F469241

General Info

Members Datasets Scaffolds Average Seq Length
613 299 587 337

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10027562|Ga0070717_100275624
Length 358
Sequence MIGLLCFVLAVLASPFKSTLRLEAENAVLRHQLNVLRRRPHGRVRLTNNHRWFFIQLYRWFPSILQVLTIIGPETLVRWHRAGFRSYWRWKSRPQGGRPQIHTELRALIRRMSVENKLGFEVAQSSVAKYMVKRRGPPSQGWRTFLRNHAPDIAAMDLFVVPTIGFDLLYAFVIVRLDRRDLVWINVTTNPTAEWIARQITQAFPWDDAPKYLIRDRDQIYGAVVTRRLRAMGIRDKPTAPASPWQNGFAERLIGSIRRECVDHIIVLGEAHLRRILKFLCQILQPCQNASIPEQGCAGFSPGSANRCDQVTRHPGRTSSPLRPCLSFRYTQLSVVEMDVKLTQKSPASPPGLFFLEL

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
4 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
5 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
6 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
7 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
8 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
9 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
10 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
11 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
12 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
13 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
14 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
15 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
16 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
17 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
140 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
141 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
149 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
152 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
157 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
174 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
175 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
194 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
195 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
204 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
205 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
206 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
252 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
253 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
254 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
255 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
258 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
261 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
287 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
290 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
291 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
292 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
293 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
294 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
295 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
296 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
297 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
298 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
299 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.08
Metatranscriptomes 0
Isolates 3.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.96
Nodule 3.75
Rhizoplane 1.96
Rhizosphere 90.86
Stem 0
Stem Tuber 0
Unclassified 1.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1003295 3300000532 Bacteria 1078
2 CNXas_1003844 3300000545 Bacteria 1061
3 Ga0065707_10178941 3300005295 Bacteria 1431
4 Ga0070658_10470099 3300005327 Bacteria 1084
5 Ga0070677_10065383 3300005333 Unclassified 1513
6 Ga0070680_100055293 3300005336 Bacteria 3243
7 Ga0070682_100095274 3300005337 Bacteria 1954
8 Ga0070682_100285419 3300005337 Bacteria 1205
9 Ga0070689_100026697 3300005340 Bacteria 4350
10 Ga0070689_100184195 3300005340 Bacteria 1697
11 Ga0070669_100128804 3300005353 Bacteria 1939
12 Ga0070669_100155005 3300005353 Bacteria 1776
13 Ga0070675_100041168 3300005354 Bacteria 3774
14 Ga0070671_100459590 3300005355 Bacteria 1093
15 Ga0070674_100006914 3300005356 Bacteria 6650
16 Ga0070673_100238003 3300005364 Bacteria 1582
17 Ga0070709_10175854 3300005434 Bacteria 1500
18 Ga0070714_100395389 3300005435 Bacteria 1305
19 Ga0070701_10161942 3300005438 Bacteria 1297
20 Ga0070711_100152925 3300005439 Bacteria 1742
21 Ga0070711_100247924 3300005439 Bacteria 1395
22 Ga0070700_100276538 3300005441 Unclassified 1216
23 Ga0070678_100027690 3300005456 Bacteria 3852
24 Ga0070678_100092318 3300005456 Bacteria 2325
25 Ga0070662_100212641 3300005457 Bacteria 1539
26 Ga0070662_100238911 3300005457 Bacteria 1456
27 Ga0070685_10081192 3300005466 Unclassified 1944
28 Ga0070698_100019478 3300005471 Bacteria 7123
29 Ga0070698_100033791 3300005471 Bacteria 5297
30 Ga0070698_100073930 3300005471 Bacteria 3414
31 Ga0070698_100074283 3300005471 Bacteria 3405
32 Ga0070699_100144157 3300005518 Bacteria 2104
33 Ga0070679_100310157 3300005530 Bacteria 1528
34 Ga0070684_100033476 3300005535 Bacteria 4388
35 Ga0070697_100092007 3300005536 Bacteria 2508
36 Ga0070697_100194021 3300005536 Bacteria 1724
37 Ga0070697_100291569 3300005536 Bacteria 1401
38 Ga0070697_100382304 3300005536 Bacteria 1219
39 Ga0070672_100053965 3300005543 Bacteria 3144
40 Ga0070686_100040398 3300005544 Bacteria 2910
41 Ga0070665_100158593 3300005548 Bacteria 2264
42 Ga0070665_100294652 3300005548 Bacteria 1625
43 Ga0068855_100456035 3300005563 Bacteria 1394
44 Ga0068855_100512900 3300005563 Bacteria 1302
45 Ga0068857_100355303 3300005577 Bacteria 1357
46 Ga0068854_100105684 3300005578 Bacteria 2117
47 Ga0068854_100323812 3300005578 Bacteria 1254
48 Ga0068856_100286396 3300005614 Bacteria 1664
49 Ga0070702_100202546 3300005615 Bacteria 1315
50 Ga0068859_100116741 3300005617 Bacteria 2733
51 Ga0068864_100297127 3300005618 Unclassified 1511
52 Ga0068860_100413064 3300005843 Bacteria 1337
53 Ga0068862_100303359 3300005844 Bacteria 1470
54 Ga0081455_10014335 3300005937 Bacteria 7776
55 Ga0081540_1033526 3300005983 Bacteria 2787
56 Ga0081540_1040307 3300005983 Bacteria 2436
57 Ga0081540_1041311 3300005983 Bacteria 2393
58 Ga0081540_1082365 3300005983 Bacteria 1444
59 Ga0070717_10027562 3300006028 Bacteria 4541
60 Ga0070717_10224909 3300006028 Bacteria 1650
61 Ga0070717_10404536 3300006028 Bacteria 1227
62 Ga0070715_10123177 3300006163 Bacteria 1238
63 Ga0070716_100274903 3300006173 Bacteria 1159
64 Ga0070712_100058334 3300006175 Bacteria 2715
65 Ga0070712_100100390 3300006175 Bacteria 2138
66 Ga0070712_100177728 3300006175 Bacteria 1656
67 Ga0075367_10120923 3300006178 Bacteria 1613
68 Ga0075370_10027168 3300006353 Bacteria 3174
69 Ga0075370_10062569 3300006353 Bacteria 2121
70 Ga0075428_100633553 3300006844 Bacteria 1141
71 Ga0075433_10355910 3300006852 Bacteria 1293
72 Ga0075434_100039981 3300006871 Bacteria 4645
73 Ga0075434_100159796 3300006871 Bacteria 2273
74 Ga0075434_100483891 3300006871 Bacteria 1259
75 Ga0075429_100270138 3300006880 Bacteria 1489
76 Ga0068865_100364556 3300006881 Unclassified 1174
77 Ga0097620_100116749 3300006931 Bacteria 2733
78 Ga0075435_100195807 3300007076 Bacteria 1711
79 Ga0075435_100356281 3300007076 Bacteria 1254
80 Ga0075435_100382229 3300007076 Bacteria 1210
81 Ga0075435_100442485 3300007076 Bacteria 1120
82 Ga0099794_10011896 3300007265 Bacteria 3740
83 Ga0099794_10013270 3300007265 Bacteria 3582
84 Ga0099794_10038054 3300007265 Bacteria 2279
85 Ga0099794_10058587 3300007265 Bacteria 1867
86 Ga0099794_10072712 3300007265 Unclassified 1686
87 Ga0099794_10080885 3300007265 Unclassified 1602
88 Ga0099794_10092704 3300007265 Bacteria 1500
89 Ga0099794_10095549 3300007265 Bacteria 1479
90 Ga0099794_10136136 3300007265 Bacteria 1242
91 Ga0099794_10174144 3300007265 Bacteria 1097
92 Ga0099795_10104998 3300007788 Bacteria 1113
93 Ga0111539_10121097 3300009094 Bacteria 3066
94 Ga0111539_10173897 3300009094 Bacteria 2516
95 Ga0111539_10186929 3300009094 Unclassified 2419
96 Ga0105245_10073651 3300009098 Bacteria 3106
97 Ga0105245_10195961 3300009098 Bacteria 1938
98 Ga0114129_10344990 3300009147 Bacteria 1974
99 Ga0114129_10602825 3300009147 Bacteria 1423
100 Ga0114129_10634097 3300009147 Bacteria 1381
101 Ga0114129_10658298 3300009147 Bacteria 1351
102 Ga0105242_10055557 3300009176 Bacteria 3239
103 Ga0105242_10264974 3300009176 Unclassified 1554
104 Ga0105248_10336017 3300009177 Bacteria 1701
105 Ga0105248_10396075 3300009177 Unclassified 1555
106 Ga0105237_10094405 3300009545 Bacteria 2980
107 Ga0099796_10038610 3300010159 Bacteria 1603
108 Ga0099796_10051904 3300010159 Bacteria 1426
109 Ga0105239_10048089 3300010375 Bacteria 4676
110 Ga0105239_10729686 3300010375 Bacteria 1134
111 Ga0105239_10762993 3300010375 Bacteria 1107
112 Ga0105246_10178858 3300011119 Bacteria 1631
113 Ga0157370_10467275 3300013104 Bacteria 1159
114 Ga0157369_10100114 3300013105 Bacteria 3089
115 Ga0157378_10024798 3300013297 Bacteria 5281
116 Ga0157378_10158706 3300013297 Bacteria 2113
117 Ga0163162_10215043 3300013306 Bacteria 2052
118 Ga0163162_10261939 3300013306 Bacteria 1861
119 Ga0163162_10585704 3300013306 Bacteria 1242
120 Ga0157372_10113214 3300013307 Bacteria 3110
121 Ga0157372_10528733 3300013307 Bacteria 1375
122 Ga0157375_10344735 3300013308 Bacteria 1655
123 Ga0157375_10707667 3300013308 Bacteria 1161
124 Ga0163163_10396773 3300014325 Bacteria 1438
125 Ga0157380_10061114 3300014326 Bacteria 3013
126 Ga0163161_10085734 3300017792 Bacteria 2323
127 Ga0207697_10070033 3300025315 Bacteria 1469
128 Ga0207697_10097541 3300025315 Bacteria 1250
129 Ga0207682_10027016 3300025893 Bacteria 2284
130 Ga0207692_10021714 3300025898 Bacteria 2941
131 Ga0207692_10196181 3300025898 Bacteria 1184
132 Ga0207688_10080129 3300025901 Bacteria 1863
133 Ga0207647_10143267 3300025904 Bacteria 1400
134 Ga0207643_10084344 3300025908 Unclassified 1844
135 Ga0207654_10290448 3300025911 Bacteria 1109
136 Ga0207707_10017385 3300025912 Bacteria 6270
137 Ga0207707_10035499 3300025912 Bacteria 4360
138 Ga0207695_10272819 3300025913 Bacteria 1587
139 Ga0207671_10074523 3300025914 Bacteria 2537
140 Ga0207693_10177076 3300025915 Bacteria 1678
141 Ga0207693_10218422 3300025915 Bacteria 1498
142 Ga0207693_10244758 3300025915 Bacteria 1408
143 Ga0207660_10171540 3300025917 Bacteria 1679
144 Ga0207660_10236374 3300025917 Bacteria 1438
145 Ga0207657_10224035 3300025919 Bacteria 1506
146 Ga0207649_10341174 3300025920 Bacteria 1106
147 Ga0207652_10182357 3300025921 Bacteria 1887
148 Ga0207646_10314384 3300025922 Bacteria 1415
149 Ga0207646_10530717 3300025922 Bacteria 1059
150 Ga0207694_10063592 3300025924 Bacteria 2875
151 Ga0207659_10070720 3300025926 Unclassified 2545
152 Ga0207687_10179764 3300025927 Bacteria 1638
153 Ga0207700_10244962 3300025928 Bacteria 1529
154 Ga0207700_10268744 3300025928 Bacteria 1463
155 Ga0207700_10288286 3300025928 Bacteria 1414
156 Ga0207664_10387079 3300025929 Bacteria 1242
157 Ga0207706_10014873 3300025933 Bacteria 7047
158 Ga0207706_10175572 3300025933 Bacteria 1882
159 Ga0207686_10173282 3300025934 Bacteria 1524
160 Ga0207709_10005054 3300025935 Bacteria 7531
161 Ga0207709_10007671 3300025935 Bacteria 5985
162 Ga0207709_10020993 3300025935 Bacteria 3692
163 Ga0207670_10243634 3300025936 Bacteria 1386
164 Ga0207670_10291853 3300025936 Bacteria 1274
165 Ga0207669_10002860 3300025937 Bacteria 7400
166 Ga0207665_10037645 3300025939 Bacteria 3220
167 Ga0207665_10261634 3300025939 Bacteria 1282
168 Ga0207665_10352011 3300025939 Bacteria 1112
169 Ga0207691_10149170 3300025940 Bacteria 2057
170 Ga0207691_10208846 3300025940 Bacteria 1697
171 Ga0207689_10208925 3300025942 Bacteria 1612
172 Ga0207661_10007954 3300025944 Bacteria 7559
173 Ga0207667_10575151 3300025949 Bacteria 1138
174 Ga0207667_10580008 3300025949 Bacteria 1132
175 Ga0207651_10380883 3300025960 Unclassified 1195
176 Ga0207668_10007464 3300025972 Bacteria 6503
177 Ga0207668_10010818 3300025972 Bacteria 5527
178 Ga0207668_10282310 3300025972 Bacteria 1362
179 Ga0207640_10353668 3300025981 Bacteria 1181
180 Ga0207677_10125961 3300026023 Bacteria 1936
181 Ga0207678_10022793 3300026067 Bacteria 5484
182 Ga0207678_10196869 3300026067 Bacteria 1722
183 Ga0207708_10037969 3300026075 Bacteria 3669
184 Ga0207708_10052588 3300026075 Bacteria 3102
185 Ga0207708_10142137 3300026075 Bacteria 1884
186 Ga0207708_10220672 3300026075 Bacteria 1519
187 Ga0207702_10077359 3300026078 Bacteria 2878
188 Ga0207648_10044679 3300026089 Bacteria 3887
189 Ga0207648_10093497 3300026089 Bacteria 2629
190 Ga0207676_10415061 3300026095 Bacteria 1261
191 Ga0207676_10429998 3300026095 Unclassified 1240
192 Ga0207674_10093100 3300026116 Bacteria 3003
193 Ga0207674_10200689 3300026116 Bacteria 1944
194 Ga0207683_10049325 3300026121 Bacteria 3685
195 Ga0209588_1000839 3300027671 Bacteria 7816
196 Ga0209588_1004780 3300027671 Bacteria 3843
197 Ga0209588_1010574 3300027671 Bacteria 2777
198 Ga0209588_1014661 3300027671 Bacteria 2402
199 Ga0209588_1025016 3300027671 Bacteria 1888
200 Ga0209588_1026754 3300027671 Bacteria 1833
201 Ga0209588_1047209 3300027671 Bacteria 1393
202 Ga0209588_1054491 3300027671 Bacteria 1293
203 Ga0209588_1054925 3300027671 Bacteria 1288
204 Ga0207428_10014418 3300027907 Bacteria 6869
205 Ga0207428_10177116 3300027907 Bacteria 1612
206 Ga0207428_10298225 3300027907 Bacteria 1193
207 Ga0268266_10068382 3300028379 Bacteria 3075
208 Ga0268266_10073315 3300028379 Bacteria 2971
209 Ga0268266_10285020 3300028379 Bacteria 1537
210 Ga0268265_10142550 3300028380 Bacteria 2008
211 Ga0307515_10208768 3300028794 Bacteria 1804
212 Ga0265316_10076463 3300031344 Bacteria 2572
213 Ga0307513_10395825 3300031456 Bacteria 1117
214 Ga0307509_10342757 3300031507 Bacteria 1221
215 Ga0316575_10088997 3300031665 Bacteria 1249
216 Ga0316577_10171576 3300031733 Bacteria 1224
217 Ga0373958_0020619 3300034819 Bacteria 1216
218 Ga0373926_0038432 3300035083 Bacteria 1704
219 Ga0373926_0093330 3300035083 Bacteria 1121
220 Ga0373934_0063382 3300035086 Bacteria 1474
221 Ga0373944_0072751 3300035089 Bacteria 1122
222 Ga0373923_0045529 3300035111 Bacteria 1822
223 Ga0373923_0125141 3300035111 Bacteria 1151
224 Ga0373932_0024998 3300035112 Bacteria 1613
225 Ga0373936_0031374 3300035113 Bacteria 2098
226 Ga0373945_0093841 3300035116 Bacteria 1165
227 Ga0373953_0073813 3300035117 Bacteria 1410
228 Ga0373953_0077776 3300035117 Bacteria 1376
229 Ga0373954_0122694 3300035118 Bacteria 1262
230 Ga0373957_0061810 3300035120 Bacteria 1452
231 Ga0373960_0038520 3300035121 Bacteria 1371
232 Ga0373943_0059039 3300035170 Bacteria 1911
233 Ga0373943_0127320 3300035170 Bacteria 1359
234 Ga0373943_0138870 3300035170 Bacteria 1307
235 Ga0373946_0049256 3300035171 Bacteria 1757
236 Ga0373946_0112970 3300035171 Bacteria 1231
237 Ga0373946_0128549 3300035171 Bacteria 1163
238 Ga0373946_0136927 3300035171 Bacteria 1131
239 Ga0373955_0160540 3300035172 Bacteria 1326
240 Ga0373961_0084784 3300035241 Bacteria 1002
241 Ga0373962_0071070 3300035242 Bacteria 1040
242 Ga0316574_0253779 3300035398 Bacteria 1123
243 Ga0373924_0017134 3300035410 Bacteria 2775
244 Ga0373924_0096536 3300035410 Bacteria 1268
245 Ga0373935_0041759 3300035692 Bacteria 2882
246 Ga0373935_0268894 3300035692 Bacteria 1197
247 Ga0373935_0273967 3300035692 Bacteria 1186
248 Ga0373927_0081952 3300035695 Bacteria 2091
249 Ga0373927_0116219 3300035695 Bacteria 1744
250 Ga0373927_0125799 3300035695 Bacteria 1673
251 Ga0373927_0201967 3300035695 Bacteria 1305
252 Ga0373927_0240176 3300035695 Bacteria 1190
253 Ga0373927_0254047 3300035695 Bacteria 1155
254 Ga0373927_0313148 3300035695 Bacteria 1033
255 Ga0373933_0022158 3300035724 Bacteria 3615
256 Ga0373933_0100624 3300035724 Bacteria 1793
257 Ga0373947_0036982 3300035725 Bacteria 2896
258 Ga0373947_0077007 3300035725 Bacteria 2056
259 Ga0373947_0156182 3300035725 Bacteria 1472
260 Ga0373947_0180126 3300035725 Bacteria 1375
261 Ga0373947_0252053 3300035725 Bacteria 1167
262 Ga0373937_0061135 3300036401 Bacteria 3462
263 Ga0373937_0309312 3300036401 Bacteria 1494
264 Ga0316584_0176137 3300036712 Bacteria 1584
265 Ga0316584_0259499 3300036712 Bacteria 1267
266 Ga0373925_0267129 3300037068 Bacteria 1375
267 Ga0373925_0311534 3300037068 Bacteria 1272
268 Ga0373925_0344861 3300037068 Bacteria 1208
269 Ga0373925_0361165 3300037068 Bacteria 1180
270 Ga0395900_0484981 3300037418 Bacteria 1188
271 Ga0395898_0163199 3300037466 Bacteria 2131
272 Ga0395898_0347721 3300037466 Bacteria 1414
273 Ga0395905_0026897 3300037471 Bacteria 5426
274 Ga0395901_0361853 3300038443 Bacteria 1496
275 Ga0436360_0224679 3300039438 Bacteria 2401
276 Ga0436363_0485272 3300039450 Bacteria 3433
277 Ga0451839_1025085 3300041496 Bacteria 1146
278 Ga0495617_074576 3300046452 Bacteria 1113
279 Ga0495627_060597 3300046453 Bacteria 1120
280 Ga0495592_0187825 3300046454 Bacteria 1402
281 Ga0495592_0238893 3300046454 Bacteria 1206
282 Ga0495603_0119159 3300046455 Bacteria 1538
283 Ga0495603_0133432 3300046455 Bacteria 1445
284 Ga0495603_0141862 3300046455 Bacteria 1397
285 Ga0495603_0160673 3300046455 Bacteria 1303
286 Ga0495591_036672 3300046458 Bacteria 1425
287 Ga0495629_0004078 3300046459 Bacteria 10966
288 Ga0495629_0004237 3300046459 Bacteria 10753
289 Ga0495629_0073142 3300046459 Bacteria 2394
290 Ga0495629_0082590 3300046459 Bacteria 2242
291 Ga0495629_0145940 3300046459 Bacteria 1645
292 Ga0495629_0146164 3300046459 Bacteria 1644
293 Ga0495629_0157377 3300046459 Bacteria 1578
294 Ga0495629_0249513 3300046459 Bacteria 1221
295 Ga0495638_0014421 3300046460 Bacteria 5341
296 Ga0495638_0161045 3300046460 Bacteria 1294
297 Ga0495638_0190636 3300046460 Bacteria 1163
298 Ga0495641_0058864 3300046461 Bacteria 1737
299 Ga0495641_0090077 3300046461 Bacteria 1370
300 Ga0495651_0078359 3300046462 Bacteria 2500
301 Ga0495651_0162172 3300046462 Bacteria 1600
302 Ga0495653_0011411 3300046463 Bacteria 7261
303 Ga0495653_0156423 3300046463 Bacteria 1587
304 Ga0495653_0242487 3300046463 Bacteria 1200
305 Ga0495580_0025348 3300046472 Bacteria 4334
306 Ga0495580_0165213 3300046472 Bacteria 1531
307 Ga0495580_0202690 3300046472 Bacteria 1366
308 Ga0495582_0058808 3300046473 Bacteria 2120
309 Ga0495582_0135421 3300046473 Unclassified 1393
310 Ga0495605_0112683 3300046474 Bacteria 1239
311 Ga0495639_0008895 3300046475 Bacteria 4305
312 Ga0495639_0070974 3300046475 Bacteria 1609
313 Ga0495639_0106957 3300046475 Bacteria 1324
314 Ga0495639_0117288 3300046475 Bacteria 1267
315 Ga0495662_0082679 3300046476 Bacteria 1562
316 Ga0495662_0101186 3300046476 Bacteria 1409
317 Ga0495662_0121454 3300046476 Bacteria 1282
318 Ga0495664_0021043 3300046477 Bacteria 3766
319 Ga0495664_0066279 3300046477 Bacteria 2153
320 Ga0495584_0112270 3300046491 Bacteria 1379
321 Ga0495584_0152244 3300046491 Bacteria 1175
322 Ga0495584_0176940 3300046491 Bacteria 1084
323 Ga0495585_0027336 3300046492 Bacteria 3256
324 Ga0495585_0173635 3300046492 Bacteria 1111
325 Ga0495585_0174464 3300046492 Bacteria 1108
326 Ga0495594_0013372 3300046499 Bacteria 4284
327 Ga0495594_0082948 3300046499 Bacteria 1791
328 Ga0495596_0086701 3300046500 Bacteria 1215
329 Ga0495596_0097783 3300046500 Bacteria 1139
330 Ga0495607_0015350 3300046501 Bacteria 4967
331 Ga0495607_0122586 3300046501 Bacteria 1362
332 Ga0495607_0134176 3300046501 Bacteria 1284
333 Ga0495583_0103653 3300046506 Bacteria 1212
334 Ga0495583_0123580 3300046506 Bacteria 1087
335 Ga0495608_0091155 3300046511 Bacteria 1971
336 Ga0495608_0186368 3300046511 Bacteria 1311
337 Ga0495608_0213139 3300046511 Bacteria 1213
338 Ga0495616_0088193 3300046513 Bacteria 1473
339 Ga0495616_0127267 3300046513 Bacteria 1170
340 Ga0495618_0003442 3300046514 Bacteria 9838
341 Ga0495618_0024958 3300046514 Bacteria 3707
342 Ga0495618_0087827 3300046514 Bacteria 1988
343 Ga0495618_0101423 3300046514 Bacteria 1842
344 Ga0495618_0211521 3300046514 Bacteria 1225
345 Ga0495628_0054182 3300046516 Bacteria 3162
346 Ga0495628_0102202 3300046516 Bacteria 2212
347 Ga0495628_0290194 3300046516 Bacteria 1213
348 Ga0495630_0041005 3300046517 Bacteria 3458
349 Ga0495630_0054992 3300046517 Bacteria 2982
350 Ga0495630_0057984 3300046517 Bacteria 2902
351 Ga0495630_0216053 3300046517 Bacteria 1463
352 Ga0495630_0216905 3300046517 Bacteria 1460
353 Ga0495631_0084058 3300046518 Bacteria 1372
354 Ga0495631_0089803 3300046518 Bacteria 1323
355 Ga0495631_0108513 3300046518 Bacteria 1193
356 Ga0495632_0083287 3300046519 Bacteria 1523
357 Ga0495637_0069275 3300046520 Bacteria 1427
358 Ga0495644_0043801 3300046523 Bacteria 1683
359 Ga0495648_0004418 3300046524 Bacteria 12013
360 Ga0495663_0036090 3300046525 Bacteria 1487
361 Ga0495666_0082341 3300046526 Bacteria 1521
362 Ga0495666_0097733 3300046526 Bacteria 1384
363 Ga0495666_0106305 3300046526 Bacteria 1320
364 Ga0495666_0149659 3300046526 Bacteria 1085
365 Ga0495642_0064983 3300046528 Bacteria 1518
366 Ga0495652_0035625 3300046529 Bacteria 4331
367 Ga0495652_0133199 3300046529 Bacteria 1964
368 Ga0495652_0188648 3300046529 Bacteria 1575
369 Ga0495665_0047525 3300046531 Bacteria 2276
370 Ga0495665_0122018 3300046531 Bacteria 1364
371 Ga0495665_0144613 3300046531 Bacteria 1242
372 Ga0495665_0175787 3300046531 Unclassified 1113
373 Ga0495640_0001058 3300046533 Bacteria 21427
374 Ga0495640_0006342 3300046533 Bacteria 9374
375 Ga0495640_0008012 3300046533 Bacteria 8301
376 Ga0495640_0021997 3300046533 Bacteria 4669
377 Ga0495640_0058231 3300046533 Plasmid 2635
378 Ga0495640_0190358 3300046533 Bacteria 1304
379 Ga0495587_0003500 3300046536 Bacteria 10457
380 Ga0495587_0210579 3300046536 Bacteria 1098
381 Ga0495587_0224304 3300046536 Bacteria 1059
382 Ga0495598_0060587 3300046537 Bacteria 1166
383 Ga0495598_0065922 3300046537 Bacteria 1128
384 Ga0495609_0117205 3300046538 Bacteria 1146
385 Ga0495621_0004372 3300046539 Bacteria 3971
386 Ga0495621_0075840 3300046539 Bacteria 1247
387 Ga0495645_0050635 3300046543 Bacteria 3023
388 Ga0495645_0061730 3300046543 Bacteria 2715
389 Ga0495645_0074561 3300046543 Bacteria 2443
390 Ga0495645_0135985 3300046543 Bacteria 1719
391 Ga0495622_0120882 3300046557 Bacteria 1196
392 Ga0495622_0130942 3300046557 Bacteria 1142
393 Ga0495633_0025442 3300046558 Bacteria 2914
394 Ga0495633_0141424 3300046558 Bacteria 1112
395 Ga0495667_0041057 3300046559 Bacteria 3069
396 Ga0495667_0220199 3300046559 Bacteria 1211
397 Ga0495667_0231282 3300046559 Bacteria 1178
398 Ga0495656_0057716 3300046615 Bacteria 1681
399 Ga0495656_0148078 3300046615 Bacteria 1131
400 Ga0495668_0117054 3300046616 Bacteria 1457
401 Ga0495668_0166725 3300046616 Bacteria 1206
402 Ga0495634_0025225 3300046642 Bacteria 4164
403 Ga0495634_0078630 3300046642 Bacteria 2160
404 Ga0495634_0141277 3300046642 Bacteria 1528
405 Ga0495634_0142532 3300046642 Bacteria 1520
406 Ga0495634_0158960 3300046642 Bacteria 1425
407 Ga0495634_0232867 3300046642 Bacteria 1132
408 Ga0495611_0013870 3300046648 Bacteria 3437
409 Ga0495611_0062750 3300046648 Bacteria 1690
410 Ga0495611_0089965 3300046648 Bacteria 1418
411 Ga0495611_0130403 3300046648 Bacteria 1172
412 Ga0495625_0065503 3300046660 Bacteria 2561
413 Ga0495625_0139363 3300046660 Bacteria 1637
414 Ga0495635_0005126 3300046663 Bacteria 9116
415 Ga0495635_0011879 3300046663 Bacteria 6104
416 Ga0495635_0078839 3300046663 Bacteria 2255
417 Ga0495635_0221023 3300046663 Bacteria 1281
418 Ga0495635_0272330 3300046663 Bacteria 1138
419 Ga0495659_0019386 3300046664 Bacteria 2276
420 Ga0495659_0086026 3300046664 Bacteria 1200
421 Ga0495659_0098246 3300046664 Bacteria 1131
422 Ga0495661_0151047 3300046665 Bacteria 1254
423 Ga0495661_0166490 3300046665 Bacteria 1179
424 Ga0495588_0086187 3300046674 Bacteria 1642
425 Ga0495588_0159078 3300046674 Bacteria 1194
426 Ga0495588_0186985 3300046674 Bacteria 1094
427 Ga0495599_0024320 3300046678 Bacteria 3788
428 Ga0495599_0159112 3300046678 Bacteria 1396
429 Ga0495599_0252334 3300046678 Bacteria 1073
430 Ga0495623_0005531 3300046679 Bacteria 8254
431 Ga0495623_0031085 3300046679 Bacteria 3435
432 Ga0495646_0032769 3300046680 Bacteria 3232
433 Ga0495646_0041132 3300046680 Bacteria 2841
434 Ga0495646_0148516 3300046680 Bacteria 1305
435 Ga0495646_0166899 3300046680 Bacteria 1215
436 Ga0495647_0013274 3300046681 Bacteria 2851
437 Ga0495647_0043777 3300046681 Bacteria 1714
438 Ga0495647_0088066 3300046681 Bacteria 1269
439 Ga0495647_0113117 3300046681 Bacteria 1134
440 Ga0495647_0140151 3300046681 Bacteria 1031
441 Ga0495658_0085258 3300046683 Bacteria 1861
442 Ga0495658_0100444 3300046683 Bacteria 1726
443 Ga0495658_0210574 3300046683 Bacteria 1214
444 Ga0495658_0227487 3300046683 Bacteria 1169
445 Ga0495669_0064956 3300046684 Bacteria 1656
446 Ga0495613_0196079 3300046689 Bacteria 1425
447 Ga0495613_0239980 3300046689 Bacteria 1267
448 Ga0495613_0248263 3300046689 Bacteria 1242
449 Ga0495624_0016238 3300046690 Bacteria 5013
450 Ga0495624_0114269 3300046690 Bacteria 1659
451 Ga0495624_0273879 3300046690 Bacteria 1020
452 Ga0495670_0012957 3300046691 Bacteria 4099
453 Ga0495670_0031741 3300046691 Bacteria 2625
454 Ga0495670_0040461 3300046691 Bacteria 2324
455 Ga0495671_0138235 3300046692 Bacteria 1187
456 Ga0495649_0139111 3300046694 Bacteria 1279
457 Ga0495649_0184436 3300046694 Bacteria 1088
458 Ga0495589_0037538 3300046794 Bacteria 2427
459 Ga0495589_0123250 3300046794 Bacteria 1247
460 Ga0495600_0003901 3300046809 Bacteria 8856
461 Ga0495600_0009456 3300046809 Bacteria 6023
462 Ga0495600_0011988 3300046809 Bacteria 5413
463 Ga0495600_0145110 3300046809 Bacteria 1538
464 Ga0495581_0120638 3300047315 Bacteria 1526
465 Ga0495581_0177679 3300047315 Bacteria 1244
466 Ga0495581_0216899 3300047315 Bacteria 1118
467 Ga0495604_0031270 3300047317 Bacteria 4223
468 Ga0495604_0148047 3300047317 Bacteria 1671
469 Ga0495604_0258833 3300047317 Bacteria 1183
470 Ga0495636_0053005 3300047318 Bacteria 1702
471 Ga0495636_0117256 3300047318 Bacteria 1175
472 Ga0495674_0001881 3300047319 Bacteria 20669
473 Ga0495674_0020337 3300047319 Bacteria 6146
474 Ga0495674_0129008 3300047319 Bacteria 2131
475 Ga0495674_0178856 3300047319 Bacteria 1767
476 Ga0495674_0402632 3300047319 Bacteria 1104
477 Ga0495672_0011148 3300047320 Bacteria 6358
478 Ga0495672_0075654 3300047320 Bacteria 1893
479 Ga0495676_0012818 3300047321 Bacteria 7540
480 Ga0495676_0184616 3300047321 Bacteria 1459
481 Ga0495676_0244657 3300047321 Bacteria 1226
482 Ga0495676_0263212 3300047321 Bacteria 1172
483 Ga0495676_0266566 3300047321 Bacteria 1163
484 Ga0495680_0001664 3300047322 Bacteria 23637
485 Ga0495680_0076721 3300047322 Bacteria 2533
486 Ga0495680_0227980 3300047322 Bacteria 1327
487 Ga0495683_0017077 3300047323 Bacteria 3764
488 Ga0495683_0109824 3300047323 Bacteria 1317
489 Ga0495675_0191167 3300047444 Bacteria 1249
490 Ga0495675_0213751 3300047444 Bacteria 1169
491 Ga0495677_0031620 3300047445 Bacteria 1926
492 Ga0495677_0093115 3300047445 Bacteria 1136
493 Ga0495679_030355 3300047446 Bacteria 1755
494 Ga0495679_040438 3300047446 Bacteria 1449
495 Ga0495685_050698 3300047447 Bacteria 1409
496 Ga0495673_0057275 3300047469 Bacteria 1683
497 Ga0495681_0085708 3300047470 Bacteria 1398
498 Ga0495684_0003144 3300047471 Bacteria 12939
499 Ga0495684_0011170 3300047471 Bacteria 6938
500 Ga0495684_0024291 3300047471 Bacteria 4665
501 Ga0495684_0226812 3300047471 Bacteria 1367
502 Ga0495686_0110207 3300047472 Bacteria 1651
503 Ga0495593_0017246 3300047673 Bacteria 4063
504 Ga0495593_0110639 3300047673 Bacteria 1403
505 Ga0495593_0159859 3300047673 Bacteria 1137
506 Ga0495593_0160358 3300047673 Bacteria 1135
507 Ga0495602_0067537 3300048088 Bacteria 3075
508 Ga0495614_0141124 3300048089 Bacteria 1070
509 Ga0495615_0032145 3300048090 Bacteria 1263
510 Ga0496101_0276821 3300048904 Bacteria 1311
511 Ga0496102_0473808 3300048905 Bacteria 1173
512 Ga0496104_0326366 3300048907 Bacteria 1448
513 Ga0496104_0368405 3300048907 Bacteria 1349
514 Ga0496105_0290349 3300048908 Bacteria 1317
515 Ga0496106_0356153 3300048909 Bacteria 1176
516 Ga0496107_0259124 3300048910 Bacteria 1294
517 Ga0496109_0233534 3300048912 Bacteria 1730
518 Ga0496109_0481646 3300048912 Bacteria 1171
519 Ga0496112_0458281 3300048915 Bacteria 1212
520 Ga0496113_0322447 3300048916 Bacteria 1238
521 Ga0496115_0351258 3300048918 Bacteria 1202
522 Ga0496121_0209843 3300048924 Bacteria 1381
523 Ga0496126_0017981 3300048929 Bacteria 7028
524 Ga0496126_0018102 3300048929 Bacteria 6995
525 Ga0495682_0017855 3300049460 Bacteria 2673
526 nmdc:mga06z11_89660_c1 3300050494 Bacteria 1667
527 nmdc:mga05p37_112454_c1 3300050507 Bacteria 3349
528 nmdc:mga05p37_123381_c1 3300050507 Bacteria 3182
529 nmdc:mga05p37_14284_c1 3300050507 Bacteria 9536
530 nmdc:mga05p37_146065_c1 3300050507 Bacteria 2896
531 nmdc:mga05p37_17548_c1 3300050507 Bacteria 8641
532 nmdc:mga05p37_437098_c1 3300050507 Bacteria 1519
533 nmdc:mga05p37_49656_c1 3300050507 Bacteria 5161
534 nmdc:mga05p37_595796_c1 3300050507 Bacteria 1249
535 nmdc:mga05p37_728489_c1 3300050507 Bacteria 1097
536 nmdc:mga09592_208552_c1 3300050508 Bacteria 1693
537 nmdc:mga09592_36353_c1 3300050508 Bacteria 4125
538 nmdc:mga0qj67_360557_c1 3300050509 Bacteria 1175
539 nmdc:mga0qj67_8436_c1 3300050509 Bacteria 7645
540 nmdc:mga06r32_185010_c1 3300050510 Bacteria 2070
541 nmdc:mga06r32_446199_c1 3300050510 Bacteria 1274
542 nmdc:mga06r32_470308_c1 3300050510 Bacteria 1236
543 nmdc:mga06r32_84544_c1 3300050510 Bacteria 3093
544 nmdc:mga08y16_147178_c1 3300050511 Unclassified 2448
545 nmdc:mga08y16_203101_c1 3300050511 Bacteria 2054
546 nmdc:mga08y16_3173_c1 3300050511 Bacteria 17018
547 nmdc:mga08y16_35747_c1 3300050511 Bacteria 5218
548 nmdc:mga08y16_384793_c1 3300050511 Bacteria 1438
549 nmdc:mga08y16_48876_c1 3300050511 Bacteria 4427
550 nmdc:mga0n895_212286_c1 3300050512 Bacteria 1966
551 nmdc:mga0n895_244118_c1 3300050512 Bacteria 1823
552 nmdc:mga0n895_43428_c1 3300050512 Bacteria 4380
553 nmdc:mga0n895_45830_c1 3300050512 Bacteria 4269
554 nmdc:mga0n895_472588_c1 3300050512 Bacteria 1265
555 nmdc:mga0rr50_21931_c1 3300050513 Bacteria 4371
556 nmdc:mga0rr50_268197_c1 3300050513 Bacteria 1422
557 nmdc:mga0rr50_385129_c1 3300050513 Bacteria 1183
558 nmdc:mga0a205_217821_c1 3300050515 Bacteria 1796
559 nmdc:mga0a205_232891_c1 3300050515 Bacteria 1725
560 nmdc:mga0a205_386752_c1 3300050515 Bacteria 1264
561 Ga0495601_0002373 3300053077 Bacteria 10671
562 Ga0495601_0023857 3300053077 Bacteria 3761
563 Ga0495601_0041306 3300053077 Bacteria 2890
564 Ga0495601_0077238 3300053077 Bacteria 2132
565 Ga0495601_0158363 3300053077 Bacteria 1479
566 Ga0495601_0210708 3300053077 Bacteria 1269
567 Ga0495612_0002936 3300053078 Bacteria 7071
568 Ga0495612_0046030 3300053078 Bacteria 1786
569 Ga0495655_0011717 3300053083 Bacteria 1769
570 Ga0495655_0030035 3300053083 Bacteria 1311
571 Ga0495655_0033692 3300053083 Bacteria 1262
572 Ga0495595_0102350 3300053084 Bacteria 1383
573 Ga0495595_0108675 3300053084 Bacteria 1343
574 Ga0495595_0140993 3300053084 Bacteria 1182
575 Ga0495619_0001546 3300053085 Bacteria 15159
576 Ga0495619_0003379 3300053085 Bacteria 10312
577 Ga0495619_0028063 3300053085 Bacteria 3629
578 Ga0495619_0028657 3300053085 Bacteria 3593
579 Ga0495619_0035955 3300053085 Bacteria 3224
580 Ga0500651_0000666 3300053093 Bacteria 17091
581 Ga0500595_027475 3300053119 Bacteria 1948
582 Ga0500658_0000628 3300053134 Bacteria 14610
583 Ga0500568_0003547 3300053139 Bacteria 8635
584 Ga0500577_0040697 3300053142 Bacteria 1692
585 Ga0500627_0003802 3300053158 Bacteria 4742
586 Ga0500634_0013459 3300053161 Bacteria 4290
587 Ga0500657_104062 3300053728 Bacteria 1164

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100019478 Ga0070698_10001947810 261
2 3300053119 Ga0500595_027475 Ga0500595_027475_710_1591 293
3 3300048089 Ga0495614_0141124 Ga0495614_0141124_161_1060 299
4 3300046533 Ga0495640_0006342 Ga0495640_0006342_686_1645 301
5 3300031665 Ga0316575_10088997 Ga0316575_100889972 303
6 3300035241 Ga0373961_0084784 Ga0373961_0084784_51_962 303
7 3300035242 Ga0373962_0071070 Ga0373962_0071070_55_966 303
8 3300013104 Ga0157370_10467275 Ga0157370_104672752 304
9 3300005471 Ga0070698_100074283 Ga0070698_1000742832 306
10 3300046681 Ga0495647_0140151 Ga0495647_0140151_80_1000 306
11 3300041496 Ga0451839_1025085 Ga0451839_1025085_164_1096 310
12 3300005536 Ga0070697_100092007 Ga0070697_1000920074 314
13 iso_pu_bacteria 8056681323 8056688912 314
14 3300013306 Ga0163162_10215043 Ga0163162_102150433 317
15 3300035111 Ga0373923_0125141 Ga0373923_0125141_176_1135 319
16 3300035724 Ga0373933_0022158 Ga0373933_0022158_1076_2035 319
17 3300046477 Ga0495664_0066279 Ga0495664_0066279_957_1931 319
18 3300046491 Ga0495584_0112270 Ga0495584_0112270_384_1343 319
19 3300046518 Ga0495631_0089803 Ga0495631_0089803_292_1251 319
20 3300047323 Ga0495683_0017077 Ga0495683_0017077_315_1274 319
21 3300047445 Ga0495677_0031620 Ga0495677_0031620_23_1039 319
22 3300006028 Ga0070717_10027562 Ga0070717_100275624 320
23 3300005543 Ga0070672_100053965 Ga0070672_1000539653 322
24 3300046690 Ga0495624_0273879 Ga0495624_0273879_39_1010 323
25 3300035695 Ga0373927_0125799 Ga0373927_0125799_19_1005 325
26 3300005333 Ga0070677_10065383 Ga0070677_100653832 326
27 3300005340 Ga0070689_100026697 Ga0070689_1000266976 326
28 3300005353 Ga0070669_100155005 Ga0070669_1001550052 326
29 3300005354 Ga0070675_100041168 Ga0070675_1000411682 326
30 3300005439 Ga0070711_100247924 Ga0070711_1002479241 326
31 3300005441 Ga0070700_100276538 Ga0070700_1002765381 326
32 3300005466 Ga0070685_10081192 Ga0070685_100811921 326
33 3300005615 Ga0070702_100202546 Ga0070702_1002025461 326
34 3300005617 Ga0068859_100116741 Ga0068859_1001167412 326
35 3300005618 Ga0068864_100297127 Ga0068864_1002971272 326
36 3300005843 Ga0068860_100413064 Ga0068860_1004130642 326
37 3300005844 Ga0068862_100303359 Ga0068862_1003033591 326
38 3300006881 Ga0068865_100364556 Ga0068865_1003645561 326
39 3300006931 Ga0097620_100116749 Ga0097620_1001167495 326
40 3300009094 Ga0111539_10186929 Ga0111539_101869293 326
41 3300009176 Ga0105242_10264974 Ga0105242_102649742 326
42 3300009177 Ga0105248_10396075 Ga0105248_103960752 326
43 3300014325 Ga0163163_10396773 Ga0163163_103967732 326
44 3300025898 Ga0207692_10196181 Ga0207692_101961811 326
45 3300025908 Ga0207643_10084344 Ga0207643_100843443 326
46 3300025926 Ga0207659_10070720 Ga0207659_100707202 326
47 3300025936 Ga0207670_10243634 Ga0207670_102436342 326
48 3300025940 Ga0207691_10149170 Ga0207691_101491704 326
49 3300025960 Ga0207651_10380883 Ga0207651_103808831 326
50 3300026075 Ga0207708_10142137 Ga0207708_101421372 326
51 3300026095 Ga0207676_10429998 Ga0207676_104299981 326
52 3300050511 nmdc:mga08y16_147178_c1 nmdc:mga08y16_147178_c1_134_1114 326
53 3300039438 Ga0436360_0224679 Ga0436360_0224679_1328_2311 327
54 3300046681 Ga0495647_0088066 Ga0495647_0088066_10_993 327
55 3300007265 Ga0099794_10136136 Ga0099794_101361361 328
56 3300035695 Ga0373927_0313148 Ga0373927_0313148_34_1020 328
57 3300035725 Ga0373947_0252053 Ga0373947_0252053_153_1139 328
58 3300046459 Ga0495629_0145940 Ga0495629_0145940_608_1594 328
59 3300046536 Ga0495587_0224304 Ga0495587_0224304_48_1034 328
60 3300046663 Ga0495635_0005126 Ga0495635_0005126_5032_6033 329
61 3300046681 Ga0495647_0043777 Ga0495647_0043777_18_1019 329
62 3300025898 Ga0207692_10021714 Ga0207692_100217143 330
63 3300005327 Ga0070658_10470099 Ga0070658_104700991 331
64 3300005337 Ga0070682_100095274 Ga0070682_1000952741 331
65 3300005578 Ga0068854_100105684 Ga0068854_1001056842 331
66 3300005614 Ga0068856_100286396 Ga0068856_1002863962 331
67 3300010375 Ga0105239_10762993 Ga0105239_107629931 331
68 3300025911 Ga0207654_10290448 Ga0207654_102904481 331
69 3300025913 Ga0207695_10272819 Ga0207695_102728193 331
70 3300025914 Ga0207671_10074523 Ga0207671_100745231 331
71 3300025920 Ga0207649_10341174 Ga0207649_103411741 331
72 3300025921 Ga0207652_10182357 Ga0207652_101823573 331
73 3300025924 Ga0207694_10063592 Ga0207694_100635923 331
74 3300025940 Ga0207691_10208846 Ga0207691_102088462 331
75 3300025949 Ga0207667_10580008 Ga0207667_105800082 331
76 3300025981 Ga0207640_10353668 Ga0207640_103536681 331
77 3300026067 Ga0207678_10196869 Ga0207678_101968691 331
78 3300026116 Ga0207674_10093100 Ga0207674_100931007 331
79 3300007076 Ga0075435_100442485 Ga0075435_1004424851 333
80 3300025917 Ga0207660_10171540 Ga0207660_101715401 333
81 iso_pu_bacteria 2935810662 2935811965 333
82 iso_pu_bacteria 2936037263 2936038548 333
83 3300031733 Ga0316577_10171576 Ga0316577_101715762 334
84 3300035410 Ga0373924_0017134 Ga0373924_0017134_61_1065 334
85 3300035724 Ga0373933_0100624 Ga0373933_0100624_722_1726 334
86 3300036401 Ga0373937_0061135 Ga0373937_0061135_187_1191 334
87 3300046514 Ga0495618_0101423 Ga0495618_0101423_147_1151 334
88 3300046536 Ga0495587_0003500 Ga0495587_0003500_9254_10258 334
89 3300047444 Ga0495675_0191167 Ga0495675_0191167_10_1014 334
90 iso_pu_bacteria 2513237098 2513677318 334
91 iso_pu_bacteria 2513237141 1024 334
92 iso_pu_bacteria 2885383462 2885392449 334
93 iso_pu_bacteria 2935675223 2935680200 334
94 iso_pu_bacteria 2935684952 2935693693 334
95 iso_pu_bacteria 2935694250 2935700760 334
96 iso_pu_bacteria 2935713505 2935722804 334
97 iso_pu_bacteria 2935722832 2935732137 334
98 iso_pu_bacteria 2935732158 2935740908 334
99 iso_pu_bacteria 2935741537 2935750389 334
100 iso_pu_bacteria 2935750917 2935759878 334
101 iso_pu_bacteria 2935760218 2935767938 334
102 iso_pu_bacteria 2935760218 2935768736 334
103 iso_pu_bacteria 2940556831 2940565783 334
104 iso_pu_bacteria 8006973647 8006984277 334
105 iso_pu_bacteria 8056681323 8056682637 334
106 iso_pu_bacteria 8056681323 8056684121 334
107 iso_pu_bacteria 8056681323 8056687030 334
108 iso_pu_bacteria 8056681323 8056689360 334
109 iso_pu_bacteria 8056681323 8056689438 334
110 3300035725 Ga0373947_0036982 Ga0373947_0036982_1162_2169 335
111 3300046459 Ga0495629_0004078 Ga0495629_0004078_6210_7217 335
112 3300046463 Ga0495653_0011411 Ga0495653_0011411_3957_4964 335
113 3300046514 Ga0495618_0003442 Ga0495618_0003442_275_1282 335
114 3300046516 Ga0495628_0102202 Ga0495628_0102202_1175_2182 335
115 3300046517 Ga0495630_0054992 Ga0495630_0054992_153_1160 335
116 3300046533 Ga0495640_0001058 Ga0495640_0001058_354_1361 335
117 3300046642 Ga0495634_0142532 Ga0495634_0142532_277_1284 335
118 3300046809 Ga0495600_0003901 Ga0495600_0003901_141_1148 335
119 3300047317 Ga0495604_0031270 Ga0495604_0031270_2729_3736 335
120 3300047319 Ga0495674_0001881 Ga0495674_0001881_277_1284 335
121 3300047322 Ga0495680_0001664 Ga0495680_0001664_6788_7795 335
122 3300047471 Ga0495684_0003144 Ga0495684_0003144_11571_12578 335
123 3300047673 Ga0495593_0110639 Ga0495593_0110639_87_1190 335
124 3300053077 Ga0495601_0002373 Ga0495601_0002373_9093_10100 335
125 3300053085 Ga0495619_0003379 Ga0495619_0003379_213_1220 335
126 iso_pu_bacteria 8019648815 8019649735 335
127 3300047317 Ga0495604_0148047 Ga0495604_0148047_17_1027 336
128 3300005456 Ga0070678_100092318 Ga0070678_1000923182 337
129 3300026121 Ga0207683_10049325 Ga0207683_100493252 337
130 3300035118 Ga0373954_0122694 Ga0373954_0122694_124_1137 337
131 3300000532 CNAas_1003295 CNAas_10032951 338
132 3300000545 CNXas_1003844 CNXas_10038441 338
133 3300005295 Ga0065707_10178941 Ga0065707_101789413 338
134 3300005336 Ga0070680_100055293 Ga0070680_1000552932 338
135 3300005337 Ga0070682_100285419 Ga0070682_1002854191 338
136 3300005340 Ga0070689_100184195 Ga0070689_1001841952 338
137 3300005353 Ga0070669_100128804 Ga0070669_1001288042 338
138 3300005355 Ga0070671_100459590 Ga0070671_1004595901 338
139 3300005356 Ga0070674_100006914 Ga0070674_1000069145 338
140 3300005364 Ga0070673_100238003 Ga0070673_1002380032 338
141 3300005434 Ga0070709_10175854 Ga0070709_101758542 338
142 3300005435 Ga0070714_100395389 Ga0070714_1003953891 338
143 3300005438 Ga0070701_10161942 Ga0070701_101619422 338
144 3300005439 Ga0070711_100152925 Ga0070711_1001529252 338
145 3300005456 Ga0070678_100027690 Ga0070678_1000276901 338
146 3300005457 Ga0070662_100212641 Ga0070662_1002126411 338
147 3300005457 Ga0070662_100238911 Ga0070662_1002389111 338
148 3300005471 Ga0070698_100033791 Ga0070698_1000337914 338
149 3300005471 Ga0070698_100073930 Ga0070698_1000739302 338
150 3300005518 Ga0070699_100144157 Ga0070699_1001441571 338
151 3300005530 Ga0070679_100310157 Ga0070679_1003101572 338
152 3300005535 Ga0070684_100033476 Ga0070684_1000334768 338
153 3300005536 Ga0070697_100194021 Ga0070697_1001940212 338
154 3300005536 Ga0070697_100291569 Ga0070697_1002915692 338
155 3300005536 Ga0070697_100382304 Ga0070697_1003823041 338
156 3300005544 Ga0070686_100040398 Ga0070686_1000403983 338
157 3300005548 Ga0070665_100158593 Ga0070665_1001585932 338
158 3300005548 Ga0070665_100294652 Ga0070665_1002946521 338
159 3300005563 Ga0068855_100456035 Ga0068855_1004560352 338
160 3300005563 Ga0068855_100512900 Ga0068855_1005129001 338
161 3300005577 Ga0068857_100355303 Ga0068857_1003553032 338
162 3300005578 Ga0068854_100323812 Ga0068854_1003238122 338
163 3300005937 Ga0081455_10014335 Ga0081455_1001433511 338
164 3300005983 Ga0081540_1033526 Ga0081540_10335262 338
165 3300005983 Ga0081540_1040307 Ga0081540_10403072 338
166 3300005983 Ga0081540_1041311 Ga0081540_10413112 338
167 3300005983 Ga0081540_1082365 Ga0081540_10823651 338
168 3300006028 Ga0070717_10224909 Ga0070717_102249092 338
169 3300006028 Ga0070717_10404536 Ga0070717_104045361 338
170 3300006163 Ga0070715_10123177 Ga0070715_101231772 338
171 3300006173 Ga0070716_100274903 Ga0070716_1002749031 338
172 3300006175 Ga0070712_100058334 Ga0070712_1000583341 338
173 3300006175 Ga0070712_100100390 Ga0070712_1001003902 338
174 3300006175 Ga0070712_100177728 Ga0070712_1001777282 338
175 3300006178 Ga0075367_10120923 Ga0075367_101209232 338
176 3300006353 Ga0075370_10027168 Ga0075370_100271684 338
177 3300006353 Ga0075370_10062569 Ga0075370_100625694 338
178 3300006844 Ga0075428_100633553 Ga0075428_1006335531 338
179 3300006852 Ga0075433_10355910 Ga0075433_103559101 338
180 3300006871 Ga0075434_100039981 Ga0075434_1000399816 338
181 3300006871 Ga0075434_100159796 Ga0075434_1001597962 338
182 3300006871 Ga0075434_100483891 Ga0075434_1004838912 338
183 3300006880 Ga0075429_100270138 Ga0075429_1002701382 338
184 3300007076 Ga0075435_100195807 Ga0075435_1001958073 338
185 3300007076 Ga0075435_100356281 Ga0075435_1003562812 338
186 3300007076 Ga0075435_100382229 Ga0075435_1003822291 338
187 3300007265 Ga0099794_10011896 Ga0099794_100118965 338
188 3300007265 Ga0099794_10013270 Ga0099794_100132703 338
189 3300007265 Ga0099794_10038054 Ga0099794_100380542 338
190 3300007265 Ga0099794_10058587 Ga0099794_100585871 338
191 3300007265 Ga0099794_10072712 Ga0099794_100727122 338
192 3300007265 Ga0099794_10080885 Ga0099794_100808852 338
193 3300007265 Ga0099794_10092704 Ga0099794_100927042 338
194 3300007265 Ga0099794_10095549 Ga0099794_100955492 338
195 3300007265 Ga0099794_10174144 Ga0099794_101741441 338
196 3300007788 Ga0099795_10104998 Ga0099795_101049981 338
197 3300009094 Ga0111539_10121097 Ga0111539_101210974 338
198 3300009094 Ga0111539_10173897 Ga0111539_101738974 338
199 3300009098 Ga0105245_10073651 Ga0105245_100736516 338
200 3300009098 Ga0105245_10195961 Ga0105245_101959612 338
201 3300009147 Ga0114129_10344990 Ga0114129_103449902 338
202 3300009147 Ga0114129_10602825 Ga0114129_106028252 338
203 3300009147 Ga0114129_10634097 Ga0114129_106340971 338
204 3300009147 Ga0114129_10658298 Ga0114129_106582981 338
205 3300009176 Ga0105242_10055557 Ga0105242_100555575 338
206 3300009177 Ga0105248_10336017 Ga0105248_103360173 338
207 3300009545 Ga0105237_10094405 Ga0105237_100944052 338
208 3300010159 Ga0099796_10038610 Ga0099796_100386102 338
209 3300010159 Ga0099796_10051904 Ga0099796_100519041 338
210 3300010375 Ga0105239_10048089 Ga0105239_100480894 338
211 3300010375 Ga0105239_10729686 Ga0105239_107296861 338
212 3300011119 Ga0105246_10178858 Ga0105246_101788582 338
213 3300013105 Ga0157369_10100114 Ga0157369_101001141 338
214 3300013297 Ga0157378_10024798 Ga0157378_100247984 338
215 3300013297 Ga0157378_10158706 Ga0157378_101587062 338
216 3300013306 Ga0163162_10261939 Ga0163162_102619392 338
217 3300013306 Ga0163162_10585704 Ga0163162_105857041 338
218 3300013307 Ga0157372_10113214 Ga0157372_101132143 338
219 3300013307 Ga0157372_10528733 Ga0157372_105287331 338
220 3300013308 Ga0157375_10344735 Ga0157375_103447351 338
221 3300013308 Ga0157375_10707667 Ga0157375_107076671 338
222 3300014326 Ga0157380_10061114 Ga0157380_100611141 338
223 3300017792 Ga0163161_10085734 Ga0163161_100857343 338
224 3300025315 Ga0207697_10070033 Ga0207697_100700331 338
225 3300025315 Ga0207697_10097541 Ga0207697_100975412 338
226 3300025893 Ga0207682_10027016 Ga0207682_100270162 338
227 3300025901 Ga0207688_10080129 Ga0207688_100801292 338
228 3300025904 Ga0207647_10143267 Ga0207647_101432672 338
229 3300025912 Ga0207707_10017385 Ga0207707_100173852 338
230 3300025912 Ga0207707_10035499 Ga0207707_100354992 338
231 3300025915 Ga0207693_10177076 Ga0207693_101770762 338
232 3300025915 Ga0207693_10218422 Ga0207693_102184221 338
233 3300025915 Ga0207693_10244758 Ga0207693_102447581 338
234 3300025917 Ga0207660_10236374 Ga0207660_102363741 338
235 3300025919 Ga0207657_10224035 Ga0207657_102240351 338
236 3300025922 Ga0207646_10314384 Ga0207646_103143842 338
237 3300025922 Ga0207646_10530717 Ga0207646_105307171 338
238 3300025927 Ga0207687_10179764 Ga0207687_101797642 338
239 3300025928 Ga0207700_10244962 Ga0207700_102449621 338
240 3300025928 Ga0207700_10268744 Ga0207700_102687442 338
241 3300025928 Ga0207700_10288286 Ga0207700_102882862 338
242 3300025929 Ga0207664_10387079 Ga0207664_103870792 338
243 3300025933 Ga0207706_10014873 Ga0207706_100148737 338
244 3300025933 Ga0207706_10175572 Ga0207706_101755721 338
245 3300025934 Ga0207686_10173282 Ga0207686_101732821 338
246 3300025935 Ga0207709_10005054 Ga0207709_1000505410 338
247 3300025935 Ga0207709_10007671 Ga0207709_100076712 338
248 3300025935 Ga0207709_10020993 Ga0207709_100209932 338
249 3300025936 Ga0207670_10291853 Ga0207670_102918532 338
250 3300025937 Ga0207669_10002860 Ga0207669_100028605 338
251 3300025939 Ga0207665_10037645 Ga0207665_100376453 338
252 3300025939 Ga0207665_10261634 Ga0207665_102616342 338
253 3300025939 Ga0207665_10352011 Ga0207665_103520111 338
254 3300025942 Ga0207689_10208925 Ga0207689_102089252 338
255 3300025944 Ga0207661_10007954 Ga0207661_100079548 338
256 3300025949 Ga0207667_10575151 Ga0207667_105751511 338
257 3300025972 Ga0207668_10007464 Ga0207668_100074642 338
258 3300025972 Ga0207668_10010818 Ga0207668_100108181 338
259 3300025972 Ga0207668_10282310 Ga0207668_102823101 338
260 3300026023 Ga0207677_10125961 Ga0207677_101259612 338
261 3300026067 Ga0207678_10022793 Ga0207678_100227937 338
262 3300026075 Ga0207708_10037969 Ga0207708_100379692 338
263 3300026075 Ga0207708_10052588 Ga0207708_100525881 338
264 3300026075 Ga0207708_10220672 Ga0207708_102206722 338
265 3300026078 Ga0207702_10077359 Ga0207702_100773591 338
266 3300026089 Ga0207648_10044679 Ga0207648_100446792 338
267 3300026089 Ga0207648_10093497 Ga0207648_100934974 338
268 3300026095 Ga0207676_10415061 Ga0207676_104150611 338
269 3300026116 Ga0207674_10200689 Ga0207674_102006892 338
270 3300027671 Ga0209588_1000839 Ga0209588_10008391 338
271 3300027671 Ga0209588_1004780 Ga0209588_10047803 338
272 3300027671 Ga0209588_1010574 Ga0209588_10105743 338
273 3300027671 Ga0209588_1014661 Ga0209588_10146613 338
274 3300027671 Ga0209588_1025016 Ga0209588_10250162 338
275 3300027671 Ga0209588_1026754 Ga0209588_10267542 338
276 3300027671 Ga0209588_1047209 Ga0209588_10472092 338
277 3300027671 Ga0209588_1054491 Ga0209588_10544911 338
278 3300027671 Ga0209588_1054925 Ga0209588_10549251 338
279 3300027907 Ga0207428_10014418 Ga0207428_100144186 338
280 3300027907 Ga0207428_10177116 Ga0207428_101771163 338
281 3300027907 Ga0207428_10298225 Ga0207428_102982251 338
282 3300028379 Ga0268266_10068382 Ga0268266_100683823 338
283 3300028379 Ga0268266_10073315 Ga0268266_100733152 338
284 3300028379 Ga0268266_10285020 Ga0268266_102850201 338
285 3300028380 Ga0268265_10142550 Ga0268265_101425501 338
286 3300028794 Ga0307515_10208768 Ga0307515_102087682 338
287 3300031344 Ga0265316_10076463 Ga0265316_100764631 338
288 3300031456 Ga0307513_10395825 Ga0307513_103958251 338
289 3300031507 Ga0307509_10342757 Ga0307509_103427572 338
290 3300034819 Ga0373958_0020619 Ga0373958_0020619_34_1050 338
291 3300035083 Ga0373926_0038432 Ga0373926_0038432_85_1101 338
292 3300035083 Ga0373926_0093330 Ga0373926_0093330_66_1082 338
293 3300035086 Ga0373934_0063382 Ga0373934_0063382_104_1120 338
294 3300035089 Ga0373944_0072751 Ga0373944_0072751_88_1104 338
295 3300035111 Ga0373923_0045529 Ga0373923_0045529_775_1791 338
296 3300035112 Ga0373932_0024998 Ga0373932_0024998_173_1189 338
297 3300035113 Ga0373936_0031374 Ga0373936_0031374_940_1956 338
298 3300035116 Ga0373945_0093841 Ga0373945_0093841_86_1102 338
299 3300035117 Ga0373953_0073813 Ga0373953_0073813_318_1337 338
300 3300035117 Ga0373953_0077776 Ga0373953_0077776_40_1056 338
301 3300035120 Ga0373957_0061810 Ga0373957_0061810_384_1403 338
302 3300035121 Ga0373960_0038520 Ga0373960_0038520_145_1161 338
303 3300035170 Ga0373943_0059039 Ga0373943_0059039_750_1766 338
304 3300035170 Ga0373943_0127320 Ga0373943_0127320_66_1082 338
305 3300035170 Ga0373943_0138870 Ga0373943_0138870_66_1082 338
306 3300035171 Ga0373946_0049256 Ga0373946_0049256_196_1212 338
307 3300035171 Ga0373946_0112970 Ga0373946_0112970_74_1090 338
308 3300035171 Ga0373946_0128549 Ga0373946_0128549_20_1039 338
309 3300035171 Ga0373946_0136927 Ga0373946_0136927_33_1049 338
310 3300035172 Ga0373955_0160540 Ga0373955_0160540_258_1274 338
311 3300035398 Ga0316574_0253779 Ga0316574_0253779_13_1029 338
312 3300035410 Ga0373924_0096536 Ga0373924_0096536_76_1092 338
313 3300035692 Ga0373935_0041759 Ga0373935_0041759_1786_2802 338
314 3300035692 Ga0373935_0268894 Ga0373935_0268894_157_1173 338
315 3300035692 Ga0373935_0273967 Ga0373935_0273967_22_1038 338
316 3300035695 Ga0373927_0081952 Ga0373927_0081952_1015_2031 338
317 3300035695 Ga0373927_0116219 Ga0373927_0116219_28_1044 338
318 3300035695 Ga0373927_0201967 Ga0373927_0201967_116_1132 338
319 3300035695 Ga0373927_0240176 Ga0373927_0240176_135_1151 338
320 3300035695 Ga0373927_0254047 Ga0373927_0254047_56_1072 338
321 3300035725 Ga0373947_0077007 Ga0373947_0077007_645_1661 338
322 3300035725 Ga0373947_0156182 Ga0373947_0156182_418_1434 338
323 3300035725 Ga0373947_0180126 Ga0373947_0180126_22_1038 338
324 3300036401 Ga0373937_0309312 Ga0373937_0309312_14_1030 338
325 3300036712 Ga0316584_0176137 Ga0316584_0176137_104_1120 338
326 3300036712 Ga0316584_0259499 Ga0316584_0259499_177_1193 338
327 3300037068 Ga0373925_0267129 Ga0373925_0267129_100_1116 338
328 3300037068 Ga0373925_0311534 Ga0373925_0311534_79_1095 338
329 3300037068 Ga0373925_0344861 Ga0373925_0344861_66_1082 338
330 3300037068 Ga0373925_0361165 Ga0373925_0361165_96_1112 338
331 3300037418 Ga0395900_0484981 Ga0395900_0484981_69_1085 338
332 3300037466 Ga0395898_0163199 Ga0395898_0163199_318_1334 338
333 3300037466 Ga0395898_0347721 Ga0395898_0347721_290_1306 338
334 3300037471 Ga0395905_0026897 Ga0395905_0026897_2164_3180 338
335 3300038443 Ga0395901_0361853 Ga0395901_0361853_226_1242 338
336 3300039450 Ga0436363_0485272 Ga0436363_0485272_541_1557 338
337 3300046452 Ga0495617_074576 Ga0495617_074576_73_1089 338
338 3300046453 Ga0495627_060597 Ga0495627_060597_83_1099 338
339 3300046454 Ga0495592_0187825 Ga0495592_0187825_72_1088 338
340 3300046454 Ga0495592_0238893 Ga0495592_0238893_99_1118 338
341 3300046455 Ga0495603_0119159 Ga0495603_0119159_478_1494 338
342 3300046455 Ga0495603_0133432 Ga0495603_0133432_156_1175 338
343 3300046455 Ga0495603_0141862 Ga0495603_0141862_96_1112 338
344 3300046455 Ga0495603_0160673 Ga0495603_0160673_94_1110 338
345 3300046458 Ga0495591_036672 Ga0495591_036672_345_1361 338
346 3300046459 Ga0495629_0004237 Ga0495629_0004237_4490_5584 338
347 3300046459 Ga0495629_0073142 Ga0495629_0073142_16_1032 338
348 3300046459 Ga0495629_0082590 Ga0495629_0082590_725_1741 338
349 3300046459 Ga0495629_0146164 Ga0495629_0146164_421_1437 338
350 3300046459 Ga0495629_0157377 Ga0495629_0157377_447_1463 338
351 3300046459 Ga0495629_0249513 Ga0495629_0249513_111_1127 338
352 3300046460 Ga0495638_0014421 Ga0495638_0014421_1224_2369 338
353 3300046460 Ga0495638_0161045 Ga0495638_0161045_182_1198 338
354 3300046460 Ga0495638_0190636 Ga0495638_0190636_63_1079 338
355 3300046461 Ga0495641_0058864 Ga0495641_0058864_267_1283 338
356 3300046461 Ga0495641_0090077 Ga0495641_0090077_232_1248 338
357 3300046462 Ga0495651_0078359 Ga0495651_0078359_641_1657 338
358 3300046462 Ga0495651_0162172 Ga0495651_0162172_361_1377 338
359 3300046463 Ga0495653_0156423 Ga0495653_0156423_90_1106 338
360 3300046463 Ga0495653_0242487 Ga0495653_0242487_167_1183 338
361 3300046472 Ga0495580_0025348 Ga0495580_0025348_16_1032 338
362 3300046472 Ga0495580_0165213 Ga0495580_0165213_435_1451 338
363 3300046472 Ga0495580_0202690 Ga0495580_0202690_325_1341 338
364 3300046473 Ga0495582_0058808 Ga0495582_0058808_631_1647 338
365 3300046473 Ga0495582_0135421 Ga0495582_0135421_319_1335 338
366 3300046474 Ga0495605_0112683 Ga0495605_0112683_105_1121 338
367 3300046475 Ga0495639_0008895 Ga0495639_0008895_158_1174 338
368 3300046475 Ga0495639_0070974 Ga0495639_0070974_74_1090 338
369 3300046475 Ga0495639_0106957 Ga0495639_0106957_91_1110 338
370 3300046475 Ga0495639_0117288 Ga0495639_0117288_217_1233 338
371 3300046476 Ga0495662_0082679 Ga0495662_0082679_523_1539 338
372 3300046476 Ga0495662_0101186 Ga0495662_0101186_75_1091 338
373 3300046476 Ga0495662_0121454 Ga0495662_0121454_242_1258 338
374 3300046477 Ga0495664_0021043 Ga0495664_0021043_2627_3643 338
375 3300046491 Ga0495584_0152244 Ga0495584_0152244_28_1044 338
376 3300046491 Ga0495584_0176940 Ga0495584_0176940_43_1059 338
377 3300046492 Ga0495585_0027336 Ga0495585_0027336_1027_2043 338
378 3300046492 Ga0495585_0173635 Ga0495585_0173635_84_1100 338
379 3300046492 Ga0495585_0174464 Ga0495585_0174464_23_1039 338
380 3300046499 Ga0495594_0013372 Ga0495594_0013372_111_1127 338
381 3300046499 Ga0495594_0082948 Ga0495594_0082948_712_1728 338
382 3300046500 Ga0495596_0086701 Ga0495596_0086701_22_1038 338
383 3300046500 Ga0495596_0097783 Ga0495596_0097783_60_1076 338
384 3300046501 Ga0495607_0015350 Ga0495607_0015350_85_1101 338
385 3300046501 Ga0495607_0122586 Ga0495607_0122586_325_1341 338
386 3300046501 Ga0495607_0134176 Ga0495607_0134176_100_1116 338
387 3300046506 Ga0495583_0103653 Ga0495583_0103653_68_1084 338
388 3300046506 Ga0495583_0123580 Ga0495583_0123580_41_1057 338
389 3300046511 Ga0495608_0091155 Ga0495608_0091155_339_1355 338
390 3300046511 Ga0495608_0186368 Ga0495608_0186368_74_1090 338
391 3300046511 Ga0495608_0213139 Ga0495608_0213139_73_1089 338
392 3300046513 Ga0495616_0088193 Ga0495616_0088193_385_1458 338
393 3300046513 Ga0495616_0127267 Ga0495616_0127267_66_1082 338
394 3300046514 Ga0495618_0024958 Ga0495618_0024958_2231_3247 338
395 3300046514 Ga0495618_0087827 Ga0495618_0087827_793_1809 338
396 3300046514 Ga0495618_0211521 Ga0495618_0211521_66_1082 338
397 3300046516 Ga0495628_0054182 Ga0495628_0054182_1138_2154 338
398 3300046516 Ga0495628_0290194 Ga0495628_0290194_164_1180 338
399 3300046517 Ga0495630_0041005 Ga0495630_0041005_2116_3132 338
400 3300046517 Ga0495630_0057984 Ga0495630_0057984_564_1658 338
401 3300046517 Ga0495630_0216053 Ga0495630_0216053_113_1129 338
402 3300046517 Ga0495630_0216905 Ga0495630_0216905_322_1338 338
403 3300046518 Ga0495631_0084058 Ga0495631_0084058_139_1155 338
404 3300046518 Ga0495631_0108513 Ga0495631_0108513_147_1163 338
405 3300046519 Ga0495632_0083287 Ga0495632_0083287_50_1066 338
406 3300046520 Ga0495637_0069275 Ga0495637_0069275_353_1369 338
407 3300046523 Ga0495644_0043801 Ga0495644_0043801_78_1094 338
408 3300046524 Ga0495648_0004418 Ga0495648_0004418_4690_5706 338
409 3300046525 Ga0495663_0036090 Ga0495663_0036090_230_1246 338
410 3300046526 Ga0495666_0082341 Ga0495666_0082341_402_1418 338
411 3300046526 Ga0495666_0097733 Ga0495666_0097733_116_1132 338
412 3300046526 Ga0495666_0106305 Ga0495666_0106305_197_1216 338
413 3300046526 Ga0495666_0149659 Ga0495666_0149659_27_1043 338
414 3300046528 Ga0495642_0064983 Ga0495642_0064983_110_1126 338
415 3300046529 Ga0495652_0035625 Ga0495652_0035625_2564_3580 338
416 3300046529 Ga0495652_0133199 Ga0495652_0133199_310_1326 338
417 3300046529 Ga0495652_0188648 Ga0495652_0188648_327_1343 338
418 3300046531 Ga0495665_0047525 Ga0495665_0047525_802_1818 338
419 3300046531 Ga0495665_0122018 Ga0495665_0122018_281_1297 338
420 3300046531 Ga0495665_0144613 Ga0495665_0144613_99_1115 338
421 3300046531 Ga0495665_0175787 Ga0495665_0175787_60_1079 338
422 3300046533 Ga0495640_0008012 Ga0495640_0008012_3175_4191 338
423 3300046533 Ga0495640_0008012 Ga0495640_0008012_6645_7661 338
424 3300046533 Ga0495640_0021997 Ga0495640_0021997_2996_4012 338
425 3300046533 Ga0495640_0058231 Ga0495640_0058231_1529_2545 338
426 3300046533 Ga0495640_0190358 Ga0495640_0190358_191_1207 338
427 3300046536 Ga0495587_0210579 Ga0495587_0210579_60_1076 338
428 3300046537 Ga0495598_0060587 Ga0495598_0060587_25_1041 338
429 3300046537 Ga0495598_0065922 Ga0495598_0065922_69_1085 338
430 3300046538 Ga0495609_0117205 Ga0495609_0117205_19_1035 338
431 3300046539 Ga0495621_0004372 Ga0495621_0004372_143_1159 338
432 3300046539 Ga0495621_0075840 Ga0495621_0075840_179_1195 338
433 3300046543 Ga0495645_0050635 Ga0495645_0050635_1536_2552 338
434 3300046543 Ga0495645_0061730 Ga0495645_0061730_1589_2605 338
435 3300046543 Ga0495645_0074561 Ga0495645_0074561_766_1782 338
436 3300046543 Ga0495645_0135985 Ga0495645_0135985_266_1282 338
437 3300046557 Ga0495622_0120882 Ga0495622_0120882_136_1152 338
438 3300046557 Ga0495622_0130942 Ga0495622_0130942_73_1089 338
439 3300046558 Ga0495633_0025442 Ga0495633_0025442_870_1886 338
440 3300046558 Ga0495633_0141424 Ga0495633_0141424_64_1080 338
441 3300046559 Ga0495667_0041057 Ga0495667_0041057_781_1797 338
442 3300046559 Ga0495667_0220199 Ga0495667_0220199_151_1167 338
443 3300046559 Ga0495667_0231282 Ga0495667_0231282_77_1093 338
444 3300046615 Ga0495656_0057716 Ga0495656_0057716_65_1081 338
445 3300046615 Ga0495656_0148078 Ga0495656_0148078_47_1063 338
446 3300046616 Ga0495668_0117054 Ga0495668_0117054_321_1337 338
447 3300046616 Ga0495668_0166725 Ga0495668_0166725_71_1132 338
448 3300046642 Ga0495634_0025225 Ga0495634_0025225_2523_3539 338
449 3300046642 Ga0495634_0078630 Ga0495634_0078630_899_1915 338
450 3300046642 Ga0495634_0141277 Ga0495634_0141277_451_1467 338
451 3300046642 Ga0495634_0158960 Ga0495634_0158960_79_1095 338
452 3300046642 Ga0495634_0232867 Ga0495634_0232867_34_1050 338
453 3300046648 Ga0495611_0013870 Ga0495611_0013870_1525_2670 338
454 3300046648 Ga0495611_0062750 Ga0495611_0062750_601_1617 338
455 3300046648 Ga0495611_0089965 Ga0495611_0089965_258_1274 338
456 3300046648 Ga0495611_0130403 Ga0495611_0130403_83_1099 338
457 3300046660 Ga0495625_0065503 Ga0495625_0065503_240_1256 338
458 3300046660 Ga0495625_0139363 Ga0495625_0139363_566_1582 338
459 3300046663 Ga0495635_0011879 Ga0495635_0011879_2820_3836 338
460 3300046663 Ga0495635_0078839 Ga0495635_0078839_57_1073 338
461 3300046663 Ga0495635_0221023 Ga0495635_0221023_125_1141 338
462 3300046663 Ga0495635_0272330 Ga0495635_0272330_85_1101 338
463 3300046664 Ga0495659_0019386 Ga0495659_0019386_105_1121 338
464 3300046664 Ga0495659_0086026 Ga0495659_0086026_139_1155 338
465 3300046664 Ga0495659_0098246 Ga0495659_0098246_35_1051 338
466 3300046665 Ga0495661_0151047 Ga0495661_0151047_63_1079 338
467 3300046665 Ga0495661_0166490 Ga0495661_0166490_111_1127 338
468 3300046674 Ga0495588_0086187 Ga0495588_0086187_614_1630 338
469 3300046674 Ga0495588_0159078 Ga0495588_0159078_57_1076 338
470 3300046674 Ga0495588_0186985 Ga0495588_0186985_52_1068 338
471 3300046678 Ga0495599_0024320 Ga0495599_0024320_2470_3486 338
472 3300046678 Ga0495599_0159112 Ga0495599_0159112_272_1288 338
473 3300046678 Ga0495599_0252334 Ga0495599_0252334_25_1041 338
474 3300046679 Ga0495623_0005531 Ga0495623_0005531_6989_8005 338
475 3300046679 Ga0495623_0031085 Ga0495623_0031085_2356_3372 338
476 3300046680 Ga0495646_0032769 Ga0495646_0032769_114_1130 338
477 3300046680 Ga0495646_0041132 Ga0495646_0041132_1031_2047 338
478 3300046680 Ga0495646_0148516 Ga0495646_0148516_264_1280 338
479 3300046680 Ga0495646_0166899 Ga0495646_0166899_175_1194 338
480 3300046681 Ga0495647_0013274 Ga0495647_0013274_668_1684 338
481 3300046681 Ga0495647_0113117 Ga0495647_0113117_90_1106 338
482 3300046683 Ga0495658_0085258 Ga0495658_0085258_32_1048 338
483 3300046683 Ga0495658_0100444 Ga0495658_0100444_422_1438 338
484 3300046683 Ga0495658_0210574 Ga0495658_0210574_21_1037 338
485 3300046683 Ga0495658_0227487 Ga0495658_0227487_71_1087 338
486 3300046684 Ga0495669_0064956 Ga0495669_0064956_107_1123 338
487 3300046689 Ga0495613_0196079 Ga0495613_0196079_385_1401 338
488 3300046689 Ga0495613_0239980 Ga0495613_0239980_70_1086 338
489 3300046689 Ga0495613_0248263 Ga0495613_0248263_55_1074 338
490 3300046690 Ga0495624_0016238 Ga0495624_0016238_2472_3488 338
491 3300046690 Ga0495624_0114269 Ga0495624_0114269_107_1123 338
492 3300046691 Ga0495670_0012957 Ga0495670_0012957_106_1122 338
493 3300046691 Ga0495670_0031741 Ga0495670_0031741_1575_2591 338
494 3300046691 Ga0495670_0040461 Ga0495670_0040461_55_1071 338
495 3300046692 Ga0495671_0138235 Ga0495671_0138235_38_1054 338
496 3300046694 Ga0495649_0139111 Ga0495649_0139111_41_1057 338
497 3300046694 Ga0495649_0184436 Ga0495649_0184436_26_1042 338
498 3300046794 Ga0495589_0037538 Ga0495589_0037538_1043_2059 338
499 3300046794 Ga0495589_0123250 Ga0495589_0123250_81_1097 338
500 3300046809 Ga0495600_0009456 Ga0495600_0009456_4989_6005 338
501 3300046809 Ga0495600_0011988 Ga0495600_0011988_3876_4892 338
502 3300046809 Ga0495600_0145110 Ga0495600_0145110_54_1070 338
503 3300047315 Ga0495581_0120638 Ga0495581_0120638_470_1486 338
504 3300047315 Ga0495581_0177679 Ga0495581_0177679_52_1068 338
505 3300047315 Ga0495581_0216899 Ga0495581_0216899_30_1046 338
506 3300047317 Ga0495604_0258833 Ga0495604_0258833_83_1102 338
507 3300047318 Ga0495636_0053005 Ga0495636_0053005_397_1413 338
508 3300047318 Ga0495636_0117256 Ga0495636_0117256_136_1152 338
509 3300047319 Ga0495674_0020337 Ga0495674_0020337_865_1881 338
510 3300047319 Ga0495674_0129008 Ga0495674_0129008_1071_2087 338
511 3300047319 Ga0495674_0178856 Ga0495674_0178856_343_1359 338
512 3300047319 Ga0495674_0402632 Ga0495674_0402632_66_1082 338
513 3300047320 Ga0495672_0011148 Ga0495672_0011148_4651_5667 338
514 3300047320 Ga0495672_0075654 Ga0495672_0075654_677_1822 338
515 3300047321 Ga0495676_0012818 Ga0495676_0012818_57_1073 338
516 3300047321 Ga0495676_0184616 Ga0495676_0184616_266_1282 338
517 3300047321 Ga0495676_0244657 Ga0495676_0244657_31_1047 338
518 3300047321 Ga0495676_0263212 Ga0495676_0263212_35_1051 338
519 3300047321 Ga0495676_0266566 Ga0495676_0266566_22_1038 338
520 3300047322 Ga0495680_0076721 Ga0495680_0076721_202_1218 338
521 3300047322 Ga0495680_0227980 Ga0495680_0227980_30_1046 338
522 3300047323 Ga0495683_0109824 Ga0495683_0109824_284_1300 338
523 3300047444 Ga0495675_0213751 Ga0495675_0213751_76_1092 338
524 3300047445 Ga0495677_0093115 Ga0495677_0093115_46_1062 338
525 3300047446 Ga0495679_030355 Ga0495679_030355_377_1393 338
526 3300047446 Ga0495679_040438 Ga0495679_040438_405_1421 338
527 3300047447 Ga0495685_050698 Ga0495685_050698_160_1176 338
528 3300047469 Ga0495673_0057275 Ga0495673_0057275_344_1360 338
529 3300047470 Ga0495681_0085708 Ga0495681_0085708_312_1328 338
530 3300047471 Ga0495684_0011170 Ga0495684_0011170_2279_3295 338
531 3300047471 Ga0495684_0011170 Ga0495684_0011170_5749_6765 338
532 3300047471 Ga0495684_0024291 Ga0495684_0024291_3370_4386 338
533 3300047471 Ga0495684_0226812 Ga0495684_0226812_62_1078 338
534 3300047472 Ga0495686_0110207 Ga0495686_0110207_435_1451 338
535 3300047673 Ga0495593_0017246 Ga0495593_0017246_2150_3166 338
536 3300047673 Ga0495593_0159859 Ga0495593_0159859_94_1110 338
537 3300047673 Ga0495593_0160358 Ga0495593_0160358_76_1092 338
538 3300048088 Ga0495602_0067537 Ga0495602_0067537_1774_2790 338
539 3300048090 Ga0495615_0032145 Ga0495615_0032145_112_1128 338
540 3300048904 Ga0496101_0276821 Ga0496101_0276821_262_1278 338
541 3300048905 Ga0496102_0473808 Ga0496102_0473808_28_1044 338
542 3300048907 Ga0496104_0326366 Ga0496104_0326366_338_1354 338
543 3300048907 Ga0496104_0368405 Ga0496104_0368405_315_1331 338
544 3300048908 Ga0496105_0290349 Ga0496105_0290349_79_1095 338
545 3300048909 Ga0496106_0356153 Ga0496106_0356153_56_1072 338
546 3300048910 Ga0496107_0259124 Ga0496107_0259124_72_1088 338
547 3300048912 Ga0496109_0233534 Ga0496109_0233534_44_1060 338
548 3300048912 Ga0496109_0481646 Ga0496109_0481646_86_1102 338
549 3300048915 Ga0496112_0458281 Ga0496112_0458281_167_1183 338
550 3300048916 Ga0496113_0322447 Ga0496113_0322447_128_1144 338
551 3300048918 Ga0496115_0351258 Ga0496115_0351258_43_1059 338
552 3300048924 Ga0496121_0209843 Ga0496121_0209843_216_1232 338
553 3300048929 Ga0496126_0017981 Ga0496126_0017981_3149_4165 338
554 3300048929 Ga0496126_0018102 Ga0496126_0018102_1074_2090 338
555 3300049460 Ga0495682_0017855 Ga0495682_0017855_654_1799 338
556 3300050494 nmdc:mga06z11_89660_c1 nmdc:mga06z11_89660_c1_123_1139 338
557 3300050507 nmdc:mga05p37_112454_c1 nmdc:mga05p37_112454_c1_116_1132 338
558 3300050507 nmdc:mga05p37_123381_c1 nmdc:mga05p37_123381_c1_155_1171 338
559 3300050507 nmdc:mga05p37_14284_c1 nmdc:mga05p37_14284_c1_1473_2489 338
560 3300050507 nmdc:mga05p37_146065_c1 nmdc:mga05p37_146065_c1_1828_2847 338
561 3300050507 nmdc:mga05p37_17548_c1 nmdc:mga05p37_17548_c1_6711_7727 338
562 3300050507 nmdc:mga05p37_437098_c1 nmdc:mga05p37_437098_c1_163_1179 338
563 3300050507 nmdc:mga05p37_49656_c1 nmdc:mga05p37_49656_c1_3988_5004 338
564 3300050507 nmdc:mga05p37_595796_c1 nmdc:mga05p37_595796_c1_144_1160 338
565 3300050507 nmdc:mga05p37_728489_c1 nmdc:mga05p37_728489_c1_33_1049 338
566 3300050508 nmdc:mga09592_208552_c1 nmdc:mga09592_208552_c1_404_1420 338
567 3300050508 nmdc:mga09592_36353_c1 nmdc:mga09592_36353_c1_127_1143 338
568 3300050509 nmdc:mga0qj67_360557_c1 nmdc:mga0qj67_360557_c1_136_1152 338
569 3300050509 nmdc:mga0qj67_8436_c1 nmdc:mga0qj67_8436_c1_981_1997 338
570 3300050510 nmdc:mga06r32_185010_c1 nmdc:mga06r32_185010_c1_872_1888 338
571 3300050510 nmdc:mga06r32_446199_c1 nmdc:mga06r32_446199_c1_17_1033 338
572 3300050510 nmdc:mga06r32_470308_c1 nmdc:mga06r32_470308_c1_144_1160 338
573 3300050510 nmdc:mga06r32_84544_c1 nmdc:mga06r32_84544_c1_35_1051 338
574 3300050511 nmdc:mga08y16_203101_c1 nmdc:mga08y16_203101_c1_797_1813 338
575 3300050511 nmdc:mga08y16_3173_c1 nmdc:mga08y16_3173_c1_15984_17000 338
576 3300050511 nmdc:mga08y16_35747_c1 nmdc:mga08y16_35747_c1_3323_4339 338
577 3300050511 nmdc:mga08y16_384793_c1 nmdc:mga08y16_384793_c1_307_1323 338
578 3300050511 nmdc:mga08y16_48876_c1 nmdc:mga08y16_48876_c1_3052_4068 338
579 3300050512 nmdc:mga0n895_212286_c1 nmdc:mga0n895_212286_c1_143_1159 338
580 3300050512 nmdc:mga0n895_244118_c1 nmdc:mga0n895_244118_c1_80_1096 338
581 3300050512 nmdc:mga0n895_43428_c1 nmdc:mga0n895_43428_c1_169_1185 338
582 3300050512 nmdc:mga0n895_45830_c1 nmdc:mga0n895_45830_c1_72_1088 338
583 3300050512 nmdc:mga0n895_472588_c1 nmdc:mga0n895_472588_c1_73_1089 338
584 3300050513 nmdc:mga0rr50_21931_c1 nmdc:mga0rr50_21931_c1_104_1120 338
585 3300050513 nmdc:mga0rr50_268197_c1 nmdc:mga0rr50_268197_c1_347_1363 338
586 3300050513 nmdc:mga0rr50_385129_c1 nmdc:mga0rr50_385129_c1_116_1132 338
587 3300050515 nmdc:mga0a205_217821_c1 nmdc:mga0a205_217821_c1_672_1688 338
588 3300050515 nmdc:mga0a205_232891_c1 nmdc:mga0a205_232891_c1_45_1061 338
589 3300050515 nmdc:mga0a205_386752_c1 nmdc:mga0a205_386752_c1_130_1149 338
590 3300053077 Ga0495601_0023857 Ga0495601_0023857_2247_3263 338
591 3300053077 Ga0495601_0041306 Ga0495601_0041306_20_1036 338
592 3300053077 Ga0495601_0077238 Ga0495601_0077238_17_1033 338
593 3300053077 Ga0495601_0158363 Ga0495601_0158363_51_1067 338
594 3300053077 Ga0495601_0210708 Ga0495601_0210708_220_1236 338
595 3300053078 Ga0495612_0002936 Ga0495612_0002936_2550_3566 338
596 3300053078 Ga0495612_0046030 Ga0495612_0046030_273_1289 338
597 3300053083 Ga0495655_0011717 Ga0495655_0011717_207_1223 338
598 3300053083 Ga0495655_0030035 Ga0495655_0030035_271_1287 338
599 3300053083 Ga0495655_0033692 Ga0495655_0033692_98_1114 338
600 3300053084 Ga0495595_0102350 Ga0495595_0102350_75_1091 338
601 3300053084 Ga0495595_0108675 Ga0495595_0108675_257_1273 338
602 3300053084 Ga0495595_0140993 Ga0495595_0140993_78_1094 338
603 3300053085 Ga0495619_0001546 Ga0495619_0001546_3807_4823 338
604 3300053085 Ga0495619_0028063 Ga0495619_0028063_2413_3429 338
605 3300053085 Ga0495619_0028657 Ga0495619_0028657_2482_3498 338
606 3300053085 Ga0495619_0035955 Ga0495619_0035955_87_1103 338
607 3300053093 Ga0500651_0000666 Ga0500651_0000666_4126_5271 338
608 3300053134 Ga0500658_0000628 Ga0500658_0000628_5630_6775 338
609 3300053139 Ga0500568_0003547 Ga0500568_0003547_482_1498 338
610 3300053142 Ga0500577_0040697 Ga0500577_0040697_62_1207 338
611 3300053158 Ga0500627_0003802 Ga0500627_0003802_2198_3343 338
612 3300053161 Ga0500634_0013459 Ga0500634_0013459_701_1846 338
613 3300053728 Ga0500657_104062 Ga0500657_104062_25_1041 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13683

rve_3

Integrase core domain

232

280

0.83

Feature Viewer

pLDDT pTM Quality
49.84 0.44 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map