3300003374 JGI25161J50226_1010185 JGI25161J50226_10101851 292
5 3300004625 Ga0055543_1018187 Ga0055543_10181872 292
6 3300005262 Ga0065165_1043736 Ga0065165_10437362 292
7 3300025208 Ga0209436_113554 Ga0209436_1135542 292
8 3300025284 Ga0209130_1024229 Ga0209130_10242292 292
9 3300025302 Ga0207426_1045871 Ga0207426_10458712 292
10 3300039110 Ga0400487_00700 Ga0400487_00700_80_1054 309
11 3300003322 rootL2_10048779 rootL2_100487799 314
12 3300046524 Ga0495648_0096684 Ga0495648_0096684_31_1062 321
13 3300038741 Ga0400488_22115 Ga0400488_22115_291_1373 323
14 3300046507 Ga0495606_0000740 Ga0495606_0000740_9741_10883 323
15 3300046694 Ga0495649_0000601 Ga0495649_0000601_1380_2522 323
16 3300013102 Ga0157371_10024651 Ga0157371_100246511 326
17 3300039062 Ga0400483_090640 Ga0400483_090640_639_1778 326
18 3300013100 Ga0157373_10131247 Ga0157373_101312472 327
19 3300017792 Ga0163161_10000522 Ga0163161_1000052214 327
20 3300033180 Ga0307510_10000338 Ga0307510_1000033825 327
21 3300046452 Ga0495617_052904 Ga0495617_052904_16_1101 327
22 3300046491 Ga0495584_0007251 Ga0495584_0007251_3401_4486 327
23 3300046500 Ga0495596_0027193 Ga0495596_0027193_611_1696 327
24 3300046513 Ga0495616_0003396 Ga0495616_0003396_1208_2293 327
25 3300046520 Ga0495637_0000580 Ga0495637_0000580_7265_8350 327
26 3300046524 Ga0495648_0099588 Ga0495648_0099588_334_1419 327
27 3300046660 Ga0495625_0126720 Ga0495625_0126720_315_1400 327
28 3300046691 Ga0495670_0000132 Ga0495670_0000132_21099_22184 327
29 3300046794 Ga0495589_0030018 Ga0495589_0030018_1476_2561 327
30 3300046810 Ga0495660_0031638 Ga0495660_0031638_646_1731 327
31 3300047320 Ga0495672_0006402 Ga0495672_0006402_4962_6047 327
32 3300047323 Ga0495683_0092195 Ga0495683_0092195_164_1249 327
33 3300047470 Ga0495681_0071721 Ga0495681_0071721_188_1273 327
34 3300047472 Ga0495686_0032512 Ga0495686_0032512_1476_2561 327
35 3300049459 Ga0495678_008130 Ga0495678_008130_1507_2592 327
36 3300042010 Ga0439452_001380 Ga0439452_001380_3129_4214 328
37 3300005544 Ga0070686_100000055 Ga0070686_10000005549 329
38 3300031548 Ga0307408_100139095 Ga0307408_1001390951 331
39 3300031731 Ga0307405_10052513 Ga0307405_100525132 331
40 3300032002 Ga0307416_100207862 Ga0307416_1002078622 331
41 3300046471 Ga0495650_0008585 Ga0495650_0008585_1622_2725 332
42 3300046474 Ga0495605_0027577 Ga0495605_0027577_124_1227 332
43 3300047320 Ga0495672_0000011 Ga0495672_0000011_332503_333606 332
44 3300047323 Ga0495683_0011030 Ga0495683_0011030_360_1463 332
45 3300003791 Ga0055530_10000094 Ga0055530_100000942 334
46 3300003792 Ga0055540_1000130 Ga0055540_10001302 334
47 3300003794 Ga0055531_10036799 Ga0055531_100367992 334
48 3300015261 Ga0182006_1034341 Ga0182006_10343411 334
49 3300025292 Ga0209676_1003039 Ga0209676_10030392 334
50 3300025298 Ga0209050_1000079 Ga0209050_100007989 334
51 3300025303 Ga0209051_1000054 Ga0209051_100005492 334
52 3300025304 Ga0209257_1007132 Ga0209257_10071321 334
53 3300031911 Ga0307412_10134311 Ga0307412_101343112 334
54 2162886007 SwRhRL2b_contig_1005263 SwRhRL2b_0390.00006780 335
55 3300005288 Ga0065714_10074817 Ga0065714_100748171 335
56 3300005289 Ga0065704_10070477 Ga0065704_1007047735 335
57 3300017792 Ga0163161_10034810 Ga0163161_100348105 335
58 3300031548 Ga0307408_100021721 Ga0307408_1000217213 335
59 3300046455 Ga0495603_0036482 Ga0495603_0036482_1723_2802 335
60 3300046530 Ga0495654_0059454 Ga0495654_0059454_314_1399 335
61 3300046660 Ga0495625_0030955 Ga0495625_0030955_979_2064 335
62 3300046810 Ga0495660_0001485 Ga0495660_0001485_10797_11882 335
63 3300048091 Ga0495626_0012066 Ga0495626_0012066_2466_3551 335
64 3300049459 Ga0495678_009503 Ga0495678_009503_2312_3397 335
65 3300049459 Ga0495678_041828 Ga0495678_041828_374_1459 335
66 3300009036 Ga0105244_10038057 Ga0105244_100380572 336
67 3300049460 Ga0495682_0000005 Ga0495682_0000005_224410_225513 336
68 iso_pu_bacteria 2885080285 2885085758 336
69 3300013104 Ga0157370_10373829 Ga0157370_103738291 337
70 3300046458 Ga0495591_000831 Ga0495591_000831_5457_6542 337
71 3300046471 Ga0495650_0000062 Ga0495650_0000062_144628_145698 337
72 3300053135 Ga0500659_0002792 Ga0500659_0002792_626_1735 337
73 3300041405 Ga0439438_000885 Ga0439438_000885_4959_6227 338
74 3300041411 Ga0439466_0001754 Ga0439466_0001754_4627_5895 338
75 3300049459 Ga0495678_003266 Ga0495678_003266_8950_10035 338
76 3300003791 Ga0055530_10009354 Ga0055530_100093543 339
77 3300025298 Ga0209050_1024119 Ga0209050_10241192 339
78 3300031250 Ga0265331_10071876 Ga0265331_100718761 339
79 3300031251 Ga0265327_10000027 Ga0265327_1000002765 339
80 3300046500 Ga0495596_0036399 Ga0495596_0036399_670_1746 339
81 3300046506 Ga0495583_0009215 Ga0495583_0009215_1114_2190 339
82 3300046519 Ga0495632_0003301 Ga0495632_0003301_721_1803 339
83 3300046616 Ga0495668_0072747 Ga0495668_0072747_442_1524 339
84 3300046692 Ga0495671_0008074 Ga0495671_0008074_1054_2130 339
85 3300003320 rootH2_10097397 rootH2_100973972 340
86 3300010375 Ga0105239_10071346 Ga0105239_100713464 340
87 3300046452 Ga0495617_002507 Ga0495617_002507_4040_5128 340
88 3300046453 Ga0495627_000004 Ga0495627_000004_526161_527249 340
89 3300046471 Ga0495650_0008277 Ga0495650_0008277_4667_5749 340
90 3300046501 Ga0495607_0075710 Ga0495607_0075710_532_1614 340
91 3300046507 Ga0495606_0000042 Ga0495606_0000042_28426_29508 340
92 3300046512 Ga0495610_0021524 Ga0495610_0021524_132_1223 340
93 3300046524 Ga0495648_0013206 Ga0495648_0013206_1880_3019 340
94 3300046558 Ga0495633_0000443 Ga0495633_0000443_16881_18065 340
95 3300046694 Ga0495649_0084628 Ga0495649_0084628_134_1222 340
96 3300048913 Ga0496110_0455239 Ga0496110_0455239_14_1123 340
97 3300048927 Ga0496124_0002208 Ga0496124_0002208_10632_11744 340
98 3300048929 Ga0496126_0008717 Ga0496126_0008717_7209_8297 340
99 iso_pu_bacteria 2891088606 2891090259 340
100 3300049766 Ga0501269_000661 Ga0501269_000661_3170_4255 341
101 iso_pu_bacteria 2585428157 2588108256 341
102 3300003781 Ga0055536_1000043 Ga0055536_100004357 342
103 3300003791 Ga0055530_10000031 Ga0055530_1000003164 342
104 3300003792 Ga0055540_1000442 Ga0055540_100044218 342
105 3300025292 Ga0209676_1000080 Ga0209676_1000080102 342
106 3300025298 Ga0209050_1000117 Ga0209050_100011756 342
107 3300025303 Ga0209051_1000077 Ga0209051_100007756 342
108 3300039437 Ga0436365_0192868 Ga0436365_0192868_32_1117 342
109 3300046507 Ga0495606_0008195 Ga0495606_0008195_4865_5950 342
110 3300046515 Ga0495620_0000517 Ga0495620_0000517_1257_2342 342
111 3300046520 Ga0495637_0003015 Ga0495637_0003015_4624_5709 342
112 3300046694 Ga0495649_0004494 Ga0495649_0004494_4683_5768 342
113 3300046694 Ga0495649_0009591 Ga0495649_0009591_4103_5185 342
114 3300046794 Ga0495589_0016301 Ga0495589_0016301_1301_2386 342
115 3300047470 Ga0495681_0001336 Ga0495681_0001336_4500_5585 342
116 3300047472 Ga0495686_0011529 Ga0495686_0011529_4655_5737 342
117 3300048919 Ga0496116_0000917 Ga0496116_0000917_22730_23815 342
118 3300049459 Ga0495678_030760 Ga0495678_030760_602_1687 342
119 3300009101 Ga0105247_10030070 Ga0105247_100300704 343
120 3300025900 Ga0207710_10015947 Ga0207710_100159474 343
121 3300048920 Ga0496117_0077044 Ga0496117_0077044_208_1275 343
122 3300048921 Ga0496118_0035528 Ga0496118_0035528_2019_3086 343
123 iso_pu_bacteria 2599185188 2599501088 343
124 iso_pu_bacteria 2599185248 2599773058 343
125 iso_pu_bacteria 2599185302 2599942814 343
126 iso_pu_bacteria 2599185304 2599953563 343
127 iso_pu_bacteria 2599185316 2600026067 343
128 iso_pu_bacteria 2599185320 2600046934 343
129 iso_pu_bacteria 2599185325 2600080045 343
130 iso_pu_bacteria 2880230671 2880233802 343
131 iso_pu_bacteria 2919385768 2919390334 343
132 iso_pu_bacteria 2919481497 2919483185 343
133 iso_pu_bacteria 2919523602 2919523762 343
134 iso_pu_bacteria 2990196909 2990200550 343
135 3300049663 Ga0501223_010448 Ga0501223_010448_272_1384 344
136 iso_pu_bacteria 2599185155 2599331091 344
137 iso_pu_bacteria 2865014394 2865014939 344
138 iso_pu_bacteria 2978975091 2978977681 344
139 3300003781 Ga0055536_1000227 Ga0055536_10002278 345
140 3300003791 Ga0055530_10003114 Ga0055530_100031147 345
141 3300003792 Ga0055540_1000161 Ga0055540_10001617 345
142 3300003794 Ga0055531_10002314 Ga0055531_100023149 345
143 3300005548 Ga0070665_100148574 Ga0070665_1001485743 345
144 3300006051 Ga0075364_10047485 Ga0075364_100474852 345
145 3300009092 Ga0105250_10008209 Ga0105250_100082095 345
146 3300013100 Ga0157373_10010108 Ga0157373_100101084 345
147 3300013307 Ga0157372_10039970 Ga0157372_100399702 345
148 3300025292 Ga0209676_1000016 Ga0209676_1000016275 345
149 3300025298 Ga0209050_1000036 Ga0209050_1000036283 345
150 3300025303 Ga0209051_1000094 Ga0209051_100009470 345
151 3300025304 Ga0209257_1000173 Ga0209257_1000173120 345
152 3300025711 Ga0207696_1001411 Ga0207696_10014113 345
153 3300028379 Ga0268266_10028121 Ga0268266_100281212 345
154 3300041405 Ga0439438_000005 Ga0439438_000005_135942_137030 345
155 3300046458 Ga0495591_030883 Ga0495591_030883_324_1409 345
156 3300046492 Ga0495585_0000700 Ga0495585_0000700_8157_9242 345
157 3300046492 Ga0495585_0015009 Ga0495585_0015009_3361_4446 345
158 3300046507 Ga0495606_0005303 Ga0495606_0005303_5858_6943 345
159 3300046512 Ga0495610_0002069 Ga0495610_0002069_15617_16702 345
160 3300046519 Ga0495632_0011627 Ga0495632_0011627_1839_2924 345
161 3300046522 Ga0495643_0050158 Ga0495643_0050158_712_1797 345
162 3300046524 Ga0495648_0043728 Ga0495648_0043728_1355_2440 345
163 3300046530 Ga0495654_0005902 Ga0495654_0005902_2215_3300 345
164 3300046557 Ga0495622_0000441 Ga0495622_0000441_20955_22040 345
165 3300046694 Ga0495649_0004465 Ga0495649_0004465_3421_4506 345
166 3300046694 Ga0495649_0069870 Ga0495649_0069870_471_1556 345
167 3300047469 Ga0495673_0008062 Ga0495673_0008062_1315_2400 345
168 3300048091 Ga0495626_0001079 Ga0495626_0001079_18780_19865 345
169 3300048091 Ga0495626_0006789 Ga0495626_0006789_3645_4730 345
170 3300048920 Ga0496117_0001894 Ga0496117_0001894_16838_17947 345
171 3300048921 Ga0496118_0002921 Ga0496118_0002921_16951_18060 345
172 3300048927 Ga0496124_0063002 Ga0496124_0063002_328_1437 345
173 3300049460 Ga0495682_0044831 Ga0495682_0044831_296_1381 345
174 3300053126 Ga0500621_024312 Ga0500621_024312_1036_2121 345
175 iso_pu_bacteria 2671180115 2671585102 345
176 3300005985 Ga0081539_10000132 Ga0081539_10000132184 346
177 3300013307 Ga0157372_10295859 Ga0157372_102958591 346
178 3300030522 Ga0307512_10005973 Ga0307512_100059735 346
179 3300041405 Ga0439438_026376 Ga0439438_026376_200_1285 346
180 3300041407 Ga0439447_020958 Ga0439447_020958_351_1436 346
181 3300041411 Ga0439466_0041683 Ga0439466_0041683_155_1240 346
182 3300042006 Ga0439432_036324 Ga0439432_036324_201_1286 346
183 3300042010 Ga0439452_023712 Ga0439452_023712_291_1376 346
184 3300042013 Ga0439456_015828 Ga0439456_015828_201_1286 346
185 3300042115 Ga0450911_000245 Ga0450911_000245_12242_13327 346
186 3300042145 Ga0450906_012847 Ga0450906_012847_284_1369 346
187 3300042185 Ga0450909_001186 Ga0450909_001186_290_1375 346
188 3300042461 Ga0439460_0031142 Ga0439460_0031142_263_1348 346
189 3300046471 Ga0495650_0000816 Ga0495650_0000816_12808_13926 346
190 3300046558 Ga0495633_0001797 Ga0495633_0001797_3020_4120 346
191 iso_pu_bacteria 2739367653 2739604427 346
192 iso_pu_bacteria 2816332305 2817509950 346
193 3300005327 Ga0070658_10096114 Ga0070658_100961142 347
194 3300005614 Ga0068856_100115611 Ga0068856_1001156112 347
195 3300013100 Ga0157373_10015814 Ga0157373_100158144 347
196 3300013100 Ga0157373_10021580 Ga0157373_100215802 347
197 3300013105 Ga0157369_10015985 Ga0157369_100159852 347
198 3300013105 Ga0157369_10164169 Ga0157369_101641692 347
199 3300025909 Ga0207705_10053797 Ga0207705_100537972 347
200 3300026078 Ga0207702_10087537 Ga0207702_100875371 347
201 3300030742 Ga0316183_1130390 Ga0316183_11303903 347
202 3300041405 Ga0439438_000924 Ga0439438_000924_7820_8902 347
203 3300041405 Ga0439438_001047 Ga0439438_001047_10210_11292 347
204 3300041407 Ga0439447_002560 Ga0439447_002560_3217_4299 347
205 3300041411 Ga0439466_0001623 Ga0439466_0001623_2300_3382 347
206 3300041997 Ga0439431_0000041 Ga0439431_0000041_15663_16745 347
207 3300042006 Ga0439432_001733 Ga0439432_001733_4882_5964 347
208 3300044712 Ga0453684_0087962 Ga0453684_0087962_1972_3057 347
209 3300046519 Ga0495632_0017012 Ga0495632_0017012_163_1233 347
210 3300046524 Ga0495648_0000314 Ga0495648_0000314_11075_12157 347
211 3300046665 Ga0495661_0001080 Ga0495661_0001080_20560_21642 347
212 3300048920 Ga0496117_0002812 Ga0496117_0002812_5985_7076 347
213 3300053161 Ga0500634_0000039 Ga0500634_0000039_41371_42453 347
214 iso_pu_bacteria 2667528173 2671109157 347
215 iso_pu_bacteria 2904474040 2904477566 347
216 iso_pu_bacteria 2919150387 2919153727 347
217 iso_pu_bacteria 2927143783 2927147257 347
218 iso_pu_bacteria 8057798959 8057801074 347
219 3300003856 Ga0058692_1013240 Ga0058692_10132402 348
220 3300005347 Ga0070668_100105264 Ga0070668_1001052643 348
221 3300009011 Ga0105251_10013525 Ga0105251_100135253 348
222 3300009036 Ga0105244_10042277 Ga0105244_100422772 348
223 3300009036 Ga0105244_10068372 Ga0105244_100683722 348
224 3300009092 Ga0105250_10057323 Ga0105250_100573231 348
225 3300009148 Ga0105243_10000196 Ga0105243_1000019619 348
226 3300011119 Ga0105246_10084034 Ga0105246_100840342 348
227 3300013102 Ga0157371_10083121 Ga0157371_100831212 348
228 3300013102 Ga0157371_10146160 Ga0157371_101461603 348
229 3300013104 Ga0157370_10164421 Ga0157370_101644211 348
230 3300013306 Ga0163162_10203791 Ga0163162_102037912 348
231 3300013307 Ga0157372_10033066 Ga0157372_100330663 348
232 3300017792 Ga0163161_10150498 Ga0163161_101504982 348
233 3300025711 Ga0207696_1041765 Ga0207696_10417652 348
234 3300025728 Ga0207655_1011841 Ga0207655_10118414 348
235 3300025728 Ga0207655_1035622 Ga0207655_10356222 348
236 3300025935 Ga0207709_10273025 Ga0207709_102730251 348
237 3300025972 Ga0207668_10206358 Ga0207668_102063582 348
238 3300027312 Ga0209371_1004524 Ga0209371_10045243 348
239 3300028794 Ga0307515_10007850 Ga0307515_1000785017 348
240 3300030500 Ga0268256_1002736 Ga0268256_10027365 348
241 3300041407 Ga0439447_029690 Ga0439447_029690_150_1235 348
242 3300041411 Ga0439466_0046282 Ga0439466_0046282_230_1315 348
243 3300042146 Ga0450907_000007 Ga0450907_000007_78178_79260 348
244 3300042439 Ga0439464_0013526 Ga0439464_0013526_431_1513 348
245 3300046460 Ga0495638_0005491 Ga0495638_0005491_1198_2283 348
246 3300046810 Ga0495660_0051560 Ga0495660_0051560_693_1775 348
247 3300047320 Ga0495672_0000040 Ga0495672_0000040_182919_184001 348
248 3300048920 Ga0496117_0003267 Ga0496117_0003267_532_1614 348
249 3300048921 Ga0496118_0000684 Ga0496118_0000684_23890_24972 348
250 3300048922 Ga0496119_0063175 Ga0496119_0063175_406_1488 348
251 3300048923 Ga0496120_0049105 Ga0496120_0049105_956_2038 348
252 3300048924 Ga0496121_0111843 Ga0496121_0111843_507_1589 348
253 3300048925 Ga0496122_0090762 Ga0496122_0090762_876_1958 348
254 3300048926 Ga0496123_0048318 Ga0496123_0048318_833_1915 348
255 3300048927 Ga0496124_0000251 Ga0496124_0000251_15934_17016 348
256 3300048929 Ga0496126_0101234 Ga0496126_0101234_1308_2390 348
257 iso_pu_bacteria 2511231004 2511256460 348
258 iso_pu_bacteria 2511231016 2511329269 348
259 iso_pu_bacteria 2511231023 2511366434 348
260 iso_pu_bacteria 2554235341 2555668385 348
261 iso_pu_bacteria 2597489889 2597871903 348
262 iso_pu_bacteria 2599185190 2599515155 348
263 iso_pu_bacteria 2599185290 2599894535 348
264 iso_pu_bacteria 2600255318 2601799872 348
265 iso_pu_bacteria 2603880185 2606074329 348
266 iso_pu_bacteria 2603880199 2606127192 348
267 iso_pu_bacteria 2643221571 2643869664 348
268 iso_pu_bacteria 2643221589 2643952005 348
269 iso_pu_bacteria 2643221602 2644024236 348
270 iso_pu_bacteria 2718217725 2718633030 348
271 iso_pu_bacteria 2738543004 2739198675 348
272 iso_pu_bacteria 2738543015 2739256565 348
273 iso_pu_bacteria 2773857670 2774121441 348
274 iso_pu_bacteria 2784132063 2784260128 348
275 iso_pu_bacteria 2784132072 2784315671 348
276 iso_pu_bacteria 2808606382 2808960919 348
277 iso_pu_bacteria 2808606445 2809216118 348
278 iso_pu_bacteria 2818991456 2819654619 348
279 iso_pu_bacteria 2823421272 2823422265 348
280 iso_pu_bacteria 2904518522 2904522437 348
281 iso_pu_bacteria 2917070673 2917072153 348
282 iso_pu_bacteria 2919501602 2919506103 348
283 iso_pu_bacteria 2926063275 2926067598 348
284 iso_pu_bacteria 2931390751 2931395876 348
285 iso_pu_bacteria 2939636861 2939637765 348
286 iso_pu_bacteria 2946027586 2946033088 348
287 iso_pu_bacteria 2947233263 2947233859 348
288 iso_pu_bacteria 2969304461 2969305936 348
289 iso_pu_bacteria 2998139840 2998141349 348
290 iso_pu_bacteria 3007614139 3007616200 348
291 iso_pu_bacteria 3007619802 3007620492 348
292 iso_pu_bacteria 8054285046 8054288891 348
293 iso_pu_bacteria 8054347763 8054353070 348
294 iso_pu_bacteria 8056148874 8056150570 348
295 iso_pu_bacteria 8056155041 8056159422 348
296 iso_pu_bacteria 8056161164 8056163047 348
297 3300005289 Ga0065704_10141131 Ga0065704_101411311 349
298 3300006051 Ga0075364_10096578 Ga0075364_100965782 349
299 3300006946 Ga0079104_1000059 Ga0079104_100005943 349
300 3300006946 Ga0079104_1003509 Ga0079104_10035096 349
301 3300006946 Ga0079104_1014022 Ga0079104_10140222 349
302 3300009011 Ga0105251_10004093 Ga0105251_100040931 349
303 3300009011 Ga0105251_10077312 Ga0105251_100773121 349
304 3300009092 Ga0105250_10002104 Ga0105250_100021044 349
305 3300009092 Ga0105250_10057832 Ga0105250_100578321 349
306 3300013100 Ga0157373_10019922 Ga0157373_100199223 349
307 3300013102 Ga0157371_10046556 Ga0157371_100465564 349
308 3300013307 Ga0157372_10044327 Ga0157372_100443273 349
309 3300025711 Ga0207696_1000743 Ga0207696_10007435 349
310 3300025711 Ga0207696_1032936 Ga0207696_10329362 349
311 3300025735 Ga0207713_1003752 Ga0207713_10037529 349
312 3300025735 Ga0207713_1019263 Ga0207713_10192632 349
313 3300027111 Ga0209281_1000065 Ga0209281_100006542 349
314 3300027111 Ga0209281_1000774 Ga0209281_100077419 349
315 3300027111 Ga0209281_1001095 Ga0209281_10010953 349
316 3300041405 Ga0439438_000184 Ga0439438_000184_15471_16553 349
317 3300041405 Ga0439438_031273 Ga0439438_031273_218_1303 349
318 3300042006 Ga0439432_023362 Ga0439432_023362_824_1900 349
319 3300046460 Ga0495638_0001939 Ga0495638_0001939_238_1314 349
320 3300046530 Ga0495654_0009990 Ga0495654_0009990_2183_3262 349
321 3300046660 Ga0495625_0011256 Ga0495625_0011256_945_2024 349
322 3300047446 Ga0495679_000016 Ga0495679_000016_203063_204142 349
323 3300047446 Ga0495679_027265 Ga0495679_027265_774_1850 349
324 3300047469 Ga0495673_0000128 Ga0495673_0000128_79956_81032 349
325 3300048919 Ga0496116_0031758 Ga0496116_0031758_1099_2175 349
326 3300048919 Ga0496116_0055569 Ga0496116_0055569_906_1982 349
327 3300048920 Ga0496117_0047327 Ga0496117_0047327_206_1282 349
328 3300048920 Ga0496117_0060838 Ga0496117_0060838_618_1694 349
329 3300048921 Ga0496118_0073296 Ga0496118_0073296_906_1982 349
330 3300048921 Ga0496118_0087208 Ga0496118_0087208_183_1259 349
331 3300048922 Ga0496119_0031604 Ga0496119_0031604_938_2014 349
332 3300048922 Ga0496119_0053682 Ga0496119_0053682_314_1390 349
333 3300048922 Ga0496119_0094724 Ga0496119_0094724_413_1489 349
334 3300048923 Ga0496120_0108003 Ga0496120_0108003_69_1145 349
335 3300048924 Ga0496121_0002695 Ga0496121_0002695_3590_4666 349
336 3300048924 Ga0496121_0002876 Ga0496121_0002876_10910_11986 349
337 3300048924 Ga0496121_0037332 Ga0496121_0037332_2827_3903 349
338 3300048924 Ga0496121_0069120 Ga0496121_0069120_603_1679 349
339 3300048924 Ga0496121_0107575 Ga0496121_0107575_906_1982 349
340 3300048925 Ga0496122_0045063 Ga0496122_0045063_623_1699 349
341 3300048926 Ga0496123_0036286 Ga0496123_0036286_1800_2876 349
342 3300048927 Ga0496124_0109298 Ga0496124_0109298_246_1322 349
343 3300048928 Ga0496125_0018757 Ga0496125_0018757_5087_6163 349
344 3300048928 Ga0496125_0024596 Ga0496125_0024596_2272_3348 349
345 3300050491 nmdc:mga00v17_86554_c1 nmdc:mga00v17_86554_c1_228_1307 349
346 3300005614 Ga0068856_100218934 Ga0068856_1002189342 350
347 3300009011 Ga0105251_10000018 Ga0105251_10000018140 350
348 3300013105 Ga0157369_10072450 Ga0157369_100724502 350
349 3300025735 Ga0207713_1000156 Ga0207713_10001569 350
350 3300027111 Ga0209281_1013296 Ga0209281_10132962 350
351 3300030734 Ga0316179_1110150 Ga0316179_11101502 350
352 3300031548 Ga0307408_100244184 Ga0307408_1002441841 350
353 3300031911 Ga0307412_10136999 Ga0307412_101369992 350
354 3300032004 Ga0307414_10138002 Ga0307414_101380022 350
355 3300037068 Ga0373925_0008930 Ga0373925_0008930_4201_5373 350
356 3300042016 Ga0439463_025361 Ga0439463_025361_146_1231 350
357 3300042137 Ga0450902_001595 Ga0450902_001595_350_1435 350
358 3300046460 Ga0495638_0043347 Ga0495638_0043347_1177_2256 350
359 3300046642 Ga0495634_0001010 Ga0495634_0001010_10094_11179 350
360 3300046680 Ga0495646_0037110 Ga0495646_0037110_1501_2586 350
361 2162886007 SwRhRL2b_contig_3072008 SwRhRL2b_0513.00001110 351
362 2162886007 SwRhRL2b_contig_3949486 SwRhRL2b_0011.00005780 351
363 3300005289 Ga0065704_10001369 Ga0065704_1000136911 351
364 3300005289 Ga0065704_10070553 Ga0065704_1007055323 351
365 3300009011 Ga0105251_10002673 Ga0105251_1000267315 351
366 3300009092 Ga0105250_10053992 Ga0105250_100539922 351
367 3300013102 Ga0157371_10000044 Ga0157371_1000004441 351
368 3300013104 Ga0157370_10036532 Ga0157370_100365324 351
369 3300015261 Ga0182006_1039090 Ga0182006_10390902 351
370 3300025711 Ga0207696_1031031 Ga0207696_10310312 351
371 3300025735 Ga0207713_1002302 Ga0207713_100230216 351
372 3300046471 Ga0495650_0000039 Ga0495650_0000039_197782_198867 351
373 3300046471 Ga0495650_0024018 Ga0495650_0024018_159_1271 351
374 3300046474 Ga0495605_0000462 Ga0495605_0000462_13629_14723 351
375 3300046474 Ga0495605_0001071 Ga0495605_0001071_138_1223 351
376 3300046519 Ga0495632_0052568 Ga0495632_0052568_560_1669 351
377 3300046520 Ga0495637_0018560 Ga0495637_0018560_1540_2634 351
378 3300046522 Ga0495643_0019970 Ga0495643_0019970_555_1664 351
379 3300046522 Ga0495643_0088949 Ga0495643_0088949_373_1458 351
380 3300046542 Ga0495597_0032994 Ga0495597_0032994_887_1972 351
381 3300046692 Ga0495671_0020654 Ga0495671_0020654_420_1532 351
382 3300046794 Ga0495589_0009643 Ga0495589_0009643_138_1223 351
383 3300046810 Ga0495660_0000023 Ga0495660_0000023_57424_58509 351
384 3300047323 Ga0495683_0053665 Ga0495683_0053665_324_1409 351
385 3300048907 Ga0496104_0000219 Ga0496104_0000219_21554_22639 351
386 3300048917 Ga0496114_0026083 Ga0496114_0026083_1396_2478 351
387 3300048921 Ga0496118_0141078 Ga0496118_0141078_175_1260 351
388 3300048922 Ga0496119_0005609 Ga0496119_0005609_10461_11546 351
389 3300048923 Ga0496120_0095202 Ga0496120_0095202_222_1307 351
390 3300048924 Ga0496121_0001953 Ga0496121_0001953_448_1530 351
391 3300048925 Ga0496122_0000067 Ga0496122_0000067_23096_24181 351
392 3300048925 Ga0496122_0032105 Ga0496122_0032105_2835_3917 351
393 3300048926 Ga0496123_0000056 Ga0496123_0000056_207185_208270 351
394 3300048927 Ga0496124_0197210 Ga0496124_0197210_174_1259 351
395 3300048928 Ga0496125_0000183 Ga0496125_0000183_1501_2586 351
396 3300048929 Ga0496126_0293587 Ga0496126_0293587_165_1250 351
397 2124908027 MRS2a_Contig_9794 MRS2a_00650480 352
398 3300005289 Ga0065704_10157362 Ga0065704_101573621 352
399 3300005353 Ga0070669_100002540 Ga0070669_1000025403 352
400 3300005457 Ga0070662_100005940 Ga0070662_1000059401 352
401 3300005578 Ga0068854_100004716 Ga0068854_1000047166 352
402 3300006051 Ga0075364_10129909 Ga0075364_101299092 352
403 3300006914 Ga0075436_100169880 Ga0075436_1001698802 352
404 3300009011 Ga0105251_10005208 Ga0105251_100052086 352
405 3300009011 Ga0105251_10025143 Ga0105251_100251431 352
406 3300009011 Ga0105251_10050311 Ga0105251_100503112 352
407 3300009011 Ga0105251_10064115 Ga0105251_100641152 352
408 3300009011 Ga0105251_10065790 Ga0105251_100657901 352
409 3300009036 Ga0105244_10020404 Ga0105244_100204042 352
410 3300009036 Ga0105244_10023005 Ga0105244_100230052 352
411 3300009036 Ga0105244_10034456 Ga0105244_100344563 352
412 3300009036 Ga0105244_10066366 Ga0105244_100663662 352
413 3300009036 Ga0105244_10086097 Ga0105244_100860971 352
414 3300009092 Ga0105250_10003350 Ga0105250_100033505 352
415 3300009092 Ga0105250_10013409 Ga0105250_100134093 352
416 3300009092 Ga0105250_10045069 Ga0105250_100450693 352
417 3300009092 Ga0105250_10075534 Ga0105250_100755342 352
418 3300009177 Ga0105248_10023148 Ga0105248_100231485 352
419 3300013100 Ga0157373_10055505 Ga0157373_100555052 352
420 3300013102 Ga0157371_10116206 Ga0157371_101162062 352
421 3300013104 Ga0157370_10208633 Ga0157370_102086332 352
422 3300013105 Ga0157369_10089027 Ga0157369_100890273 352
423 3300013306 Ga0163162_10183455 Ga0163162_101834552 352
424 3300013306 Ga0163162_10309922 Ga0163162_103099221 352
425 3300013307 Ga0157372_10001040 Ga0157372_1000104029 352
426 3300014497 Ga0182008_10006185 Ga0182008_100061856 352
427 3300014497 Ga0182008_10110299 Ga0182008_101102992 352
428 3300015261 Ga0182006_1004345 Ga0182006_10043454 352
429 3300015261 Ga0182006_1050282 Ga0182006_10502822 352
430 3300015261 Ga0182006_1050738 Ga0182006_10507382 352
431 3300015261 Ga0182006_1057056 Ga0182006_10570562 352
432 3300015262 Ga0182007_10045959 Ga0182007_100459591 352
433 3300015262 Ga0182007_10051157 Ga0182007_100511572 352
434 3300015265 Ga0182005_1025302 Ga0182005_10253022 352
435 3300015265 Ga0182005_1025554 Ga0182005_10255542 352
436 3300017792 Ga0163161_10019422 Ga0163161_100194222 352
437 3300017792 Ga0163161_10024826 Ga0163161_100248264 352
438 3300017792 Ga0163161_10125147 Ga0163161_101251472 352
439 3300017792 Ga0163161_10181253 Ga0163161_101812532 352
440 3300025298 Ga0209050_1033293 Ga0209050_10332932 352
441 3300025711 Ga0207696_1000083 Ga0207696_1000083120 352
442 3300025711 Ga0207696_1013861 Ga0207696_10138612 352
443 3300025711 Ga0207696_1016192 Ga0207696_10161922 352
444 3300025711 Ga0207696_1017157 Ga0207696_10171573 352
445 3300025711 Ga0207696_1031891 Ga0207696_10318911 352
446 3300025728 Ga0207655_1001403 Ga0207655_100140324 352
447 3300025728 Ga0207655_1032478 Ga0207655_10324782 352
448 3300025728 Ga0207655_1037386 Ga0207655_10373862 352
449 3300025728 Ga0207655_1055445 Ga0207655_10554452 352
450 3300025735 Ga0207713_1002375 Ga0207713_10023754 352
451 3300025735 Ga0207713_1007149 Ga0207713_10071491 352
452 3300025735 Ga0207713_1031916 Ga0207713_10319162 352
453 3300025735 Ga0207713_1042771 Ga0207713_10427712 352
454 3300025923 Ga0207681_10000386 Ga0207681_100003866 352
455 3300025933 Ga0207706_10000056 Ga0207706_1000005630 352
456 3300025941 Ga0207711_10075864 Ga0207711_100758642 352
457 3300025981 Ga0207640_10040147 Ga0207640_100401472 352
458 3300027907 Ga0207428_10037980 Ga0207428_100379805 352
459 3300027907 Ga0207428_10087366 Ga0207428_100873661 352
460 3300027907 Ga0207428_10147699 Ga0207428_101476992 352
461 3300038705 Ga0237819_00554 Ga0237819_00554_4473_5558 352
462 3300041405 Ga0439438_002883 Ga0439438_002883_4714_5799 352
463 3300041405 Ga0439438_009382 Ga0439438_009382_1665_2750 352
464 3300041407 Ga0439447_001821 Ga0439447_001821_2247_3332 352
465 3300041407 Ga0439447_008514 Ga0439447_008514_421_1506 352
466 3300041411 Ga0439466_0008936 Ga0439466_0008936_217_1302 352
467 3300041411 Ga0439466_0012203 Ga0439466_0012203_1665_2750 352
468 3300042006 Ga0439432_010745 Ga0439432_010745_1660_2745 352
469 3300042009 Ga0439451_001507 Ga0439451_001507_291_1376 352
470 3300042009 Ga0439451_014899 Ga0439451_014899_298_1383 352
471 3300042010 Ga0439452_002007 Ga0439452_002007_5207_6292 352
472 3300042010 Ga0439452_008144 Ga0439452_008144_1665_2750 352
473 3300042122 Ga0450920_000596 Ga0450920_000596_4159_5244 352
474 3300042124 Ga0450922_000143 Ga0450922_000143_363_1448 352
475 3300042125 Ga0450923_007593 Ga0450923_007593_525_1610 352
476 3300042127 Ga0450890_000068 Ga0450890_000068_120_1205 352
477 3300042138 Ga0450903_008948 Ga0450903_008948_140_1225 352
478 3300042145 Ga0450906_008647 Ga0450906_008647_543_1628 352
479 3300042146 Ga0450907_000041 Ga0450907_000041_37938_39023 352
480 3300042146 Ga0450907_000756 Ga0450907_000756_1046_2131 352
481 3300042184 Ga0450908_007783 Ga0450908_007783_352_1437 352
482 3300042185 Ga0450909_000107 Ga0450909_000107_4344_5429 352
483 3300042435 Ga0439434_0000029 Ga0439434_0000029_19200_20285 352
484 3300046452 Ga0495617_013335 Ga0495617_013335_790_1875 352
485 3300046453 Ga0495627_001368 Ga0495627_001368_1407_2492 352
486 3300046455 Ga0495603_0054772 Ga0495603_0054772_317_1402 352
487 3300046455 Ga0495603_0061474 Ga0495603_0061474_185_1270 352
488 3300046457 Ga0495590_0014217 Ga0495590_0014217_791_1876 352
489 3300046460 Ga0495638_0001131 Ga0495638_0001131_6745_7941 352
490 3300046460 Ga0495638_0004663 Ga0495638_0004663_755_1840 352
491 3300046460 Ga0495638_0139333 Ga0495638_0139333_293_1378 352
492 3300046463 Ga0495653_0021455 Ga0495653_0021455_3420_4505 352
493 3300046471 Ga0495650_0001935 Ga0495650_0001935_9728_10813 352
494 3300046471 Ga0495650_0002360 Ga0495650_0002360_334_1419 352
495 3300046471 Ga0495650_0008766 Ga0495650_0008766_319_1434 352
496 3300046474 Ga0495605_0022596 Ga0495605_0022596_136_1221 352
497 3300046491 Ga0495584_0011458 Ga0495584_0011458_149_1234 352
498 3300046492 Ga0495585_0004622 Ga0495585_0004622_4250_5335 352
499 3300046492 Ga0495585_0016684 Ga0495585_0016684_1839_2924 352
500 3300046500 Ga0495596_0000075 Ga0495596_0000075_50544_51740 352
501 3300046501 Ga0495607_0009695 Ga0495607_0009695_5402_6487 352
502 3300046501 Ga0495607_0017442 Ga0495607_0017442_2387_3472 352
503 3300046501 Ga0495607_0056504 Ga0495607_0056504_844_1929 352
504 3300046501 Ga0495607_0105234 Ga0495607_0105234_96_1181 352
505 3300046506 Ga0495583_0034634 Ga0495583_0034634_950_2035 352
506 3300046507 Ga0495606_0001625 Ga0495606_0001625_8003_9088 352
507 3300046518 Ga0495631_0014295 Ga0495631_0014295_925_2010 352
508 3300046519 Ga0495632_0000341 Ga0495632_0000341_19065_20150 352
509 3300046520 Ga0495637_0003021 Ga0495637_0003021_4020_5105 352
510 3300046520 Ga0495637_0003198 Ga0495637_0003198_4727_5812 352
511 3300046520 Ga0495637_0042764 Ga0495637_0042764_430_1515 352
512 3300046522 Ga0495643_0038900 Ga0495643_0038900_97_1182 352
513 3300046524 Ga0495648_0001666 Ga0495648_0001666_9004_10089 352
514 3300046530 Ga0495654_0000675 Ga0495654_0000675_6769_7965 352
515 3300046530 Ga0495654_0002824 Ga0495654_0002824_7695_8780 352
516 3300046530 Ga0495654_0013066 Ga0495654_0013066_801_1886 352
517 3300046530 Ga0495654_0016270 Ga0495654_0016270_427_1512 352
518 3300046530 Ga0495654_0019402 Ga0495654_0019402_1543_2628 352
519 3300046530 Ga0495654_0026620 Ga0495654_0026620_1641_2726 352
520 3300046530 Ga0495654_0053951 Ga0495654_0053951_511_1596 352
521 3300046530 Ga0495654_0087111 Ga0495654_0087111_155_1243 352
522 3300046538 Ga0495609_0041257 Ga0495609_0041257_387_1472 352
523 3300046538 Ga0495609_0052735 Ga0495609_0052735_190_1275 352
524 3300046542 Ga0495597_0000832 Ga0495597_0000832_5859_6944 352
525 3300046542 Ga0495597_0064653 Ga0495597_0064653_211_1296 352
526 3300046557 Ga0495622_0055220 Ga0495622_0055220_225_1310 352
527 3300046557 Ga0495622_0065299 Ga0495622_0065299_367_1452 352
528 3300046557 Ga0495622_0068462 Ga0495622_0068462_266_1351 352
529 3300046558 Ga0495633_0006287 Ga0495633_0006287_3944_5029 352
530 3300046615 Ga0495656_0006368 Ga0495656_0006368_2683_3768 352
531 3300046616 Ga0495668_0000195 Ga0495668_0000195_18782_19978 352
532 3300046616 Ga0495668_0000912 Ga0495668_0000912_21599_22849 352
533 3300046648 Ga0495611_0066639 Ga0495611_0066639_463_1548 352
534 3300046660 Ga0495625_0057807 Ga0495625_0057807_1329_2414 352
535 3300046665 Ga0495661_0013577 Ga0495661_0013577_3454_4539 352
536 3300046684 Ga0495669_0004460 Ga0495669_0004460_387_1472 352
537 3300046689 Ga0495613_0006736 Ga0495613_0006736_1209_2294 352
538 3300046691 Ga0495670_0000533 Ga0495670_0000533_9311_10396 352
539 3300046691 Ga0495670_0002962 Ga0495670_0002962_1576_2787 352
540 3300046691 Ga0495670_0010627 Ga0495670_0010627_2848_3933 352
541 3300046692 Ga0495671_0012558 Ga0495671_0012558_2912_3997 352
542 3300046694 Ga0495649_0008493 Ga0495649_0008493_3614_4699 352
543 3300046694 Ga0495649_0028318 Ga0495649_0028318_1657_2745 352
544 3300046694 Ga0495649_0035581 Ga0495649_0035581_446_1531 352
545 3300046694 Ga0495649_0116169 Ga0495649_0116169_274_1359 352
546 3300046794 Ga0495589_0018848 Ga0495589_0018848_387_1472 352
547 3300046794 Ga0495589_0070295 Ga0495589_0070295_298_1383 352
548 3300046809 Ga0495600_0016587 Ga0495600_0016587_3270_4355 352
549 3300046810 Ga0495660_0001575 Ga0495660_0001575_11361_12446 352
550 3300046810 Ga0495660_0006210 Ga0495660_0006210_3117_4202 352
551 3300046810 Ga0495660_0022046 Ga0495660_0022046_950_2035 352
552 3300046810 Ga0495660_0066268 Ga0495660_0066268_215_1300 352
553 3300046810 Ga0495660_0068246 Ga0495660_0068246_764_1849 352
554 3300047317 Ga0495604_0034209 Ga0495604_0034209_141_1226 352
555 3300047318 Ga0495636_0031142 Ga0495636_0031142_745_1830 352
556 3300047320 Ga0495672_0004581 Ga0495672_0004581_6314_7399 352
557 3300047320 Ga0495672_0005408 Ga0495672_0005408_4073_5158 352
558 3300047320 Ga0495672_0013359 Ga0495672_0013359_4261_5349 352
559 3300047322 Ga0495680_0099303 Ga0495680_0099303_780_1865 352
560 3300047322 Ga0495680_0181572 Ga0495680_0181572_256_1344 352
561 3300047323 Ga0495683_0027714 Ga0495683_0027714_1301_2386 352
562 3300047323 Ga0495683_0038662 Ga0495683_0038662_173_1258 352
563 3300047443 Ga0495687_003347 Ga0495687_003347_11_1096 352
564 3300047443 Ga0495687_008029 Ga0495687_008029_11_1096 352
565 3300047445 Ga0495677_0000197 Ga0495677_0000197_19060_20145 352
566 3300047446 Ga0495679_001724 Ga0495679_001724_1364_2449 352
567 3300047469 Ga0495673_0000535 Ga0495673_0000535_11543_12628 352
568 3300047469 Ga0495673_0003340 Ga0495673_0003340_9147_10235 352
569 3300047469 Ga0495673_0010611 Ga0495673_0010611_1295_2506 352
570 3300047469 Ga0495673_0023571 Ga0495673_0023571_1399_2484 352
571 3300047470 Ga0495681_0031690 Ga0495681_0031690_1338_2423 352
572 3300048091 Ga0495626_0000724 Ga0495626_0000724_21629_22714 352
573 3300048091 Ga0495626_0011234 Ga0495626_0011234_1838_2923 352
574 3300048091 Ga0495626_0044571 Ga0495626_0044571_603_1688 352
575 3300048919 Ga0496116_0000126 Ga0496116_0000126_106544_107629 352
576 3300048919 Ga0496116_0002322 Ga0496116_0002322_3865_4950 352
577 3300048920 Ga0496117_0000623 Ga0496117_0000623_31847_32932 352
578 3300048920 Ga0496117_0006508 Ga0496117_0006508_3953_5038 352
579 3300048920 Ga0496117_0014842 Ga0496117_0014842_3554_4639 352
580 3300048920 Ga0496117_0030304 Ga0496117_0030304_2472_3557 352
581 3300048921 Ga0496118_0018165 Ga0496118_0018165_5083_6168 352
582 3300048921 Ga0496118_0024582 Ga0496118_0024582_1092_2177 352
583 3300048921 Ga0496118_0024735 Ga0496118_0024735_3873_4958 352
584 3300048922 Ga0496119_0023365 Ga0496119_0023365_2995_4080 352
585 3300048922 Ga0496119_0028163 Ga0496119_0028163_1489_2574 352
586 3300048923 Ga0496120_0011119 Ga0496120_0011119_2895_3980 352
587 3300048923 Ga0496120_0014868 Ga0496120_0014868_3768_4853 352
588 3300048924 Ga0496121_0000142 Ga0496121_0000142_106184_107269 352
589 3300048924 Ga0496121_0021741 Ga0496121_0021741_1710_2795 352
590 3300048925 Ga0496122_0030111 Ga0496122_0030111_2010_3095 352
591 3300048925 Ga0496122_0048097 Ga0496122_0048097_1142_2227 352
592 3300048925 Ga0496122_0049728 Ga0496122_0049728_1232_2317 352
593 3300048925 Ga0496122_0062428 Ga0496122_0062428_1334_2419 352
594 3300048925 Ga0496122_0132471 Ga0496122_0132471_145_1230 352
595 3300048926 Ga0496123_0036238 Ga0496123_0036238_1104_2189 352
596 3300048926 Ga0496123_0044396 Ga0496123_0044396_1058_2143 352
597 3300048926 Ga0496123_0078730 Ga0496123_0078730_532_1617 352
598 3300048926 Ga0496123_0105311 Ga0496123_0105311_309_1394 352
599 3300048927 Ga0496124_0003628 Ga0496124_0003628_14245_15330 352
600 3300048927 Ga0496124_0055658 Ga0496124_0055658_1153_2238 352
601 3300048927 Ga0496124_0069474 Ga0496124_0069474_598_1683 352
602 3300048927 Ga0496124_0281381 Ga0496124_0281381_42_1127 352
603 3300048928 Ga0496125_0013810 Ga0496125_0013810_5836_6921 352
604 3300048928 Ga0496125_0014700 Ga0496125_0014700_2087_3172 352
605 3300048928 Ga0496125_0017357 Ga0496125_0017357_2098_3183 352
606 3300048928 Ga0496125_0029031 Ga0496125_0029031_935_2020 352
607 3300048928 Ga0496125_0055869 Ga0496125_0055869_775_1860 352
608 3300048928 Ga0496125_0077437 Ga0496125_0077437_643_1728 352
609 3300048929 Ga0496126_0032838 Ga0496126_0032838_1121_2206 352
610 3300048929 Ga0496126_0092289 Ga0496126_0092289_1044_2129 352
611 3300049459 Ga0495678_011583 Ga0495678_011583_1063_2148 352
612 3300049459 Ga0495678_025147 Ga0495678_025147_312_1397 352
613 3300049460 Ga0495682_0070167 Ga0495682_0070167_36_1121 352

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13588

HSDR_N_2

Type I restriction enzyme R protein N terminus (HSDR_N)

23

133

0.78

PF04313

HSDR_N

Type I restriction enzyme R protein N terminus (HSDR_N)

21

128

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h1t-assembly1.cif.gz_A the fragment structure of a putative hsdr subunit of a type i restriction enzyme from vibrio vulnificus yj016 0.6832 21 132
2l1d-assembly1.cif.gz_A mouse prion protein (121-231) containing the substitution y169g 0.6492 190 232
5u6g-assembly5.cif.gz_I crystal structure of the holo domain-swapped dimer mutant q108k:k40d human cellular retinol binding protein ii bound with all trans retinal 0.6398 284 331
7bto-assembly1.cif.gz_F ecor124i-arda in the translocation state 0.5804 68 137
7pd3-assembly1.cif.gz_b structure of the human mitoribosomal large subunit in complex with nsun4.mterf4.gtpbp7 and malsu1.l0r8f8.mt-acp 0.5684 311 345
ID Description Score Start End Superfamily
af_Q59058_106_224_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.7454 49 112 3.40.1350.10
3h1tA01 Alpha Beta;Alpha-Beta Complex;tt1808, chain A; 0.7169 21 132 3.90.1570.30
af_C7G039_2_116_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.683 50 106 3.40.1350.10
af_Q19532_358_459_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6514 304 331 2.30.29.30
af_Q60295_117_300_3.90.1570.50 Alpha Beta;Alpha-Beta Complex;tt1808, chain A; 0.6316 42 130 3.90.1570.50
ID Description Score Start End GO Terms
AF-D0WZN0-F1-model_v4 deleted 0.9868 276 352
AF-A0A6L9FDY1-F1-model_v4 Restriction endonuclease 0.9867 1 167 GO:0004519
AF-A0A1N7M212-F1-model_v4 deleted 0.9862 284 351
AF-A0A1X3ACX2-F1-model_v4 deleted 0.9847 280 349
AF-A0A173S1T0-F1-model_v4 Uncharacterized conserved protein 0.984 259 351

Feature Viewer

pLDDT pTM Quality
84.39 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map