F469241
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 613 | 299 | 587 | 337 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10027562|Ga0070717_100275624 |
| Length | 358 |
| Sequence | MIGLLCFVLAVLASPFKSTLRLEAENAVLRHQLNVLRRRPHGRVRLTNNHRWFFIQLYRWFPSILQVLTIIGPETLVRWHRAGFRSYWRWKSRPQGGRPQIHTELRALIRRMSVENKLGFEVAQSSVAKYMVKRRGPPSQGWRTFLRNHAPDIAAMDLFVVPTIGFDLLYAFVIVRLDRRDLVWINVTTNPTAEWIARQITQAFPWDDAPKYLIRDRDQIYGAVVTRRLRAMGIRDKPTAPASPWQNGFAERLIGSIRRECVDHIIVLGEAHLRRILKFLCQILQPCQNASIPEQGCAGFSPGSANRCDQVTRHPGRTSSPLRPCLSFRYTQLSVVEMDVKLTQKSPASPPGLFFLEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 2 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 3 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 4 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 5 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 6 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 7 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 8 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 9 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 10 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 11 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 12 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 13 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 14 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 15 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 16 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 17 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 70 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 136 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 137 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 138 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 139 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 140 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 141 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 142 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 143 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 144 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 145 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 148 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 149 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 150 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 151 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 152 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 153 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 154 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 155 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 156 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 158 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 159 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 160 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 162 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 163 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 172 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 173 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 174 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 272 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 273 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 274 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 276 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 290 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 291 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 292 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 293 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 294 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 295 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 296 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 297 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 298 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 299 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.08 |
| Metatranscriptomes | 0 |
| Isolates | 3.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.96 |
| Nodule | 3.75 |
| Rhizoplane | 1.96 |
| Rhizosphere | 90.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1003295 | 3300000532 | Bacteria | 1078 |
| 2 | CNXas_1003844 | 3300000545 | Bacteria | 1061 |
| 3 | Ga0065707_10178941 | 3300005295 | Bacteria | 1431 |
| 4 | Ga0070658_10470099 | 3300005327 | Bacteria | 1084 |
| 5 | Ga0070677_10065383 | 3300005333 | Unclassified | 1513 |
| 6 | Ga0070680_100055293 | 3300005336 | Bacteria | 3243 |
| 7 | Ga0070682_100095274 | 3300005337 | Bacteria | 1954 |
| 8 | Ga0070682_100285419 | 3300005337 | Bacteria | 1205 |
| 9 | Ga0070689_100026697 | 3300005340 | Bacteria | 4350 |
| 10 | Ga0070689_100184195 | 3300005340 | Bacteria | 1697 |
| 11 | Ga0070669_100128804 | 3300005353 | Bacteria | 1939 |
| 12 | Ga0070669_100155005 | 3300005353 | Bacteria | 1776 |
| 13 | Ga0070675_100041168 | 3300005354 | Bacteria | 3774 |
| 14 | Ga0070671_100459590 | 3300005355 | Bacteria | 1093 |
| 15 | Ga0070674_100006914 | 3300005356 | Bacteria | 6650 |
| 16 | Ga0070673_100238003 | 3300005364 | Bacteria | 1582 |
| 17 | Ga0070709_10175854 | 3300005434 | Bacteria | 1500 |
| 18 | Ga0070714_100395389 | 3300005435 | Bacteria | 1305 |
| 19 | Ga0070701_10161942 | 3300005438 | Bacteria | 1297 |
| 20 | Ga0070711_100152925 | 3300005439 | Bacteria | 1742 |
| 21 | Ga0070711_100247924 | 3300005439 | Bacteria | 1395 |
| 22 | Ga0070700_100276538 | 3300005441 | Unclassified | 1216 |
| 23 | Ga0070678_100027690 | 3300005456 | Bacteria | 3852 |
| 24 | Ga0070678_100092318 | 3300005456 | Bacteria | 2325 |
| 25 | Ga0070662_100212641 | 3300005457 | Bacteria | 1539 |
| 26 | Ga0070662_100238911 | 3300005457 | Bacteria | 1456 |
| 27 | Ga0070685_10081192 | 3300005466 | Unclassified | 1944 |
| 28 | Ga0070698_100019478 | 3300005471 | Bacteria | 7123 |
| 29 | Ga0070698_100033791 | 3300005471 | Bacteria | 5297 |
| 30 | Ga0070698_100073930 | 3300005471 | Bacteria | 3414 |
| 31 | Ga0070698_100074283 | 3300005471 | Bacteria | 3405 |
| 32 | Ga0070699_100144157 | 3300005518 | Bacteria | 2104 |
| 33 | Ga0070679_100310157 | 3300005530 | Bacteria | 1528 |
| 34 | Ga0070684_100033476 | 3300005535 | Bacteria | 4388 |
| 35 | Ga0070697_100092007 | 3300005536 | Bacteria | 2508 |
| 36 | Ga0070697_100194021 | 3300005536 | Bacteria | 1724 |
| 37 | Ga0070697_100291569 | 3300005536 | Bacteria | 1401 |
| 38 | Ga0070697_100382304 | 3300005536 | Bacteria | 1219 |
| 39 | Ga0070672_100053965 | 3300005543 | Bacteria | 3144 |
| 40 | Ga0070686_100040398 | 3300005544 | Bacteria | 2910 |
| 41 | Ga0070665_100158593 | 3300005548 | Bacteria | 2264 |
| 42 | Ga0070665_100294652 | 3300005548 | Bacteria | 1625 |
| 43 | Ga0068855_100456035 | 3300005563 | Bacteria | 1394 |
| 44 | Ga0068855_100512900 | 3300005563 | Bacteria | 1302 |
| 45 | Ga0068857_100355303 | 3300005577 | Bacteria | 1357 |
| 46 | Ga0068854_100105684 | 3300005578 | Bacteria | 2117 |
| 47 | Ga0068854_100323812 | 3300005578 | Bacteria | 1254 |
| 48 | Ga0068856_100286396 | 3300005614 | Bacteria | 1664 |
| 49 | Ga0070702_100202546 | 3300005615 | Bacteria | 1315 |
| 50 | Ga0068859_100116741 | 3300005617 | Bacteria | 2733 |
| 51 | Ga0068864_100297127 | 3300005618 | Unclassified | 1511 |
| 52 | Ga0068860_100413064 | 3300005843 | Bacteria | 1337 |
| 53 | Ga0068862_100303359 | 3300005844 | Bacteria | 1470 |
| 54 | Ga0081455_10014335 | 3300005937 | Bacteria | 7776 |
| 55 | Ga0081540_1033526 | 3300005983 | Bacteria | 2787 |
| 56 | Ga0081540_1040307 | 3300005983 | Bacteria | 2436 |
| 57 | Ga0081540_1041311 | 3300005983 | Bacteria | 2393 |
| 58 | Ga0081540_1082365 | 3300005983 | Bacteria | 1444 |
| 59 | Ga0070717_10027562 | 3300006028 | Bacteria | 4541 |
| 60 | Ga0070717_10224909 | 3300006028 | Bacteria | 1650 |
| 61 | Ga0070717_10404536 | 3300006028 | Bacteria | 1227 |
| 62 | Ga0070715_10123177 | 3300006163 | Bacteria | 1238 |
| 63 | Ga0070716_100274903 | 3300006173 | Bacteria | 1159 |
| 64 | Ga0070712_100058334 | 3300006175 | Bacteria | 2715 |
| 65 | Ga0070712_100100390 | 3300006175 | Bacteria | 2138 |
| 66 | Ga0070712_100177728 | 3300006175 | Bacteria | 1656 |
| 67 | Ga0075367_10120923 | 3300006178 | Bacteria | 1613 |
| 68 | Ga0075370_10027168 | 3300006353 | Bacteria | 3174 |
| 69 | Ga0075370_10062569 | 3300006353 | Bacteria | 2121 |
| 70 | Ga0075428_100633553 | 3300006844 | Bacteria | 1141 |
| 71 | Ga0075433_10355910 | 3300006852 | Bacteria | 1293 |
| 72 | Ga0075434_100039981 | 3300006871 | Bacteria | 4645 |
| 73 | Ga0075434_100159796 | 3300006871 | Bacteria | 2273 |
| 74 | Ga0075434_100483891 | 3300006871 | Bacteria | 1259 |
| 75 | Ga0075429_100270138 | 3300006880 | Bacteria | 1489 |
| 76 | Ga0068865_100364556 | 3300006881 | Unclassified | 1174 |
| 77 | Ga0097620_100116749 | 3300006931 | Bacteria | 2733 |
| 78 | Ga0075435_100195807 | 3300007076 | Bacteria | 1711 |
| 79 | Ga0075435_100356281 | 3300007076 | Bacteria | 1254 |
| 80 | Ga0075435_100382229 | 3300007076 | Bacteria | 1210 |
| 81 | Ga0075435_100442485 | 3300007076 | Bacteria | 1120 |
| 82 | Ga0099794_10011896 | 3300007265 | Bacteria | 3740 |
| 83 | Ga0099794_10013270 | 3300007265 | Bacteria | 3582 |
| 84 | Ga0099794_10038054 | 3300007265 | Bacteria | 2279 |
| 85 | Ga0099794_10058587 | 3300007265 | Bacteria | 1867 |
| 86 | Ga0099794_10072712 | 3300007265 | Unclassified | 1686 |
| 87 | Ga0099794_10080885 | 3300007265 | Unclassified | 1602 |
| 88 | Ga0099794_10092704 | 3300007265 | Bacteria | 1500 |
| 89 | Ga0099794_10095549 | 3300007265 | Bacteria | 1479 |
| 90 | Ga0099794_10136136 | 3300007265 | Bacteria | 1242 |
| 91 | Ga0099794_10174144 | 3300007265 | Bacteria | 1097 |
| 92 | Ga0099795_10104998 | 3300007788 | Bacteria | 1113 |
| 93 | Ga0111539_10121097 | 3300009094 | Bacteria | 3066 |
| 94 | Ga0111539_10173897 | 3300009094 | Bacteria | 2516 |
| 95 | Ga0111539_10186929 | 3300009094 | Unclassified | 2419 |
| 96 | Ga0105245_10073651 | 3300009098 | Bacteria | 3106 |
| 97 | Ga0105245_10195961 | 3300009098 | Bacteria | 1938 |
| 98 | Ga0114129_10344990 | 3300009147 | Bacteria | 1974 |
| 99 | Ga0114129_10602825 | 3300009147 | Bacteria | 1423 |
| 100 | Ga0114129_10634097 | 3300009147 | Bacteria | 1381 |
| 101 | Ga0114129_10658298 | 3300009147 | Bacteria | 1351 |
| 102 | Ga0105242_10055557 | 3300009176 | Bacteria | 3239 |
| 103 | Ga0105242_10264974 | 3300009176 | Unclassified | 1554 |
| 104 | Ga0105248_10336017 | 3300009177 | Bacteria | 1701 |
| 105 | Ga0105248_10396075 | 3300009177 | Unclassified | 1555 |
| 106 | Ga0105237_10094405 | 3300009545 | Bacteria | 2980 |
| 107 | Ga0099796_10038610 | 3300010159 | Bacteria | 1603 |
| 108 | Ga0099796_10051904 | 3300010159 | Bacteria | 1426 |
| 109 | Ga0105239_10048089 | 3300010375 | Bacteria | 4676 |
| 110 | Ga0105239_10729686 | 3300010375 | Bacteria | 1134 |
| 111 | Ga0105239_10762993 | 3300010375 | Bacteria | 1107 |
| 112 | Ga0105246_10178858 | 3300011119 | Bacteria | 1631 |
| 113 | Ga0157370_10467275 | 3300013104 | Bacteria | 1159 |
| 114 | Ga0157369_10100114 | 3300013105 | Bacteria | 3089 |
| 115 | Ga0157378_10024798 | 3300013297 | Bacteria | 5281 |
| 116 | Ga0157378_10158706 | 3300013297 | Bacteria | 2113 |
| 117 | Ga0163162_10215043 | 3300013306 | Bacteria | 2052 |
| 118 | Ga0163162_10261939 | 3300013306 | Bacteria | 1861 |
| 119 | Ga0163162_10585704 | 3300013306 | Bacteria | 1242 |
| 120 | Ga0157372_10113214 | 3300013307 | Bacteria | 3110 |
| 121 | Ga0157372_10528733 | 3300013307 | Bacteria | 1375 |
| 122 | Ga0157375_10344735 | 3300013308 | Bacteria | 1655 |
| 123 | Ga0157375_10707667 | 3300013308 | Bacteria | 1161 |
| 124 | Ga0163163_10396773 | 3300014325 | Bacteria | 1438 |
| 125 | Ga0157380_10061114 | 3300014326 | Bacteria | 3013 |
| 126 | Ga0163161_10085734 | 3300017792 | Bacteria | 2323 |
| 127 | Ga0207697_10070033 | 3300025315 | Bacteria | 1469 |
| 128 | Ga0207697_10097541 | 3300025315 | Bacteria | 1250 |
| 129 | Ga0207682_10027016 | 3300025893 | Bacteria | 2284 |
| 130 | Ga0207692_10021714 | 3300025898 | Bacteria | 2941 |
| 131 | Ga0207692_10196181 | 3300025898 | Bacteria | 1184 |
| 132 | Ga0207688_10080129 | 3300025901 | Bacteria | 1863 |
| 133 | Ga0207647_10143267 | 3300025904 | Bacteria | 1400 |
| 134 | Ga0207643_10084344 | 3300025908 | Unclassified | 1844 |
| 135 | Ga0207654_10290448 | 3300025911 | Bacteria | 1109 |
| 136 | Ga0207707_10017385 | 3300025912 | Bacteria | 6270 |
| 137 | Ga0207707_10035499 | 3300025912 | Bacteria | 4360 |
| 138 | Ga0207695_10272819 | 3300025913 | Bacteria | 1587 |
| 139 | Ga0207671_10074523 | 3300025914 | Bacteria | 2537 |
| 140 | Ga0207693_10177076 | 3300025915 | Bacteria | 1678 |
| 141 | Ga0207693_10218422 | 3300025915 | Bacteria | 1498 |
| 142 | Ga0207693_10244758 | 3300025915 | Bacteria | 1408 |
| 143 | Ga0207660_10171540 | 3300025917 | Bacteria | 1679 |
| 144 | Ga0207660_10236374 | 3300025917 | Bacteria | 1438 |
| 145 | Ga0207657_10224035 | 3300025919 | Bacteria | 1506 |
| 146 | Ga0207649_10341174 | 3300025920 | Bacteria | 1106 |
| 147 | Ga0207652_10182357 | 3300025921 | Bacteria | 1887 |
| 148 | Ga0207646_10314384 | 3300025922 | Bacteria | 1415 |
| 149 | Ga0207646_10530717 | 3300025922 | Bacteria | 1059 |
| 150 | Ga0207694_10063592 | 3300025924 | Bacteria | 2875 |
| 151 | Ga0207659_10070720 | 3300025926 | Unclassified | 2545 |
| 152 | Ga0207687_10179764 | 3300025927 | Bacteria | 1638 |
| 153 | Ga0207700_10244962 | 3300025928 | Bacteria | 1529 |
| 154 | Ga0207700_10268744 | 3300025928 | Bacteria | 1463 |
| 155 | Ga0207700_10288286 | 3300025928 | Bacteria | 1414 |
| 156 | Ga0207664_10387079 | 3300025929 | Bacteria | 1242 |
| 157 | Ga0207706_10014873 | 3300025933 | Bacteria | 7047 |
| 158 | Ga0207706_10175572 | 3300025933 | Bacteria | 1882 |
| 159 | Ga0207686_10173282 | 3300025934 | Bacteria | 1524 |
| 160 | Ga0207709_10005054 | 3300025935 | Bacteria | 7531 |
| 161 | Ga0207709_10007671 | 3300025935 | Bacteria | 5985 |
| 162 | Ga0207709_10020993 | 3300025935 | Bacteria | 3692 |
| 163 | Ga0207670_10243634 | 3300025936 | Bacteria | 1386 |
| 164 | Ga0207670_10291853 | 3300025936 | Bacteria | 1274 |
| 165 | Ga0207669_10002860 | 3300025937 | Bacteria | 7400 |
| 166 | Ga0207665_10037645 | 3300025939 | Bacteria | 3220 |
| 167 | Ga0207665_10261634 | 3300025939 | Bacteria | 1282 |
| 168 | Ga0207665_10352011 | 3300025939 | Bacteria | 1112 |
| 169 | Ga0207691_10149170 | 3300025940 | Bacteria | 2057 |
| 170 | Ga0207691_10208846 | 3300025940 | Bacteria | 1697 |
| 171 | Ga0207689_10208925 | 3300025942 | Bacteria | 1612 |
| 172 | Ga0207661_10007954 | 3300025944 | Bacteria | 7559 |
| 173 | Ga0207667_10575151 | 3300025949 | Bacteria | 1138 |
| 174 | Ga0207667_10580008 | 3300025949 | Bacteria | 1132 |
| 175 | Ga0207651_10380883 | 3300025960 | Unclassified | 1195 |
| 176 | Ga0207668_10007464 | 3300025972 | Bacteria | 6503 |
| 177 | Ga0207668_10010818 | 3300025972 | Bacteria | 5527 |
| 178 | Ga0207668_10282310 | 3300025972 | Bacteria | 1362 |
| 179 | Ga0207640_10353668 | 3300025981 | Bacteria | 1181 |
| 180 | Ga0207677_10125961 | 3300026023 | Bacteria | 1936 |
| 181 | Ga0207678_10022793 | 3300026067 | Bacteria | 5484 |
| 182 | Ga0207678_10196869 | 3300026067 | Bacteria | 1722 |
| 183 | Ga0207708_10037969 | 3300026075 | Bacteria | 3669 |
| 184 | Ga0207708_10052588 | 3300026075 | Bacteria | 3102 |
| 185 | Ga0207708_10142137 | 3300026075 | Bacteria | 1884 |
| 186 | Ga0207708_10220672 | 3300026075 | Bacteria | 1519 |
| 187 | Ga0207702_10077359 | 3300026078 | Bacteria | 2878 |
| 188 | Ga0207648_10044679 | 3300026089 | Bacteria | 3887 |
| 189 | Ga0207648_10093497 | 3300026089 | Bacteria | 2629 |
| 190 | Ga0207676_10415061 | 3300026095 | Bacteria | 1261 |
| 191 | Ga0207676_10429998 | 3300026095 | Unclassified | 1240 |
| 192 | Ga0207674_10093100 | 3300026116 | Bacteria | 3003 |
| 193 | Ga0207674_10200689 | 3300026116 | Bacteria | 1944 |
| 194 | Ga0207683_10049325 | 3300026121 | Bacteria | 3685 |
| 195 | Ga0209588_1000839 | 3300027671 | Bacteria | 7816 |
| 196 | Ga0209588_1004780 | 3300027671 | Bacteria | 3843 |
| 197 | Ga0209588_1010574 | 3300027671 | Bacteria | 2777 |
| 198 | Ga0209588_1014661 | 3300027671 | Bacteria | 2402 |
| 199 | Ga0209588_1025016 | 3300027671 | Bacteria | 1888 |
| 200 | Ga0209588_1026754 | 3300027671 | Bacteria | 1833 |
| 201 | Ga0209588_1047209 | 3300027671 | Bacteria | 1393 |
| 202 | Ga0209588_1054491 | 3300027671 | Bacteria | 1293 |
| 203 | Ga0209588_1054925 | 3300027671 | Bacteria | 1288 |
| 204 | Ga0207428_10014418 | 3300027907 | Bacteria | 6869 |
| 205 | Ga0207428_10177116 | 3300027907 | Bacteria | 1612 |
| 206 | Ga0207428_10298225 | 3300027907 | Bacteria | 1193 |
| 207 | Ga0268266_10068382 | 3300028379 | Bacteria | 3075 |
| 208 | Ga0268266_10073315 | 3300028379 | Bacteria | 2971 |
| 209 | Ga0268266_10285020 | 3300028379 | Bacteria | 1537 |
| 210 | Ga0268265_10142550 | 3300028380 | Bacteria | 2008 |
| 211 | Ga0307515_10208768 | 3300028794 | Bacteria | 1804 |
| 212 | Ga0265316_10076463 | 3300031344 | Bacteria | 2572 |
| 213 | Ga0307513_10395825 | 3300031456 | Bacteria | 1117 |
| 214 | Ga0307509_10342757 | 3300031507 | Bacteria | 1221 |
| 215 | Ga0316575_10088997 | 3300031665 | Bacteria | 1249 |
| 216 | Ga0316577_10171576 | 3300031733 | Bacteria | 1224 |
| 217 | Ga0373958_0020619 | 3300034819 | Bacteria | 1216 |
| 218 | Ga0373926_0038432 | 3300035083 | Bacteria | 1704 |
| 219 | Ga0373926_0093330 | 3300035083 | Bacteria | 1121 |
| 220 | Ga0373934_0063382 | 3300035086 | Bacteria | 1474 |
| 221 | Ga0373944_0072751 | 3300035089 | Bacteria | 1122 |
| 222 | Ga0373923_0045529 | 3300035111 | Bacteria | 1822 |
| 223 | Ga0373923_0125141 | 3300035111 | Bacteria | 1151 |
| 224 | Ga0373932_0024998 | 3300035112 | Bacteria | 1613 |
| 225 | Ga0373936_0031374 | 3300035113 | Bacteria | 2098 |
| 226 | Ga0373945_0093841 | 3300035116 | Bacteria | 1165 |
| 227 | Ga0373953_0073813 | 3300035117 | Bacteria | 1410 |
| 228 | Ga0373953_0077776 | 3300035117 | Bacteria | 1376 |
| 229 | Ga0373954_0122694 | 3300035118 | Bacteria | 1262 |
| 230 | Ga0373957_0061810 | 3300035120 | Bacteria | 1452 |
| 231 | Ga0373960_0038520 | 3300035121 | Bacteria | 1371 |
| 232 | Ga0373943_0059039 | 3300035170 | Bacteria | 1911 |
| 233 | Ga0373943_0127320 | 3300035170 | Bacteria | 1359 |
| 234 | Ga0373943_0138870 | 3300035170 | Bacteria | 1307 |
| 235 | Ga0373946_0049256 | 3300035171 | Bacteria | 1757 |
| 236 | Ga0373946_0112970 | 3300035171 | Bacteria | 1231 |
| 237 | Ga0373946_0128549 | 3300035171 | Bacteria | 1163 |
| 238 | Ga0373946_0136927 | 3300035171 | Bacteria | 1131 |
| 239 | Ga0373955_0160540 | 3300035172 | Bacteria | 1326 |
| 240 | Ga0373961_0084784 | 3300035241 | Bacteria | 1002 |
| 241 | Ga0373962_0071070 | 3300035242 | Bacteria | 1040 |
| 242 | Ga0316574_0253779 | 3300035398 | Bacteria | 1123 |
| 243 | Ga0373924_0017134 | 3300035410 | Bacteria | 2775 |
| 244 | Ga0373924_0096536 | 3300035410 | Bacteria | 1268 |
| 245 | Ga0373935_0041759 | 3300035692 | Bacteria | 2882 |
| 246 | Ga0373935_0268894 | 3300035692 | Bacteria | 1197 |
| 247 | Ga0373935_0273967 | 3300035692 | Bacteria | 1186 |
| 248 | Ga0373927_0081952 | 3300035695 | Bacteria | 2091 |
| 249 | Ga0373927_0116219 | 3300035695 | Bacteria | 1744 |
| 250 | Ga0373927_0125799 | 3300035695 | Bacteria | 1673 |
| 251 | Ga0373927_0201967 | 3300035695 | Bacteria | 1305 |
| 252 | Ga0373927_0240176 | 3300035695 | Bacteria | 1190 |
| 253 | Ga0373927_0254047 | 3300035695 | Bacteria | 1155 |
| 254 | Ga0373927_0313148 | 3300035695 | Bacteria | 1033 |
| 255 | Ga0373933_0022158 | 3300035724 | Bacteria | 3615 |
| 256 | Ga0373933_0100624 | 3300035724 | Bacteria | 1793 |
| 257 | Ga0373947_0036982 | 3300035725 | Bacteria | 2896 |
| 258 | Ga0373947_0077007 | 3300035725 | Bacteria | 2056 |
| 259 | Ga0373947_0156182 | 3300035725 | Bacteria | 1472 |
| 260 | Ga0373947_0180126 | 3300035725 | Bacteria | 1375 |
| 261 | Ga0373947_0252053 | 3300035725 | Bacteria | 1167 |
| 262 | Ga0373937_0061135 | 3300036401 | Bacteria | 3462 |
| 263 | Ga0373937_0309312 | 3300036401 | Bacteria | 1494 |
| 264 | Ga0316584_0176137 | 3300036712 | Bacteria | 1584 |
| 265 | Ga0316584_0259499 | 3300036712 | Bacteria | 1267 |
| 266 | Ga0373925_0267129 | 3300037068 | Bacteria | 1375 |
| 267 | Ga0373925_0311534 | 3300037068 | Bacteria | 1272 |
| 268 | Ga0373925_0344861 | 3300037068 | Bacteria | 1208 |
| 269 | Ga0373925_0361165 | 3300037068 | Bacteria | 1180 |
| 270 | Ga0395900_0484981 | 3300037418 | Bacteria | 1188 |
| 271 | Ga0395898_0163199 | 3300037466 | Bacteria | 2131 |
| 272 | Ga0395898_0347721 | 3300037466 | Bacteria | 1414 |
| 273 | Ga0395905_0026897 | 3300037471 | Bacteria | 5426 |
| 274 | Ga0395901_0361853 | 3300038443 | Bacteria | 1496 |
| 275 | Ga0436360_0224679 | 3300039438 | Bacteria | 2401 |
| 276 | Ga0436363_0485272 | 3300039450 | Bacteria | 3433 |
| 277 | Ga0451839_1025085 | 3300041496 | Bacteria | 1146 |
| 278 | Ga0495617_074576 | 3300046452 | Bacteria | 1113 |
| 279 | Ga0495627_060597 | 3300046453 | Bacteria | 1120 |
| 280 | Ga0495592_0187825 | 3300046454 | Bacteria | 1402 |
| 281 | Ga0495592_0238893 | 3300046454 | Bacteria | 1206 |
| 282 | Ga0495603_0119159 | 3300046455 | Bacteria | 1538 |
| 283 | Ga0495603_0133432 | 3300046455 | Bacteria | 1445 |
| 284 | Ga0495603_0141862 | 3300046455 | Bacteria | 1397 |
| 285 | Ga0495603_0160673 | 3300046455 | Bacteria | 1303 |
| 286 | Ga0495591_036672 | 3300046458 | Bacteria | 1425 |
| 287 | Ga0495629_0004078 | 3300046459 | Bacteria | 10966 |
| 288 | Ga0495629_0004237 | 3300046459 | Bacteria | 10753 |
| 289 | Ga0495629_0073142 | 3300046459 | Bacteria | 2394 |
| 290 | Ga0495629_0082590 | 3300046459 | Bacteria | 2242 |
| 291 | Ga0495629_0145940 | 3300046459 | Bacteria | 1645 |
| 292 | Ga0495629_0146164 | 3300046459 | Bacteria | 1644 |
| 293 | Ga0495629_0157377 | 3300046459 | Bacteria | 1578 |
| 294 | Ga0495629_0249513 | 3300046459 | Bacteria | 1221 |
| 295 | Ga0495638_0014421 | 3300046460 | Bacteria | 5341 |
| 296 | Ga0495638_0161045 | 3300046460 | Bacteria | 1294 |
| 297 | Ga0495638_0190636 | 3300046460 | Bacteria | 1163 |
| 298 | Ga0495641_0058864 | 3300046461 | Bacteria | 1737 |
| 299 | Ga0495641_0090077 | 3300046461 | Bacteria | 1370 |
| 300 | Ga0495651_0078359 | 3300046462 | Bacteria | 2500 |
| 301 | Ga0495651_0162172 | 3300046462 | Bacteria | 1600 |
| 302 | Ga0495653_0011411 | 3300046463 | Bacteria | 7261 |
| 303 | Ga0495653_0156423 | 3300046463 | Bacteria | 1587 |
| 304 | Ga0495653_0242487 | 3300046463 | Bacteria | 1200 |
| 305 | Ga0495580_0025348 | 3300046472 | Bacteria | 4334 |
| 306 | Ga0495580_0165213 | 3300046472 | Bacteria | 1531 |
| 307 | Ga0495580_0202690 | 3300046472 | Bacteria | 1366 |
| 308 | Ga0495582_0058808 | 3300046473 | Bacteria | 2120 |
| 309 | Ga0495582_0135421 | 3300046473 | Unclassified | 1393 |
| 310 | Ga0495605_0112683 | 3300046474 | Bacteria | 1239 |
| 311 | Ga0495639_0008895 | 3300046475 | Bacteria | 4305 |
| 312 | Ga0495639_0070974 | 3300046475 | Bacteria | 1609 |
| 313 | Ga0495639_0106957 | 3300046475 | Bacteria | 1324 |
| 314 | Ga0495639_0117288 | 3300046475 | Bacteria | 1267 |
| 315 | Ga0495662_0082679 | 3300046476 | Bacteria | 1562 |
| 316 | Ga0495662_0101186 | 3300046476 | Bacteria | 1409 |
| 317 | Ga0495662_0121454 | 3300046476 | Bacteria | 1282 |
| 318 | Ga0495664_0021043 | 3300046477 | Bacteria | 3766 |
| 319 | Ga0495664_0066279 | 3300046477 | Bacteria | 2153 |
| 320 | Ga0495584_0112270 | 3300046491 | Bacteria | 1379 |
| 321 | Ga0495584_0152244 | 3300046491 | Bacteria | 1175 |
| 322 | Ga0495584_0176940 | 3300046491 | Bacteria | 1084 |
| 323 | Ga0495585_0027336 | 3300046492 | Bacteria | 3256 |
| 324 | Ga0495585_0173635 | 3300046492 | Bacteria | 1111 |
| 325 | Ga0495585_0174464 | 3300046492 | Bacteria | 1108 |
| 326 | Ga0495594_0013372 | 3300046499 | Bacteria | 4284 |
| 327 | Ga0495594_0082948 | 3300046499 | Bacteria | 1791 |
| 328 | Ga0495596_0086701 | 3300046500 | Bacteria | 1215 |
| 329 | Ga0495596_0097783 | 3300046500 | Bacteria | 1139 |
| 330 | Ga0495607_0015350 | 3300046501 | Bacteria | 4967 |
| 331 | Ga0495607_0122586 | 3300046501 | Bacteria | 1362 |
| 332 | Ga0495607_0134176 | 3300046501 | Bacteria | 1284 |
| 333 | Ga0495583_0103653 | 3300046506 | Bacteria | 1212 |
| 334 | Ga0495583_0123580 | 3300046506 | Bacteria | 1087 |
| 335 | Ga0495608_0091155 | 3300046511 | Bacteria | 1971 |
| 336 | Ga0495608_0186368 | 3300046511 | Bacteria | 1311 |
| 337 | Ga0495608_0213139 | 3300046511 | Bacteria | 1213 |
| 338 | Ga0495616_0088193 | 3300046513 | Bacteria | 1473 |
| 339 | Ga0495616_0127267 | 3300046513 | Bacteria | 1170 |
| 340 | Ga0495618_0003442 | 3300046514 | Bacteria | 9838 |
| 341 | Ga0495618_0024958 | 3300046514 | Bacteria | 3707 |
| 342 | Ga0495618_0087827 | 3300046514 | Bacteria | 1988 |
| 343 | Ga0495618_0101423 | 3300046514 | Bacteria | 1842 |
| 344 | Ga0495618_0211521 | 3300046514 | Bacteria | 1225 |
| 345 | Ga0495628_0054182 | 3300046516 | Bacteria | 3162 |
| 346 | Ga0495628_0102202 | 3300046516 | Bacteria | 2212 |
| 347 | Ga0495628_0290194 | 3300046516 | Bacteria | 1213 |
| 348 | Ga0495630_0041005 | 3300046517 | Bacteria | 3458 |
| 349 | Ga0495630_0054992 | 3300046517 | Bacteria | 2982 |
| 350 | Ga0495630_0057984 | 3300046517 | Bacteria | 2902 |
| 351 | Ga0495630_0216053 | 3300046517 | Bacteria | 1463 |
| 352 | Ga0495630_0216905 | 3300046517 | Bacteria | 1460 |
| 353 | Ga0495631_0084058 | 3300046518 | Bacteria | 1372 |
| 354 | Ga0495631_0089803 | 3300046518 | Bacteria | 1323 |
| 355 | Ga0495631_0108513 | 3300046518 | Bacteria | 1193 |
| 356 | Ga0495632_0083287 | 3300046519 | Bacteria | 1523 |
| 357 | Ga0495637_0069275 | 3300046520 | Bacteria | 1427 |
| 358 | Ga0495644_0043801 | 3300046523 | Bacteria | 1683 |
| 359 | Ga0495648_0004418 | 3300046524 | Bacteria | 12013 |
| 360 | Ga0495663_0036090 | 3300046525 | Bacteria | 1487 |
| 361 | Ga0495666_0082341 | 3300046526 | Bacteria | 1521 |
| 362 | Ga0495666_0097733 | 3300046526 | Bacteria | 1384 |
| 363 | Ga0495666_0106305 | 3300046526 | Bacteria | 1320 |
| 364 | Ga0495666_0149659 | 3300046526 | Bacteria | 1085 |
| 365 | Ga0495642_0064983 | 3300046528 | Bacteria | 1518 |
| 366 | Ga0495652_0035625 | 3300046529 | Bacteria | 4331 |
| 367 | Ga0495652_0133199 | 3300046529 | Bacteria | 1964 |
| 368 | Ga0495652_0188648 | 3300046529 | Bacteria | 1575 |
| 369 | Ga0495665_0047525 | 3300046531 | Bacteria | 2276 |
| 370 | Ga0495665_0122018 | 3300046531 | Bacteria | 1364 |
| 371 | Ga0495665_0144613 | 3300046531 | Bacteria | 1242 |
| 372 | Ga0495665_0175787 | 3300046531 | Unclassified | 1113 |
| 373 | Ga0495640_0001058 | 3300046533 | Bacteria | 21427 |
| 374 | Ga0495640_0006342 | 3300046533 | Bacteria | 9374 |
| 375 | Ga0495640_0008012 | 3300046533 | Bacteria | 8301 |
| 376 | Ga0495640_0021997 | 3300046533 | Bacteria | 4669 |
| 377 | Ga0495640_0058231 | 3300046533 | Plasmid | 2635 |
| 378 | Ga0495640_0190358 | 3300046533 | Bacteria | 1304 |
| 379 | Ga0495587_0003500 | 3300046536 | Bacteria | 10457 |
| 380 | Ga0495587_0210579 | 3300046536 | Bacteria | 1098 |
| 381 | Ga0495587_0224304 | 3300046536 | Bacteria | 1059 |
| 382 | Ga0495598_0060587 | 3300046537 | Bacteria | 1166 |
| 383 | Ga0495598_0065922 | 3300046537 | Bacteria | 1128 |
| 384 | Ga0495609_0117205 | 3300046538 | Bacteria | 1146 |
| 385 | Ga0495621_0004372 | 3300046539 | Bacteria | 3971 |
| 386 | Ga0495621_0075840 | 3300046539 | Bacteria | 1247 |
| 387 | Ga0495645_0050635 | 3300046543 | Bacteria | 3023 |
| 388 | Ga0495645_0061730 | 3300046543 | Bacteria | 2715 |
| 389 | Ga0495645_0074561 | 3300046543 | Bacteria | 2443 |
| 390 | Ga0495645_0135985 | 3300046543 | Bacteria | 1719 |
| 391 | Ga0495622_0120882 | 3300046557 | Bacteria | 1196 |
| 392 | Ga0495622_0130942 | 3300046557 | Bacteria | 1142 |
| 393 | Ga0495633_0025442 | 3300046558 | Bacteria | 2914 |
| 394 | Ga0495633_0141424 | 3300046558 | Bacteria | 1112 |
| 395 | Ga0495667_0041057 | 3300046559 | Bacteria | 3069 |
| 396 | Ga0495667_0220199 | 3300046559 | Bacteria | 1211 |
| 397 | Ga0495667_0231282 | 3300046559 | Bacteria | 1178 |
| 398 | Ga0495656_0057716 | 3300046615 | Bacteria | 1681 |
| 399 | Ga0495656_0148078 | 3300046615 | Bacteria | 1131 |
| 400 | Ga0495668_0117054 | 3300046616 | Bacteria | 1457 |
| 401 | Ga0495668_0166725 | 3300046616 | Bacteria | 1206 |
| 402 | Ga0495634_0025225 | 3300046642 | Bacteria | 4164 |
| 403 | Ga0495634_0078630 | 3300046642 | Bacteria | 2160 |
| 404 | Ga0495634_0141277 | 3300046642 | Bacteria | 1528 |
| 405 | Ga0495634_0142532 | 3300046642 | Bacteria | 1520 |
| 406 | Ga0495634_0158960 | 3300046642 | Bacteria | 1425 |
| 407 | Ga0495634_0232867 | 3300046642 | Bacteria | 1132 |
| 408 | Ga0495611_0013870 | 3300046648 | Bacteria | 3437 |
| 409 | Ga0495611_0062750 | 3300046648 | Bacteria | 1690 |
| 410 | Ga0495611_0089965 | 3300046648 | Bacteria | 1418 |
| 411 | Ga0495611_0130403 | 3300046648 | Bacteria | 1172 |
| 412 | Ga0495625_0065503 | 3300046660 | Bacteria | 2561 |
| 413 | Ga0495625_0139363 | 3300046660 | Bacteria | 1637 |
| 414 | Ga0495635_0005126 | 3300046663 | Bacteria | 9116 |
| 415 | Ga0495635_0011879 | 3300046663 | Bacteria | 6104 |
| 416 | Ga0495635_0078839 | 3300046663 | Bacteria | 2255 |
| 417 | Ga0495635_0221023 | 3300046663 | Bacteria | 1281 |
| 418 | Ga0495635_0272330 | 3300046663 | Bacteria | 1138 |
| 419 | Ga0495659_0019386 | 3300046664 | Bacteria | 2276 |
| 420 | Ga0495659_0086026 | 3300046664 | Bacteria | 1200 |
| 421 | Ga0495659_0098246 | 3300046664 | Bacteria | 1131 |
| 422 | Ga0495661_0151047 | 3300046665 | Bacteria | 1254 |
| 423 | Ga0495661_0166490 | 3300046665 | Bacteria | 1179 |
| 424 | Ga0495588_0086187 | 3300046674 | Bacteria | 1642 |
| 425 | Ga0495588_0159078 | 3300046674 | Bacteria | 1194 |
| 426 | Ga0495588_0186985 | 3300046674 | Bacteria | 1094 |
| 427 | Ga0495599_0024320 | 3300046678 | Bacteria | 3788 |
| 428 | Ga0495599_0159112 | 3300046678 | Bacteria | 1396 |
| 429 | Ga0495599_0252334 | 3300046678 | Bacteria | 1073 |
| 430 | Ga0495623_0005531 | 3300046679 | Bacteria | 8254 |
| 431 | Ga0495623_0031085 | 3300046679 | Bacteria | 3435 |
| 432 | Ga0495646_0032769 | 3300046680 | Bacteria | 3232 |
| 433 | Ga0495646_0041132 | 3300046680 | Bacteria | 2841 |
| 434 | Ga0495646_0148516 | 3300046680 | Bacteria | 1305 |
| 435 | Ga0495646_0166899 | 3300046680 | Bacteria | 1215 |
| 436 | Ga0495647_0013274 | 3300046681 | Bacteria | 2851 |
| 437 | Ga0495647_0043777 | 3300046681 | Bacteria | 1714 |
| 438 | Ga0495647_0088066 | 3300046681 | Bacteria | 1269 |
| 439 | Ga0495647_0113117 | 3300046681 | Bacteria | 1134 |
| 440 | Ga0495647_0140151 | 3300046681 | Bacteria | 1031 |
| 441 | Ga0495658_0085258 | 3300046683 | Bacteria | 1861 |
| 442 | Ga0495658_0100444 | 3300046683 | Bacteria | 1726 |
| 443 | Ga0495658_0210574 | 3300046683 | Bacteria | 1214 |
| 444 | Ga0495658_0227487 | 3300046683 | Bacteria | 1169 |
| 445 | Ga0495669_0064956 | 3300046684 | Bacteria | 1656 |
| 446 | Ga0495613_0196079 | 3300046689 | Bacteria | 1425 |
| 447 | Ga0495613_0239980 | 3300046689 | Bacteria | 1267 |
| 448 | Ga0495613_0248263 | 3300046689 | Bacteria | 1242 |
| 449 | Ga0495624_0016238 | 3300046690 | Bacteria | 5013 |
| 450 | Ga0495624_0114269 | 3300046690 | Bacteria | 1659 |
| 451 | Ga0495624_0273879 | 3300046690 | Bacteria | 1020 |
| 452 | Ga0495670_0012957 | 3300046691 | Bacteria | 4099 |
| 453 | Ga0495670_0031741 | 3300046691 | Bacteria | 2625 |
| 454 | Ga0495670_0040461 | 3300046691 | Bacteria | 2324 |
| 455 | Ga0495671_0138235 | 3300046692 | Bacteria | 1187 |
| 456 | Ga0495649_0139111 | 3300046694 | Bacteria | 1279 |
| 457 | Ga0495649_0184436 | 3300046694 | Bacteria | 1088 |
| 458 | Ga0495589_0037538 | 3300046794 | Bacteria | 2427 |
| 459 | Ga0495589_0123250 | 3300046794 | Bacteria | 1247 |
| 460 | Ga0495600_0003901 | 3300046809 | Bacteria | 8856 |
| 461 | Ga0495600_0009456 | 3300046809 | Bacteria | 6023 |
| 462 | Ga0495600_0011988 | 3300046809 | Bacteria | 5413 |
| 463 | Ga0495600_0145110 | 3300046809 | Bacteria | 1538 |
| 464 | Ga0495581_0120638 | 3300047315 | Bacteria | 1526 |
| 465 | Ga0495581_0177679 | 3300047315 | Bacteria | 1244 |
| 466 | Ga0495581_0216899 | 3300047315 | Bacteria | 1118 |
| 467 | Ga0495604_0031270 | 3300047317 | Bacteria | 4223 |
| 468 | Ga0495604_0148047 | 3300047317 | Bacteria | 1671 |
| 469 | Ga0495604_0258833 | 3300047317 | Bacteria | 1183 |
| 470 | Ga0495636_0053005 | 3300047318 | Bacteria | 1702 |
| 471 | Ga0495636_0117256 | 3300047318 | Bacteria | 1175 |
| 472 | Ga0495674_0001881 | 3300047319 | Bacteria | 20669 |
| 473 | Ga0495674_0020337 | 3300047319 | Bacteria | 6146 |
| 474 | Ga0495674_0129008 | 3300047319 | Bacteria | 2131 |
| 475 | Ga0495674_0178856 | 3300047319 | Bacteria | 1767 |
| 476 | Ga0495674_0402632 | 3300047319 | Bacteria | 1104 |
| 477 | Ga0495672_0011148 | 3300047320 | Bacteria | 6358 |
| 478 | Ga0495672_0075654 | 3300047320 | Bacteria | 1893 |
| 479 | Ga0495676_0012818 | 3300047321 | Bacteria | 7540 |
| 480 | Ga0495676_0184616 | 3300047321 | Bacteria | 1459 |
| 481 | Ga0495676_0244657 | 3300047321 | Bacteria | 1226 |
| 482 | Ga0495676_0263212 | 3300047321 | Bacteria | 1172 |
| 483 | Ga0495676_0266566 | 3300047321 | Bacteria | 1163 |
| 484 | Ga0495680_0001664 | 3300047322 | Bacteria | 23637 |
| 485 | Ga0495680_0076721 | 3300047322 | Bacteria | 2533 |
| 486 | Ga0495680_0227980 | 3300047322 | Bacteria | 1327 |
| 487 | Ga0495683_0017077 | 3300047323 | Bacteria | 3764 |
| 488 | Ga0495683_0109824 | 3300047323 | Bacteria | 1317 |
| 489 | Ga0495675_0191167 | 3300047444 | Bacteria | 1249 |
| 490 | Ga0495675_0213751 | 3300047444 | Bacteria | 1169 |
| 491 | Ga0495677_0031620 | 3300047445 | Bacteria | 1926 |
| 492 | Ga0495677_0093115 | 3300047445 | Bacteria | 1136 |
| 493 | Ga0495679_030355 | 3300047446 | Bacteria | 1755 |
| 494 | Ga0495679_040438 | 3300047446 | Bacteria | 1449 |
| 495 | Ga0495685_050698 | 3300047447 | Bacteria | 1409 |
| 496 | Ga0495673_0057275 | 3300047469 | Bacteria | 1683 |
| 497 | Ga0495681_0085708 | 3300047470 | Bacteria | 1398 |
| 498 | Ga0495684_0003144 | 3300047471 | Bacteria | 12939 |
| 499 | Ga0495684_0011170 | 3300047471 | Bacteria | 6938 |
| 500 | Ga0495684_0024291 | 3300047471 | Bacteria | 4665 |
| 501 | Ga0495684_0226812 | 3300047471 | Bacteria | 1367 |
| 502 | Ga0495686_0110207 | 3300047472 | Bacteria | 1651 |
| 503 | Ga0495593_0017246 | 3300047673 | Bacteria | 4063 |
| 504 | Ga0495593_0110639 | 3300047673 | Bacteria | 1403 |
| 505 | Ga0495593_0159859 | 3300047673 | Bacteria | 1137 |
| 506 | Ga0495593_0160358 | 3300047673 | Bacteria | 1135 |
| 507 | Ga0495602_0067537 | 3300048088 | Bacteria | 3075 |
| 508 | Ga0495614_0141124 | 3300048089 | Bacteria | 1070 |
| 509 | Ga0495615_0032145 | 3300048090 | Bacteria | 1263 |
| 510 | Ga0496101_0276821 | 3300048904 | Bacteria | 1311 |
| 511 | Ga0496102_0473808 | 3300048905 | Bacteria | 1173 |
| 512 | Ga0496104_0326366 | 3300048907 | Bacteria | 1448 |
| 513 | Ga0496104_0368405 | 3300048907 | Bacteria | 1349 |
| 514 | Ga0496105_0290349 | 3300048908 | Bacteria | 1317 |
| 515 | Ga0496106_0356153 | 3300048909 | Bacteria | 1176 |
| 516 | Ga0496107_0259124 | 3300048910 | Bacteria | 1294 |
| 517 | Ga0496109_0233534 | 3300048912 | Bacteria | 1730 |
| 518 | Ga0496109_0481646 | 3300048912 | Bacteria | 1171 |
| 519 | Ga0496112_0458281 | 3300048915 | Bacteria | 1212 |
| 520 | Ga0496113_0322447 | 3300048916 | Bacteria | 1238 |
| 521 | Ga0496115_0351258 | 3300048918 | Bacteria | 1202 |
| 522 | Ga0496121_0209843 | 3300048924 | Bacteria | 1381 |
| 523 | Ga0496126_0017981 | 3300048929 | Bacteria | 7028 |
| 524 | Ga0496126_0018102 | 3300048929 | Bacteria | 6995 |
| 525 | Ga0495682_0017855 | 3300049460 | Bacteria | 2673 |
| 526 | nmdc:mga06z11_89660_c1 | 3300050494 | Bacteria | 1667 |
| 527 | nmdc:mga05p37_112454_c1 | 3300050507 | Bacteria | 3349 |
| 528 | nmdc:mga05p37_123381_c1 | 3300050507 | Bacteria | 3182 |
| 529 | nmdc:mga05p37_14284_c1 | 3300050507 | Bacteria | 9536 |
| 530 | nmdc:mga05p37_146065_c1 | 3300050507 | Bacteria | 2896 |
| 531 | nmdc:mga05p37_17548_c1 | 3300050507 | Bacteria | 8641 |
| 532 | nmdc:mga05p37_437098_c1 | 3300050507 | Bacteria | 1519 |
| 533 | nmdc:mga05p37_49656_c1 | 3300050507 | Bacteria | 5161 |
| 534 | nmdc:mga05p37_595796_c1 | 3300050507 | Bacteria | 1249 |
| 535 | nmdc:mga05p37_728489_c1 | 3300050507 | Bacteria | 1097 |
| 536 | nmdc:mga09592_208552_c1 | 3300050508 | Bacteria | 1693 |
| 537 | nmdc:mga09592_36353_c1 | 3300050508 | Bacteria | 4125 |
| 538 | nmdc:mga0qj67_360557_c1 | 3300050509 | Bacteria | 1175 |
| 539 | nmdc:mga0qj67_8436_c1 | 3300050509 | Bacteria | 7645 |
| 540 | nmdc:mga06r32_185010_c1 | 3300050510 | Bacteria | 2070 |
| 541 | nmdc:mga06r32_446199_c1 | 3300050510 | Bacteria | 1274 |
| 542 | nmdc:mga06r32_470308_c1 | 3300050510 | Bacteria | 1236 |
| 543 | nmdc:mga06r32_84544_c1 | 3300050510 | Bacteria | 3093 |
| 544 | nmdc:mga08y16_147178_c1 | 3300050511 | Unclassified | 2448 |
| 545 | nmdc:mga08y16_203101_c1 | 3300050511 | Bacteria | 2054 |
| 546 | nmdc:mga08y16_3173_c1 | 3300050511 | Bacteria | 17018 |
| 547 | nmdc:mga08y16_35747_c1 | 3300050511 | Bacteria | 5218 |
| 548 | nmdc:mga08y16_384793_c1 | 3300050511 | Bacteria | 1438 |
| 549 | nmdc:mga08y16_48876_c1 | 3300050511 | Bacteria | 4427 |
| 550 | nmdc:mga0n895_212286_c1 | 3300050512 | Bacteria | 1966 |
| 551 | nmdc:mga0n895_244118_c1 | 3300050512 | Bacteria | 1823 |
| 552 | nmdc:mga0n895_43428_c1 | 3300050512 | Bacteria | 4380 |
| 553 | nmdc:mga0n895_45830_c1 | 3300050512 | Bacteria | 4269 |
| 554 | nmdc:mga0n895_472588_c1 | 3300050512 | Bacteria | 1265 |
| 555 | nmdc:mga0rr50_21931_c1 | 3300050513 | Bacteria | 4371 |
| 556 | nmdc:mga0rr50_268197_c1 | 3300050513 | Bacteria | 1422 |
| 557 | nmdc:mga0rr50_385129_c1 | 3300050513 | Bacteria | 1183 |
| 558 | nmdc:mga0a205_217821_c1 | 3300050515 | Bacteria | 1796 |
| 559 | nmdc:mga0a205_232891_c1 | 3300050515 | Bacteria | 1725 |
| 560 | nmdc:mga0a205_386752_c1 | 3300050515 | Bacteria | 1264 |
| 561 | Ga0495601_0002373 | 3300053077 | Bacteria | 10671 |
| 562 | Ga0495601_0023857 | 3300053077 | Bacteria | 3761 |
| 563 | Ga0495601_0041306 | 3300053077 | Bacteria | 2890 |
| 564 | Ga0495601_0077238 | 3300053077 | Bacteria | 2132 |
| 565 | Ga0495601_0158363 | 3300053077 | Bacteria | 1479 |
| 566 | Ga0495601_0210708 | 3300053077 | Bacteria | 1269 |
| 567 | Ga0495612_0002936 | 3300053078 | Bacteria | 7071 |
| 568 | Ga0495612_0046030 | 3300053078 | Bacteria | 1786 |
| 569 | Ga0495655_0011717 | 3300053083 | Bacteria | 1769 |
| 570 | Ga0495655_0030035 | 3300053083 | Bacteria | 1311 |
| 571 | Ga0495655_0033692 | 3300053083 | Bacteria | 1262 |
| 572 | Ga0495595_0102350 | 3300053084 | Bacteria | 1383 |
| 573 | Ga0495595_0108675 | 3300053084 | Bacteria | 1343 |
| 574 | Ga0495595_0140993 | 3300053084 | Bacteria | 1182 |
| 575 | Ga0495619_0001546 | 3300053085 | Bacteria | 15159 |
| 576 | Ga0495619_0003379 | 3300053085 | Bacteria | 10312 |
| 577 | Ga0495619_0028063 | 3300053085 | Bacteria | 3629 |
| 578 | Ga0495619_0028657 | 3300053085 | Bacteria | 3593 |
| 579 | Ga0495619_0035955 | 3300053085 | Bacteria | 3224 |
| 580 | Ga0500651_0000666 | 3300053093 | Bacteria | 17091 |
| 581 | Ga0500595_027475 | 3300053119 | Bacteria | 1948 |
| 582 | Ga0500658_0000628 | 3300053134 | Bacteria | 14610 |
| 583 | Ga0500568_0003547 | 3300053139 | Bacteria | 8635 |
| 584 | Ga0500577_0040697 | 3300053142 | Bacteria | 1692 |
| 585 | Ga0500627_0003802 | 3300053158 | Bacteria | 4742 |
| 586 | Ga0500634_0013459 | 3300053161 | Bacteria | 4290 |
| 587 | Ga0500657_104062 | 3300053728 | Bacteria | 1164 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005471 | Ga0070698_100019478 | Ga0070698_10001947810 | 261 |
| 2 | 3300053119 | Ga0500595_027475 | Ga0500595_027475_710_1591 | 293 |
| 3 | 3300048089 | Ga0495614_0141124 | Ga0495614_0141124_161_1060 | 299 |
| 4 | 3300046533 | Ga0495640_0006342 | Ga0495640_0006342_686_1645 | 301 |
| 5 | 3300031665 | Ga0316575_10088997 | Ga0316575_100889972 | 303 |
| 6 | 3300035241 | Ga0373961_0084784 | Ga0373961_0084784_51_962 | 303 |
| 7 | 3300035242 | Ga0373962_0071070 | Ga0373962_0071070_55_966 | 303 |
| 8 | 3300013104 | Ga0157370_10467275 | Ga0157370_104672752 | 304 |
| 9 | 3300005471 | Ga0070698_100074283 | Ga0070698_1000742832 | 306 |
| 10 | 3300046681 | Ga0495647_0140151 | Ga0495647_0140151_80_1000 | 306 |
| 11 | 3300041496 | Ga0451839_1025085 | Ga0451839_1025085_164_1096 | 310 |
| 12 | 3300005536 | Ga0070697_100092007 | Ga0070697_1000920074 | 314 |
| 13 | iso_pu_bacteria | 8056681323 | 8056688912 | 314 |
| 14 | 3300013306 | Ga0163162_10215043 | Ga0163162_102150433 | 317 |
| 15 | 3300035111 | Ga0373923_0125141 | Ga0373923_0125141_176_1135 | 319 |
| 16 | 3300035724 | Ga0373933_0022158 | Ga0373933_0022158_1076_2035 | 319 |
| 17 | 3300046477 | Ga0495664_0066279 | Ga0495664_0066279_957_1931 | 319 |
| 18 | 3300046491 | Ga0495584_0112270 | Ga0495584_0112270_384_1343 | 319 |
| 19 | 3300046518 | Ga0495631_0089803 | Ga0495631_0089803_292_1251 | 319 |
| 20 | 3300047323 | Ga0495683_0017077 | Ga0495683_0017077_315_1274 | 319 |
| 21 | 3300047445 | Ga0495677_0031620 | Ga0495677_0031620_23_1039 | 319 |
| 22 | 3300006028 | Ga0070717_10027562 | Ga0070717_100275624 | 320 |
| 23 | 3300005543 | Ga0070672_100053965 | Ga0070672_1000539653 | 322 |
| 24 | 3300046690 | Ga0495624_0273879 | Ga0495624_0273879_39_1010 | 323 |
| 25 | 3300035695 | Ga0373927_0125799 | Ga0373927_0125799_19_1005 | 325 |
| 26 | 3300005333 | Ga0070677_10065383 | Ga0070677_100653832 | 326 |
| 27 | 3300005340 | Ga0070689_100026697 | Ga0070689_1000266976 | 326 |
| 28 | 3300005353 | Ga0070669_100155005 | Ga0070669_1001550052 | 326 |
| 29 | 3300005354 | Ga0070675_100041168 | Ga0070675_1000411682 | 326 |
| 30 | 3300005439 | Ga0070711_100247924 | Ga0070711_1002479241 | 326 |
| 31 | 3300005441 | Ga0070700_100276538 | Ga0070700_1002765381 | 326 |
| 32 | 3300005466 | Ga0070685_10081192 | Ga0070685_100811921 | 326 |
| 33 | 3300005615 | Ga0070702_100202546 | Ga0070702_1002025461 | 326 |
| 34 | 3300005617 | Ga0068859_100116741 | Ga0068859_1001167412 | 326 |
| 35 | 3300005618 | Ga0068864_100297127 | Ga0068864_1002971272 | 326 |
| 36 | 3300005843 | Ga0068860_100413064 | Ga0068860_1004130642 | 326 |
| 37 | 3300005844 | Ga0068862_100303359 | Ga0068862_1003033591 | 326 |
| 38 | 3300006881 | Ga0068865_100364556 | Ga0068865_1003645561 | 326 |
| 39 | 3300006931 | Ga0097620_100116749 | Ga0097620_1001167495 | 326 |
| 40 | 3300009094 | Ga0111539_10186929 | Ga0111539_101869293 | 326 |
| 41 | 3300009176 | Ga0105242_10264974 | Ga0105242_102649742 | 326 |
| 42 | 3300009177 | Ga0105248_10396075 | Ga0105248_103960752 | 326 |
| 43 | 3300014325 | Ga0163163_10396773 | Ga0163163_103967732 | 326 |
| 44 | 3300025898 | Ga0207692_10196181 | Ga0207692_101961811 | 326 |
| 45 | 3300025908 | Ga0207643_10084344 | Ga0207643_100843443 | 326 |
| 46 | 3300025926 | Ga0207659_10070720 | Ga0207659_100707202 | 326 |
| 47 | 3300025936 | Ga0207670_10243634 | Ga0207670_102436342 | 326 |
| 48 | 3300025940 | Ga0207691_10149170 | Ga0207691_101491704 | 326 |
| 49 | 3300025960 | Ga0207651_10380883 | Ga0207651_103808831 | 326 |
| 50 | 3300026075 | Ga0207708_10142137 | Ga0207708_101421372 | 326 |
| 51 | 3300026095 | Ga0207676_10429998 | Ga0207676_104299981 | 326 |
| 52 | 3300050511 | nmdc:mga08y16_147178_c1 | nmdc:mga08y16_147178_c1_134_1114 | 326 |
| 53 | 3300039438 | Ga0436360_0224679 | Ga0436360_0224679_1328_2311 | 327 |
| 54 | 3300046681 | Ga0495647_0088066 | Ga0495647_0088066_10_993 | 327 |
| 55 | 3300007265 | Ga0099794_10136136 | Ga0099794_101361361 | 328 |
| 56 | 3300035695 | Ga0373927_0313148 | Ga0373927_0313148_34_1020 | 328 |
| 57 | 3300035725 | Ga0373947_0252053 | Ga0373947_0252053_153_1139 | 328 |
| 58 | 3300046459 | Ga0495629_0145940 | Ga0495629_0145940_608_1594 | 328 |
| 59 | 3300046536 | Ga0495587_0224304 | Ga0495587_0224304_48_1034 | 328 |
| 60 | 3300046663 | Ga0495635_0005126 | Ga0495635_0005126_5032_6033 | 329 |
| 61 | 3300046681 | Ga0495647_0043777 | Ga0495647_0043777_18_1019 | 329 |
| 62 | 3300025898 | Ga0207692_10021714 | Ga0207692_100217143 | 330 |
| 63 | 3300005327 | Ga0070658_10470099 | Ga0070658_104700991 | 331 |
| 64 | 3300005337 | Ga0070682_100095274 | Ga0070682_1000952741 | 331 |
| 65 | 3300005578 | Ga0068854_100105684 | Ga0068854_1001056842 | 331 |
| 66 | 3300005614 | Ga0068856_100286396 | Ga0068856_1002863962 | 331 |
| 67 | 3300010375 | Ga0105239_10762993 | Ga0105239_107629931 | 331 |
| 68 | 3300025911 | Ga0207654_10290448 | Ga0207654_102904481 | 331 |
| 69 | 3300025913 | Ga0207695_10272819 | Ga0207695_102728193 | 331 |
| 70 | 3300025914 | Ga0207671_10074523 | Ga0207671_100745231 | 331 |
| 71 | 3300025920 | Ga0207649_10341174 | Ga0207649_103411741 | 331 |
| 72 | 3300025921 | Ga0207652_10182357 | Ga0207652_101823573 | 331 |
| 73 | 3300025924 | Ga0207694_10063592 | Ga0207694_100635923 | 331 |
| 74 | 3300025940 | Ga0207691_10208846 | Ga0207691_102088462 | 331 |
| 75 | 3300025949 | Ga0207667_10580008 | Ga0207667_105800082 | 331 |
| 76 | 3300025981 | Ga0207640_10353668 | Ga0207640_103536681 | 331 |
| 77 | 3300026067 | Ga0207678_10196869 | Ga0207678_101968691 | 331 |
| 78 | 3300026116 | Ga0207674_10093100 | Ga0207674_100931007 | 331 |
| 79 | 3300007076 | Ga0075435_100442485 | Ga0075435_1004424851 | 333 |
| 80 | 3300025917 | Ga0207660_10171540 | Ga0207660_101715401 | 333 |
| 81 | iso_pu_bacteria | 2935810662 | 2935811965 | 333 |
| 82 | iso_pu_bacteria | 2936037263 | 2936038548 | 333 |
| 83 | 3300031733 | Ga0316577_10171576 | Ga0316577_101715762 | 334 |
| 84 | 3300035410 | Ga0373924_0017134 | Ga0373924_0017134_61_1065 | 334 |
| 85 | 3300035724 | Ga0373933_0100624 | Ga0373933_0100624_722_1726 | 334 |
| 86 | 3300036401 | Ga0373937_0061135 | Ga0373937_0061135_187_1191 | 334 |
| 87 | 3300046514 | Ga0495618_0101423 | Ga0495618_0101423_147_1151 | 334 |
| 88 | 3300046536 | Ga0495587_0003500 | Ga0495587_0003500_9254_10258 | 334 |
| 89 | 3300047444 | Ga0495675_0191167 | Ga0495675_0191167_10_1014 | 334 |
| 90 | iso_pu_bacteria | 2513237098 | 2513677318 | 334 |
| 91 | iso_pu_bacteria | 2513237141 | 1024 | 334 |
| 92 | iso_pu_bacteria | 2885383462 | 2885392449 | 334 |
| 93 | iso_pu_bacteria | 2935675223 | 2935680200 | 334 |
| 94 | iso_pu_bacteria | 2935684952 | 2935693693 | 334 |
| 95 | iso_pu_bacteria | 2935694250 | 2935700760 | 334 |
| 96 | iso_pu_bacteria | 2935713505 | 2935722804 | 334 |
| 97 | iso_pu_bacteria | 2935722832 | 2935732137 | 334 |
| 98 | iso_pu_bacteria | 2935732158 | 2935740908 | 334 |
| 99 | iso_pu_bacteria | 2935741537 | 2935750389 | 334 |
| 100 | iso_pu_bacteria | 2935750917 | 2935759878 | 334 |
| 101 | iso_pu_bacteria | 2935760218 | 2935767938 | 334 |
| 102 | iso_pu_bacteria | 2935760218 | 2935768736 | 334 |
| 103 | iso_pu_bacteria | 2940556831 | 2940565783 | 334 |
| 104 | iso_pu_bacteria | 8006973647 | 8006984277 | 334 |
| 105 | iso_pu_bacteria | 8056681323 | 8056682637 | 334 |
| 106 | iso_pu_bacteria | 8056681323 | 8056684121 | 334 |
| 107 | iso_pu_bacteria | 8056681323 | 8056687030 | 334 |
| 108 | iso_pu_bacteria | 8056681323 | 8056689360 | 334 |
| 109 | iso_pu_bacteria | 8056681323 | 8056689438 | 334 |
| 110 | 3300035725 | Ga0373947_0036982 | Ga0373947_0036982_1162_2169 | 335 |
| 111 | 3300046459 | Ga0495629_0004078 | Ga0495629_0004078_6210_7217 | 335 |
| 112 | 3300046463 | Ga0495653_0011411 | Ga0495653_0011411_3957_4964 | 335 |
| 113 | 3300046514 | Ga0495618_0003442 | Ga0495618_0003442_275_1282 | 335 |
| 114 | 3300046516 | Ga0495628_0102202 | Ga0495628_0102202_1175_2182 | 335 |
| 115 | 3300046517 | Ga0495630_0054992 | Ga0495630_0054992_153_1160 | 335 |
| 116 | 3300046533 | Ga0495640_0001058 | Ga0495640_0001058_354_1361 | 335 |
| 117 | 3300046642 | Ga0495634_0142532 | Ga0495634_0142532_277_1284 | 335 |
| 118 | 3300046809 | Ga0495600_0003901 | Ga0495600_0003901_141_1148 | 335 |
| 119 | 3300047317 | Ga0495604_0031270 | Ga0495604_0031270_2729_3736 | 335 |
| 120 | 3300047319 | Ga0495674_0001881 | Ga0495674_0001881_277_1284 | 335 |
| 121 | 3300047322 | Ga0495680_0001664 | Ga0495680_0001664_6788_7795 | 335 |
| 122 | 3300047471 | Ga0495684_0003144 | Ga0495684_0003144_11571_12578 | 335 |
| 123 | 3300047673 | Ga0495593_0110639 | Ga0495593_0110639_87_1190 | 335 |
| 124 | 3300053077 | Ga0495601_0002373 | Ga0495601_0002373_9093_10100 | 335 |
| 125 | 3300053085 | Ga0495619_0003379 | Ga0495619_0003379_213_1220 | 335 |
| 126 | iso_pu_bacteria | 8019648815 | 8019649735 | 335 |
| 127 | 3300047317 | Ga0495604_0148047 | Ga0495604_0148047_17_1027 | 336 |
| 128 | 3300005456 | Ga0070678_100092318 | Ga0070678_1000923182 | 337 |
| 129 | 3300026121 | Ga0207683_10049325 | Ga0207683_100493252 | 337 |
| 130 | 3300035118 | Ga0373954_0122694 | Ga0373954_0122694_124_1137 | 337 |
| 131 | 3300000532 | CNAas_1003295 | CNAas_10032951 | 338 |
| 132 | 3300000545 | CNXas_1003844 | CNXas_10038441 | 338 |
| 133 | 3300005295 | Ga0065707_10178941 | Ga0065707_101789413 | 338 |
| 134 | 3300005336 | Ga0070680_100055293 | Ga0070680_1000552932 | 338 |
| 135 | 3300005337 | Ga0070682_100285419 | Ga0070682_1002854191 | 338 |
| 136 | 3300005340 | Ga0070689_100184195 | Ga0070689_1001841952 | 338 |
| 137 | 3300005353 | Ga0070669_100128804 | Ga0070669_1001288042 | 338 |
| 138 | 3300005355 | Ga0070671_100459590 | Ga0070671_1004595901 | 338 |
| 139 | 3300005356 | Ga0070674_100006914 | Ga0070674_1000069145 | 338 |
| 140 | 3300005364 | Ga0070673_100238003 | Ga0070673_1002380032 | 338 |
| 141 | 3300005434 | Ga0070709_10175854 | Ga0070709_101758542 | 338 |
| 142 | 3300005435 | Ga0070714_100395389 | Ga0070714_1003953891 | 338 |
| 143 | 3300005438 | Ga0070701_10161942 | Ga0070701_101619422 | 338 |
| 144 | 3300005439 | Ga0070711_100152925 | Ga0070711_1001529252 | 338 |
| 145 | 3300005456 | Ga0070678_100027690 | Ga0070678_1000276901 | 338 |
| 146 | 3300005457 | Ga0070662_100212641 | Ga0070662_1002126411 | 338 |
| 147 | 3300005457 | Ga0070662_100238911 | Ga0070662_1002389111 | 338 |
| 148 | 3300005471 | Ga0070698_100033791 | Ga0070698_1000337914 | 338 |
| 149 | 3300005471 | Ga0070698_100073930 | Ga0070698_1000739302 | 338 |
| 150 | 3300005518 | Ga0070699_100144157 | Ga0070699_1001441571 | 338 |
| 151 | 3300005530 | Ga0070679_100310157 | Ga0070679_1003101572 | 338 |
| 152 | 3300005535 | Ga0070684_100033476 | Ga0070684_1000334768 | 338 |
| 153 | 3300005536 | Ga0070697_100194021 | Ga0070697_1001940212 | 338 |
| 154 | 3300005536 | Ga0070697_100291569 | Ga0070697_1002915692 | 338 |
| 155 | 3300005536 | Ga0070697_100382304 | Ga0070697_1003823041 | 338 |
| 156 | 3300005544 | Ga0070686_100040398 | Ga0070686_1000403983 | 338 |
| 157 | 3300005548 | Ga0070665_100158593 | Ga0070665_1001585932 | 338 |
| 158 | 3300005548 | Ga0070665_100294652 | Ga0070665_1002946521 | 338 |
| 159 | 3300005563 | Ga0068855_100456035 | Ga0068855_1004560352 | 338 |
| 160 | 3300005563 | Ga0068855_100512900 | Ga0068855_1005129001 | 338 |
| 161 | 3300005577 | Ga0068857_100355303 | Ga0068857_1003553032 | 338 |
| 162 | 3300005578 | Ga0068854_100323812 | Ga0068854_1003238122 | 338 |
| 163 | 3300005937 | Ga0081455_10014335 | Ga0081455_1001433511 | 338 |
| 164 | 3300005983 | Ga0081540_1033526 | Ga0081540_10335262 | 338 |
| 165 | 3300005983 | Ga0081540_1040307 | Ga0081540_10403072 | 338 |
| 166 | 3300005983 | Ga0081540_1041311 | Ga0081540_10413112 | 338 |
| 167 | 3300005983 | Ga0081540_1082365 | Ga0081540_10823651 | 338 |
| 168 | 3300006028 | Ga0070717_10224909 | Ga0070717_102249092 | 338 |
| 169 | 3300006028 | Ga0070717_10404536 | Ga0070717_104045361 | 338 |
| 170 | 3300006163 | Ga0070715_10123177 | Ga0070715_101231772 | 338 |
| 171 | 3300006173 | Ga0070716_100274903 | Ga0070716_1002749031 | 338 |
| 172 | 3300006175 | Ga0070712_100058334 | Ga0070712_1000583341 | 338 |
| 173 | 3300006175 | Ga0070712_100100390 | Ga0070712_1001003902 | 338 |
| 174 | 3300006175 | Ga0070712_100177728 | Ga0070712_1001777282 | 338 |
| 175 | 3300006178 | Ga0075367_10120923 | Ga0075367_101209232 | 338 |
| 176 | 3300006353 | Ga0075370_10027168 | Ga0075370_100271684 | 338 |
| 177 | 3300006353 | Ga0075370_10062569 | Ga0075370_100625694 | 338 |
| 178 | 3300006844 | Ga0075428_100633553 | Ga0075428_1006335531 | 338 |
| 179 | 3300006852 | Ga0075433_10355910 | Ga0075433_103559101 | 338 |
| 180 | 3300006871 | Ga0075434_100039981 | Ga0075434_1000399816 | 338 |
| 181 | 3300006871 | Ga0075434_100159796 | Ga0075434_1001597962 | 338 |
| 182 | 3300006871 | Ga0075434_100483891 | Ga0075434_1004838912 | 338 |
| 183 | 3300006880 | Ga0075429_100270138 | Ga0075429_1002701382 | 338 |
| 184 | 3300007076 | Ga0075435_100195807 | Ga0075435_1001958073 | 338 |
| 185 | 3300007076 | Ga0075435_100356281 | Ga0075435_1003562812 | 338 |
| 186 | 3300007076 | Ga0075435_100382229 | Ga0075435_1003822291 | 338 |
| 187 | 3300007265 | Ga0099794_10011896 | Ga0099794_100118965 | 338 |
| 188 | 3300007265 | Ga0099794_10013270 | Ga0099794_100132703 | 338 |
| 189 | 3300007265 | Ga0099794_10038054 | Ga0099794_100380542 | 338 |
| 190 | 3300007265 | Ga0099794_10058587 | Ga0099794_100585871 | 338 |
| 191 | 3300007265 | Ga0099794_10072712 | Ga0099794_100727122 | 338 |
| 192 | 3300007265 | Ga0099794_10080885 | Ga0099794_100808852 | 338 |
| 193 | 3300007265 | Ga0099794_10092704 | Ga0099794_100927042 | 338 |
| 194 | 3300007265 | Ga0099794_10095549 | Ga0099794_100955492 | 338 |
| 195 | 3300007265 | Ga0099794_10174144 | Ga0099794_101741441 | 338 |
| 196 | 3300007788 | Ga0099795_10104998 | Ga0099795_101049981 | 338 |
| 197 | 3300009094 | Ga0111539_10121097 | Ga0111539_101210974 | 338 |
| 198 | 3300009094 | Ga0111539_10173897 | Ga0111539_101738974 | 338 |
| 199 | 3300009098 | Ga0105245_10073651 | Ga0105245_100736516 | 338 |
| 200 | 3300009098 | Ga0105245_10195961 | Ga0105245_101959612 | 338 |
| 201 | 3300009147 | Ga0114129_10344990 | Ga0114129_103449902 | 338 |
| 202 | 3300009147 | Ga0114129_10602825 | Ga0114129_106028252 | 338 |
| 203 | 3300009147 | Ga0114129_10634097 | Ga0114129_106340971 | 338 |
| 204 | 3300009147 | Ga0114129_10658298 | Ga0114129_106582981 | 338 |
| 205 | 3300009176 | Ga0105242_10055557 | Ga0105242_100555575 | 338 |
| 206 | 3300009177 | Ga0105248_10336017 | Ga0105248_103360173 | 338 |
| 207 | 3300009545 | Ga0105237_10094405 | Ga0105237_100944052 | 338 |
| 208 | 3300010159 | Ga0099796_10038610 | Ga0099796_100386102 | 338 |
| 209 | 3300010159 | Ga0099796_10051904 | Ga0099796_100519041 | 338 |
| 210 | 3300010375 | Ga0105239_10048089 | Ga0105239_100480894 | 338 |
| 211 | 3300010375 | Ga0105239_10729686 | Ga0105239_107296861 | 338 |
| 212 | 3300011119 | Ga0105246_10178858 | Ga0105246_101788582 | 338 |
| 213 | 3300013105 | Ga0157369_10100114 | Ga0157369_101001141 | 338 |
| 214 | 3300013297 | Ga0157378_10024798 | Ga0157378_100247984 | 338 |
| 215 | 3300013297 | Ga0157378_10158706 | Ga0157378_101587062 | 338 |
| 216 | 3300013306 | Ga0163162_10261939 | Ga0163162_102619392 | 338 |
| 217 | 3300013306 | Ga0163162_10585704 | Ga0163162_105857041 | 338 |
| 218 | 3300013307 | Ga0157372_10113214 | Ga0157372_101132143 | 338 |
| 219 | 3300013307 | Ga0157372_10528733 | Ga0157372_105287331 | 338 |
| 220 | 3300013308 | Ga0157375_10344735 | Ga0157375_103447351 | 338 |
| 221 | 3300013308 | Ga0157375_10707667 | Ga0157375_107076671 | 338 |
| 222 | 3300014326 | Ga0157380_10061114 | Ga0157380_100611141 | 338 |
| 223 | 3300017792 | Ga0163161_10085734 | Ga0163161_100857343 | 338 |
| 224 | 3300025315 | Ga0207697_10070033 | Ga0207697_100700331 | 338 |
| 225 | 3300025315 | Ga0207697_10097541 | Ga0207697_100975412 | 338 |
| 226 | 3300025893 | Ga0207682_10027016 | Ga0207682_100270162 | 338 |
| 227 | 3300025901 | Ga0207688_10080129 | Ga0207688_100801292 | 338 |
| 228 | 3300025904 | Ga0207647_10143267 | Ga0207647_101432672 | 338 |
| 229 | 3300025912 | Ga0207707_10017385 | Ga0207707_100173852 | 338 |
| 230 | 3300025912 | Ga0207707_10035499 | Ga0207707_100354992 | 338 |
| 231 | 3300025915 | Ga0207693_10177076 | Ga0207693_101770762 | 338 |
| 232 | 3300025915 | Ga0207693_10218422 | Ga0207693_102184221 | 338 |
| 233 | 3300025915 | Ga0207693_10244758 | Ga0207693_102447581 | 338 |
| 234 | 3300025917 | Ga0207660_10236374 | Ga0207660_102363741 | 338 |
| 235 | 3300025919 | Ga0207657_10224035 | Ga0207657_102240351 | 338 |
| 236 | 3300025922 | Ga0207646_10314384 | Ga0207646_103143842 | 338 |
| 237 | 3300025922 | Ga0207646_10530717 | Ga0207646_105307171 | 338 |
| 238 | 3300025927 | Ga0207687_10179764 | Ga0207687_101797642 | 338 |
| 239 | 3300025928 | Ga0207700_10244962 | Ga0207700_102449621 | 338 |
| 240 | 3300025928 | Ga0207700_10268744 | Ga0207700_102687442 | 338 |
| 241 | 3300025928 | Ga0207700_10288286 | Ga0207700_102882862 | 338 |
| 242 | 3300025929 | Ga0207664_10387079 | Ga0207664_103870792 | 338 |
| 243 | 3300025933 | Ga0207706_10014873 | Ga0207706_100148737 | 338 |
| 244 | 3300025933 | Ga0207706_10175572 | Ga0207706_101755721 | 338 |
| 245 | 3300025934 | Ga0207686_10173282 | Ga0207686_101732821 | 338 |
| 246 | 3300025935 | Ga0207709_10005054 | Ga0207709_1000505410 | 338 |
| 247 | 3300025935 | Ga0207709_10007671 | Ga0207709_100076712 | 338 |
| 248 | 3300025935 | Ga0207709_10020993 | Ga0207709_100209932 | 338 |
| 249 | 3300025936 | Ga0207670_10291853 | Ga0207670_102918532 | 338 |
| 250 | 3300025937 | Ga0207669_10002860 | Ga0207669_100028605 | 338 |
| 251 | 3300025939 | Ga0207665_10037645 | Ga0207665_100376453 | 338 |
| 252 | 3300025939 | Ga0207665_10261634 | Ga0207665_102616342 | 338 |
| 253 | 3300025939 | Ga0207665_10352011 | Ga0207665_103520111 | 338 |
| 254 | 3300025942 | Ga0207689_10208925 | Ga0207689_102089252 | 338 |
| 255 | 3300025944 | Ga0207661_10007954 | Ga0207661_100079548 | 338 |
| 256 | 3300025949 | Ga0207667_10575151 | Ga0207667_105751511 | 338 |
| 257 | 3300025972 | Ga0207668_10007464 | Ga0207668_100074642 | 338 |
| 258 | 3300025972 | Ga0207668_10010818 | Ga0207668_100108181 | 338 |
| 259 | 3300025972 | Ga0207668_10282310 | Ga0207668_102823101 | 338 |
| 260 | 3300026023 | Ga0207677_10125961 | Ga0207677_101259612 | 338 |
| 261 | 3300026067 | Ga0207678_10022793 | Ga0207678_100227937 | 338 |
| 262 | 3300026075 | Ga0207708_10037969 | Ga0207708_100379692 | 338 |
| 263 | 3300026075 | Ga0207708_10052588 | Ga0207708_100525881 | 338 |
| 264 | 3300026075 | Ga0207708_10220672 | Ga0207708_102206722 | 338 |
| 265 | 3300026078 | Ga0207702_10077359 | Ga0207702_100773591 | 338 |
| 266 | 3300026089 | Ga0207648_10044679 | Ga0207648_100446792 | 338 |
| 267 | 3300026089 | Ga0207648_10093497 | Ga0207648_100934974 | 338 |
| 268 | 3300026095 | Ga0207676_10415061 | Ga0207676_104150611 | 338 |
| 269 | 3300026116 | Ga0207674_10200689 | Ga0207674_102006892 | 338 |
| 270 | 3300027671 | Ga0209588_1000839 | Ga0209588_10008391 | 338 |
| 271 | 3300027671 | Ga0209588_1004780 | Ga0209588_10047803 | 338 |
| 272 | 3300027671 | Ga0209588_1010574 | Ga0209588_10105743 | 338 |
| 273 | 3300027671 | Ga0209588_1014661 | Ga0209588_10146613 | 338 |
| 274 | 3300027671 | Ga0209588_1025016 | Ga0209588_10250162 | 338 |
| 275 | 3300027671 | Ga0209588_1026754 | Ga0209588_10267542 | 338 |
| 276 | 3300027671 | Ga0209588_1047209 | Ga0209588_10472092 | 338 |
| 277 | 3300027671 | Ga0209588_1054491 | Ga0209588_10544911 | 338 |
| 278 | 3300027671 | Ga0209588_1054925 | Ga0209588_10549251 | 338 |
| 279 | 3300027907 | Ga0207428_10014418 | Ga0207428_100144186 | 338 |
| 280 | 3300027907 | Ga0207428_10177116 | Ga0207428_101771163 | 338 |
| 281 | 3300027907 | Ga0207428_10298225 | Ga0207428_102982251 | 338 |
| 282 | 3300028379 | Ga0268266_10068382 | Ga0268266_100683823 | 338 |
| 283 | 3300028379 | Ga0268266_10073315 | Ga0268266_100733152 | 338 |
| 284 | 3300028379 | Ga0268266_10285020 | Ga0268266_102850201 | 338 |
| 285 | 3300028380 | Ga0268265_10142550 | Ga0268265_101425501 | 338 |
| 286 | 3300028794 | Ga0307515_10208768 | Ga0307515_102087682 | 338 |
| 287 | 3300031344 | Ga0265316_10076463 | Ga0265316_100764631 | 338 |
| 288 | 3300031456 | Ga0307513_10395825 | Ga0307513_103958251 | 338 |
| 289 | 3300031507 | Ga0307509_10342757 | Ga0307509_103427572 | 338 |
| 290 | 3300034819 | Ga0373958_0020619 | Ga0373958_0020619_34_1050 | 338 |
| 291 | 3300035083 | Ga0373926_0038432 | Ga0373926_0038432_85_1101 | 338 |
| 292 | 3300035083 | Ga0373926_0093330 | Ga0373926_0093330_66_1082 | 338 |
| 293 | 3300035086 | Ga0373934_0063382 | Ga0373934_0063382_104_1120 | 338 |
| 294 | 3300035089 | Ga0373944_0072751 | Ga0373944_0072751_88_1104 | 338 |
| 295 | 3300035111 | Ga0373923_0045529 | Ga0373923_0045529_775_1791 | 338 |
| 296 | 3300035112 | Ga0373932_0024998 | Ga0373932_0024998_173_1189 | 338 |
| 297 | 3300035113 | Ga0373936_0031374 | Ga0373936_0031374_940_1956 | 338 |
| 298 | 3300035116 | Ga0373945_0093841 | Ga0373945_0093841_86_1102 | 338 |
| 299 | 3300035117 | Ga0373953_0073813 | Ga0373953_0073813_318_1337 | 338 |
| 300 | 3300035117 | Ga0373953_0077776 | Ga0373953_0077776_40_1056 | 338 |
| 301 | 3300035120 | Ga0373957_0061810 | Ga0373957_0061810_384_1403 | 338 |
| 302 | 3300035121 | Ga0373960_0038520 | Ga0373960_0038520_145_1161 | 338 |
| 303 | 3300035170 | Ga0373943_0059039 | Ga0373943_0059039_750_1766 | 338 |
| 304 | 3300035170 | Ga0373943_0127320 | Ga0373943_0127320_66_1082 | 338 |
| 305 | 3300035170 | Ga0373943_0138870 | Ga0373943_0138870_66_1082 | 338 |
| 306 | 3300035171 | Ga0373946_0049256 | Ga0373946_0049256_196_1212 | 338 |
| 307 | 3300035171 | Ga0373946_0112970 | Ga0373946_0112970_74_1090 | 338 |
| 308 | 3300035171 | Ga0373946_0128549 | Ga0373946_0128549_20_1039 | 338 |
| 309 | 3300035171 | Ga0373946_0136927 | Ga0373946_0136927_33_1049 | 338 |
| 310 | 3300035172 | Ga0373955_0160540 | Ga0373955_0160540_258_1274 | 338 |
| 311 | 3300035398 | Ga0316574_0253779 | Ga0316574_0253779_13_1029 | 338 |
| 312 | 3300035410 | Ga0373924_0096536 | Ga0373924_0096536_76_1092 | 338 |
| 313 | 3300035692 | Ga0373935_0041759 | Ga0373935_0041759_1786_2802 | 338 |
| 314 | 3300035692 | Ga0373935_0268894 | Ga0373935_0268894_157_1173 | 338 |
| 315 | 3300035692 | Ga0373935_0273967 | Ga0373935_0273967_22_1038 | 338 |
| 316 | 3300035695 | Ga0373927_0081952 | Ga0373927_0081952_1015_2031 | 338 |
| 317 | 3300035695 | Ga0373927_0116219 | Ga0373927_0116219_28_1044 | 338 |
| 318 | 3300035695 | Ga0373927_0201967 | Ga0373927_0201967_116_1132 | 338 |
| 319 | 3300035695 | Ga0373927_0240176 | Ga0373927_0240176_135_1151 | 338 |
| 320 | 3300035695 | Ga0373927_0254047 | Ga0373927_0254047_56_1072 | 338 |
| 321 | 3300035725 | Ga0373947_0077007 | Ga0373947_0077007_645_1661 | 338 |
| 322 | 3300035725 | Ga0373947_0156182 | Ga0373947_0156182_418_1434 | 338 |
| 323 | 3300035725 | Ga0373947_0180126 | Ga0373947_0180126_22_1038 | 338 |
| 324 | 3300036401 | Ga0373937_0309312 | Ga0373937_0309312_14_1030 | 338 |
| 325 | 3300036712 | Ga0316584_0176137 | Ga0316584_0176137_104_1120 | 338 |
| 326 | 3300036712 | Ga0316584_0259499 | Ga0316584_0259499_177_1193 | 338 |
| 327 | 3300037068 | Ga0373925_0267129 | Ga0373925_0267129_100_1116 | 338 |
| 328 | 3300037068 | Ga0373925_0311534 | Ga0373925_0311534_79_1095 | 338 |
| 329 | 3300037068 | Ga0373925_0344861 | Ga0373925_0344861_66_1082 | 338 |
| 330 | 3300037068 | Ga0373925_0361165 | Ga0373925_0361165_96_1112 | 338 |
| 331 | 3300037418 | Ga0395900_0484981 | Ga0395900_0484981_69_1085 | 338 |
| 332 | 3300037466 | Ga0395898_0163199 | Ga0395898_0163199_318_1334 | 338 |
| 333 | 3300037466 | Ga0395898_0347721 | Ga0395898_0347721_290_1306 | 338 |
| 334 | 3300037471 | Ga0395905_0026897 | Ga0395905_0026897_2164_3180 | 338 |
| 335 | 3300038443 | Ga0395901_0361853 | Ga0395901_0361853_226_1242 | 338 |
| 336 | 3300039450 | Ga0436363_0485272 | Ga0436363_0485272_541_1557 | 338 |
| 337 | 3300046452 | Ga0495617_074576 | Ga0495617_074576_73_1089 | 338 |
| 338 | 3300046453 | Ga0495627_060597 | Ga0495627_060597_83_1099 | 338 |
| 339 | 3300046454 | Ga0495592_0187825 | Ga0495592_0187825_72_1088 | 338 |
| 340 | 3300046454 | Ga0495592_0238893 | Ga0495592_0238893_99_1118 | 338 |
| 341 | 3300046455 | Ga0495603_0119159 | Ga0495603_0119159_478_1494 | 338 |
| 342 | 3300046455 | Ga0495603_0133432 | Ga0495603_0133432_156_1175 | 338 |
| 343 | 3300046455 | Ga0495603_0141862 | Ga0495603_0141862_96_1112 | 338 |
| 344 | 3300046455 | Ga0495603_0160673 | Ga0495603_0160673_94_1110 | 338 |
| 345 | 3300046458 | Ga0495591_036672 | Ga0495591_036672_345_1361 | 338 |
| 346 | 3300046459 | Ga0495629_0004237 | Ga0495629_0004237_4490_5584 | 338 |
| 347 | 3300046459 | Ga0495629_0073142 | Ga0495629_0073142_16_1032 | 338 |
| 348 | 3300046459 | Ga0495629_0082590 | Ga0495629_0082590_725_1741 | 338 |
| 349 | 3300046459 | Ga0495629_0146164 | Ga0495629_0146164_421_1437 | 338 |
| 350 | 3300046459 | Ga0495629_0157377 | Ga0495629_0157377_447_1463 | 338 |
| 351 | 3300046459 | Ga0495629_0249513 | Ga0495629_0249513_111_1127 | 338 |
| 352 | 3300046460 | Ga0495638_0014421 | Ga0495638_0014421_1224_2369 | 338 |
| 353 | 3300046460 | Ga0495638_0161045 | Ga0495638_0161045_182_1198 | 338 |
| 354 | 3300046460 | Ga0495638_0190636 | Ga0495638_0190636_63_1079 | 338 |
| 355 | 3300046461 | Ga0495641_0058864 | Ga0495641_0058864_267_1283 | 338 |
| 356 | 3300046461 | Ga0495641_0090077 | Ga0495641_0090077_232_1248 | 338 |
| 357 | 3300046462 | Ga0495651_0078359 | Ga0495651_0078359_641_1657 | 338 |
| 358 | 3300046462 | Ga0495651_0162172 | Ga0495651_0162172_361_1377 | 338 |
| 359 | 3300046463 | Ga0495653_0156423 | Ga0495653_0156423_90_1106 | 338 |
| 360 | 3300046463 | Ga0495653_0242487 | Ga0495653_0242487_167_1183 | 338 |
| 361 | 3300046472 | Ga0495580_0025348 | Ga0495580_0025348_16_1032 | 338 |
| 362 | 3300046472 | Ga0495580_0165213 | Ga0495580_0165213_435_1451 | 338 |
| 363 | 3300046472 | Ga0495580_0202690 | Ga0495580_0202690_325_1341 | 338 |
| 364 | 3300046473 | Ga0495582_0058808 | Ga0495582_0058808_631_1647 | 338 |
| 365 | 3300046473 | Ga0495582_0135421 | Ga0495582_0135421_319_1335 | 338 |
| 366 | 3300046474 | Ga0495605_0112683 | Ga0495605_0112683_105_1121 | 338 |
| 367 | 3300046475 | Ga0495639_0008895 | Ga0495639_0008895_158_1174 | 338 |
| 368 | 3300046475 | Ga0495639_0070974 | Ga0495639_0070974_74_1090 | 338 |
| 369 | 3300046475 | Ga0495639_0106957 | Ga0495639_0106957_91_1110 | 338 |
| 370 | 3300046475 | Ga0495639_0117288 | Ga0495639_0117288_217_1233 | 338 |
| 371 | 3300046476 | Ga0495662_0082679 | Ga0495662_0082679_523_1539 | 338 |
| 372 | 3300046476 | Ga0495662_0101186 | Ga0495662_0101186_75_1091 | 338 |
| 373 | 3300046476 | Ga0495662_0121454 | Ga0495662_0121454_242_1258 | 338 |
| 374 | 3300046477 | Ga0495664_0021043 | Ga0495664_0021043_2627_3643 | 338 |
| 375 | 3300046491 | Ga0495584_0152244 | Ga0495584_0152244_28_1044 | 338 |
| 376 | 3300046491 | Ga0495584_0176940 | Ga0495584_0176940_43_1059 | 338 |
| 377 | 3300046492 | Ga0495585_0027336 | Ga0495585_0027336_1027_2043 | 338 |
| 378 | 3300046492 | Ga0495585_0173635 | Ga0495585_0173635_84_1100 | 338 |
| 379 | 3300046492 | Ga0495585_0174464 | Ga0495585_0174464_23_1039 | 338 |
| 380 | 3300046499 | Ga0495594_0013372 | Ga0495594_0013372_111_1127 | 338 |
| 381 | 3300046499 | Ga0495594_0082948 | Ga0495594_0082948_712_1728 | 338 |
| 382 | 3300046500 | Ga0495596_0086701 | Ga0495596_0086701_22_1038 | 338 |
| 383 | 3300046500 | Ga0495596_0097783 | Ga0495596_0097783_60_1076 | 338 |
| 384 | 3300046501 | Ga0495607_0015350 | Ga0495607_0015350_85_1101 | 338 |
| 385 | 3300046501 | Ga0495607_0122586 | Ga0495607_0122586_325_1341 | 338 |
| 386 | 3300046501 | Ga0495607_0134176 | Ga0495607_0134176_100_1116 | 338 |
| 387 | 3300046506 | Ga0495583_0103653 | Ga0495583_0103653_68_1084 | 338 |
| 388 | 3300046506 | Ga0495583_0123580 | Ga0495583_0123580_41_1057 | 338 |
| 389 | 3300046511 | Ga0495608_0091155 | Ga0495608_0091155_339_1355 | 338 |
| 390 | 3300046511 | Ga0495608_0186368 | Ga0495608_0186368_74_1090 | 338 |
| 391 | 3300046511 | Ga0495608_0213139 | Ga0495608_0213139_73_1089 | 338 |
| 392 | 3300046513 | Ga0495616_0088193 | Ga0495616_0088193_385_1458 | 338 |
| 393 | 3300046513 | Ga0495616_0127267 | Ga0495616_0127267_66_1082 | 338 |
| 394 | 3300046514 | Ga0495618_0024958 | Ga0495618_0024958_2231_3247 | 338 |
| 395 | 3300046514 | Ga0495618_0087827 | Ga0495618_0087827_793_1809 | 338 |
| 396 | 3300046514 | Ga0495618_0211521 | Ga0495618_0211521_66_1082 | 338 |
| 397 | 3300046516 | Ga0495628_0054182 | Ga0495628_0054182_1138_2154 | 338 |
| 398 | 3300046516 | Ga0495628_0290194 | Ga0495628_0290194_164_1180 | 338 |
| 399 | 3300046517 | Ga0495630_0041005 | Ga0495630_0041005_2116_3132 | 338 |
| 400 | 3300046517 | Ga0495630_0057984 | Ga0495630_0057984_564_1658 | 338 |
| 401 | 3300046517 | Ga0495630_0216053 | Ga0495630_0216053_113_1129 | 338 |
| 402 | 3300046517 | Ga0495630_0216905 | Ga0495630_0216905_322_1338 | 338 |
| 403 | 3300046518 | Ga0495631_0084058 | Ga0495631_0084058_139_1155 | 338 |
| 404 | 3300046518 | Ga0495631_0108513 | Ga0495631_0108513_147_1163 | 338 |
| 405 | 3300046519 | Ga0495632_0083287 | Ga0495632_0083287_50_1066 | 338 |
| 406 | 3300046520 | Ga0495637_0069275 | Ga0495637_0069275_353_1369 | 338 |
| 407 | 3300046523 | Ga0495644_0043801 | Ga0495644_0043801_78_1094 | 338 |
| 408 | 3300046524 | Ga0495648_0004418 | Ga0495648_0004418_4690_5706 | 338 |
| 409 | 3300046525 | Ga0495663_0036090 | Ga0495663_0036090_230_1246 | 338 |
| 410 | 3300046526 | Ga0495666_0082341 | Ga0495666_0082341_402_1418 | 338 |
| 411 | 3300046526 | Ga0495666_0097733 | Ga0495666_0097733_116_1132 | 338 |
| 412 | 3300046526 | Ga0495666_0106305 | Ga0495666_0106305_197_1216 | 338 |
| 413 | 3300046526 | Ga0495666_0149659 | Ga0495666_0149659_27_1043 | 338 |
| 414 | 3300046528 | Ga0495642_0064983 | Ga0495642_0064983_110_1126 | 338 |
| 415 | 3300046529 | Ga0495652_0035625 | Ga0495652_0035625_2564_3580 | 338 |
| 416 | 3300046529 | Ga0495652_0133199 | Ga0495652_0133199_310_1326 | 338 |
| 417 | 3300046529 | Ga0495652_0188648 | Ga0495652_0188648_327_1343 | 338 |
| 418 | 3300046531 | Ga0495665_0047525 | Ga0495665_0047525_802_1818 | 338 |
| 419 | 3300046531 | Ga0495665_0122018 | Ga0495665_0122018_281_1297 | 338 |
| 420 | 3300046531 | Ga0495665_0144613 | Ga0495665_0144613_99_1115 | 338 |
| 421 | 3300046531 | Ga0495665_0175787 | Ga0495665_0175787_60_1079 | 338 |
| 422 | 3300046533 | Ga0495640_0008012 | Ga0495640_0008012_3175_4191 | 338 |
| 423 | 3300046533 | Ga0495640_0008012 | Ga0495640_0008012_6645_7661 | 338 |
| 424 | 3300046533 | Ga0495640_0021997 | Ga0495640_0021997_2996_4012 | 338 |
| 425 | 3300046533 | Ga0495640_0058231 | Ga0495640_0058231_1529_2545 | 338 |
| 426 | 3300046533 | Ga0495640_0190358 | Ga0495640_0190358_191_1207 | 338 |
| 427 | 3300046536 | Ga0495587_0210579 | Ga0495587_0210579_60_1076 | 338 |
| 428 | 3300046537 | Ga0495598_0060587 | Ga0495598_0060587_25_1041 | 338 |
| 429 | 3300046537 | Ga0495598_0065922 | Ga0495598_0065922_69_1085 | 338 |
| 430 | 3300046538 | Ga0495609_0117205 | Ga0495609_0117205_19_1035 | 338 |
| 431 | 3300046539 | Ga0495621_0004372 | Ga0495621_0004372_143_1159 | 338 |
| 432 | 3300046539 | Ga0495621_0075840 | Ga0495621_0075840_179_1195 | 338 |
| 433 | 3300046543 | Ga0495645_0050635 | Ga0495645_0050635_1536_2552 | 338 |
| 434 | 3300046543 | Ga0495645_0061730 | Ga0495645_0061730_1589_2605 | 338 |
| 435 | 3300046543 | Ga0495645_0074561 | Ga0495645_0074561_766_1782 | 338 |
| 436 | 3300046543 | Ga0495645_0135985 | Ga0495645_0135985_266_1282 | 338 |
| 437 | 3300046557 | Ga0495622_0120882 | Ga0495622_0120882_136_1152 | 338 |
| 438 | 3300046557 | Ga0495622_0130942 | Ga0495622_0130942_73_1089 | 338 |
| 439 | 3300046558 | Ga0495633_0025442 | Ga0495633_0025442_870_1886 | 338 |
| 440 | 3300046558 | Ga0495633_0141424 | Ga0495633_0141424_64_1080 | 338 |
| 441 | 3300046559 | Ga0495667_0041057 | Ga0495667_0041057_781_1797 | 338 |
| 442 | 3300046559 | Ga0495667_0220199 | Ga0495667_0220199_151_1167 | 338 |
| 443 | 3300046559 | Ga0495667_0231282 | Ga0495667_0231282_77_1093 | 338 |
| 444 | 3300046615 | Ga0495656_0057716 | Ga0495656_0057716_65_1081 | 338 |
| 445 | 3300046615 | Ga0495656_0148078 | Ga0495656_0148078_47_1063 | 338 |
| 446 | 3300046616 | Ga0495668_0117054 | Ga0495668_0117054_321_1337 | 338 |
| 447 | 3300046616 | Ga0495668_0166725 | Ga0495668_0166725_71_1132 | 338 |
| 448 | 3300046642 | Ga0495634_0025225 | Ga0495634_0025225_2523_3539 | 338 |
| 449 | 3300046642 | Ga0495634_0078630 | Ga0495634_0078630_899_1915 | 338 |
| 450 | 3300046642 | Ga0495634_0141277 | Ga0495634_0141277_451_1467 | 338 |
| 451 | 3300046642 | Ga0495634_0158960 | Ga0495634_0158960_79_1095 | 338 |
| 452 | 3300046642 | Ga0495634_0232867 | Ga0495634_0232867_34_1050 | 338 |
| 453 | 3300046648 | Ga0495611_0013870 | Ga0495611_0013870_1525_2670 | 338 |
| 454 | 3300046648 | Ga0495611_0062750 | Ga0495611_0062750_601_1617 | 338 |
| 455 | 3300046648 | Ga0495611_0089965 | Ga0495611_0089965_258_1274 | 338 |
| 456 | 3300046648 | Ga0495611_0130403 | Ga0495611_0130403_83_1099 | 338 |
| 457 | 3300046660 | Ga0495625_0065503 | Ga0495625_0065503_240_1256 | 338 |
| 458 | 3300046660 | Ga0495625_0139363 | Ga0495625_0139363_566_1582 | 338 |
| 459 | 3300046663 | Ga0495635_0011879 | Ga0495635_0011879_2820_3836 | 338 |
| 460 | 3300046663 | Ga0495635_0078839 | Ga0495635_0078839_57_1073 | 338 |
| 461 | 3300046663 | Ga0495635_0221023 | Ga0495635_0221023_125_1141 | 338 |
| 462 | 3300046663 | Ga0495635_0272330 | Ga0495635_0272330_85_1101 | 338 |
| 463 | 3300046664 | Ga0495659_0019386 | Ga0495659_0019386_105_1121 | 338 |
| 464 | 3300046664 | Ga0495659_0086026 | Ga0495659_0086026_139_1155 | 338 |
| 465 | 3300046664 | Ga0495659_0098246 | Ga0495659_0098246_35_1051 | 338 |
| 466 | 3300046665 | Ga0495661_0151047 | Ga0495661_0151047_63_1079 | 338 |
| 467 | 3300046665 | Ga0495661_0166490 | Ga0495661_0166490_111_1127 | 338 |
| 468 | 3300046674 | Ga0495588_0086187 | Ga0495588_0086187_614_1630 | 338 |
| 469 | 3300046674 | Ga0495588_0159078 | Ga0495588_0159078_57_1076 | 338 |
| 470 | 3300046674 | Ga0495588_0186985 | Ga0495588_0186985_52_1068 | 338 |
| 471 | 3300046678 | Ga0495599_0024320 | Ga0495599_0024320_2470_3486 | 338 |
| 472 | 3300046678 | Ga0495599_0159112 | Ga0495599_0159112_272_1288 | 338 |
| 473 | 3300046678 | Ga0495599_0252334 | Ga0495599_0252334_25_1041 | 338 |
| 474 | 3300046679 | Ga0495623_0005531 | Ga0495623_0005531_6989_8005 | 338 |
| 475 | 3300046679 | Ga0495623_0031085 | Ga0495623_0031085_2356_3372 | 338 |
| 476 | 3300046680 | Ga0495646_0032769 | Ga0495646_0032769_114_1130 | 338 |
| 477 | 3300046680 | Ga0495646_0041132 | Ga0495646_0041132_1031_2047 | 338 |
| 478 | 3300046680 | Ga0495646_0148516 | Ga0495646_0148516_264_1280 | 338 |
| 479 | 3300046680 | Ga0495646_0166899 | Ga0495646_0166899_175_1194 | 338 |
| 480 | 3300046681 | Ga0495647_0013274 | Ga0495647_0013274_668_1684 | 338 |
| 481 | 3300046681 | Ga0495647_0113117 | Ga0495647_0113117_90_1106 | 338 |
| 482 | 3300046683 | Ga0495658_0085258 | Ga0495658_0085258_32_1048 | 338 |
| 483 | 3300046683 | Ga0495658_0100444 | Ga0495658_0100444_422_1438 | 338 |
| 484 | 3300046683 | Ga0495658_0210574 | Ga0495658_0210574_21_1037 | 338 |
| 485 | 3300046683 | Ga0495658_0227487 | Ga0495658_0227487_71_1087 | 338 |
| 486 | 3300046684 | Ga0495669_0064956 | Ga0495669_0064956_107_1123 | 338 |
| 487 | 3300046689 | Ga0495613_0196079 | Ga0495613_0196079_385_1401 | 338 |
| 488 | 3300046689 | Ga0495613_0239980 | Ga0495613_0239980_70_1086 | 338 |
| 489 | 3300046689 | Ga0495613_0248263 | Ga0495613_0248263_55_1074 | 338 |
| 490 | 3300046690 | Ga0495624_0016238 | Ga0495624_0016238_2472_3488 | 338 |
| 491 | 3300046690 | Ga0495624_0114269 | Ga0495624_0114269_107_1123 | 338 |
| 492 | 3300046691 | Ga0495670_0012957 | Ga0495670_0012957_106_1122 | 338 |
| 493 | 3300046691 | Ga0495670_0031741 | Ga0495670_0031741_1575_2591 | 338 |
| 494 | 3300046691 | Ga0495670_0040461 | Ga0495670_0040461_55_1071 | 338 |
| 495 | 3300046692 | Ga0495671_0138235 | Ga0495671_0138235_38_1054 | 338 |
| 496 | 3300046694 | Ga0495649_0139111 | Ga0495649_0139111_41_1057 | 338 |
| 497 | 3300046694 | Ga0495649_0184436 | Ga0495649_0184436_26_1042 | 338 |
| 498 | 3300046794 | Ga0495589_0037538 | Ga0495589_0037538_1043_2059 | 338 |
| 499 | 3300046794 | Ga0495589_0123250 | Ga0495589_0123250_81_1097 | 338 |
| 500 | 3300046809 | Ga0495600_0009456 | Ga0495600_0009456_4989_6005 | 338 |
| 501 | 3300046809 | Ga0495600_0011988 | Ga0495600_0011988_3876_4892 | 338 |
| 502 | 3300046809 | Ga0495600_0145110 | Ga0495600_0145110_54_1070 | 338 |
| 503 | 3300047315 | Ga0495581_0120638 | Ga0495581_0120638_470_1486 | 338 |
| 504 | 3300047315 | Ga0495581_0177679 | Ga0495581_0177679_52_1068 | 338 |
| 505 | 3300047315 | Ga0495581_0216899 | Ga0495581_0216899_30_1046 | 338 |
| 506 | 3300047317 | Ga0495604_0258833 | Ga0495604_0258833_83_1102 | 338 |
| 507 | 3300047318 | Ga0495636_0053005 | Ga0495636_0053005_397_1413 | 338 |
| 508 | 3300047318 | Ga0495636_0117256 | Ga0495636_0117256_136_1152 | 338 |
| 509 | 3300047319 | Ga0495674_0020337 | Ga0495674_0020337_865_1881 | 338 |
| 510 | 3300047319 | Ga0495674_0129008 | Ga0495674_0129008_1071_2087 | 338 |
| 511 | 3300047319 | Ga0495674_0178856 | Ga0495674_0178856_343_1359 | 338 |
| 512 | 3300047319 | Ga0495674_0402632 | Ga0495674_0402632_66_1082 | 338 |
| 513 | 3300047320 | Ga0495672_0011148 | Ga0495672_0011148_4651_5667 | 338 |
| 514 | 3300047320 | Ga0495672_0075654 | Ga0495672_0075654_677_1822 | 338 |
| 515 | 3300047321 | Ga0495676_0012818 | Ga0495676_0012818_57_1073 | 338 |
| 516 | 3300047321 | Ga0495676_0184616 | Ga0495676_0184616_266_1282 | 338 |
| 517 | 3300047321 | Ga0495676_0244657 | Ga0495676_0244657_31_1047 | 338 |
| 518 | 3300047321 | Ga0495676_0263212 | Ga0495676_0263212_35_1051 | 338 |
| 519 | 3300047321 | Ga0495676_0266566 | Ga0495676_0266566_22_1038 | 338 |
| 520 | 3300047322 | Ga0495680_0076721 | Ga0495680_0076721_202_1218 | 338 |
| 521 | 3300047322 | Ga0495680_0227980 | Ga0495680_0227980_30_1046 | 338 |
| 522 | 3300047323 | Ga0495683_0109824 | Ga0495683_0109824_284_1300 | 338 |
| 523 | 3300047444 | Ga0495675_0213751 | Ga0495675_0213751_76_1092 | 338 |
| 524 | 3300047445 | Ga0495677_0093115 | Ga0495677_0093115_46_1062 | 338 |
| 525 | 3300047446 | Ga0495679_030355 | Ga0495679_030355_377_1393 | 338 |
| 526 | 3300047446 | Ga0495679_040438 | Ga0495679_040438_405_1421 | 338 |
| 527 | 3300047447 | Ga0495685_050698 | Ga0495685_050698_160_1176 | 338 |
| 528 | 3300047469 | Ga0495673_0057275 | Ga0495673_0057275_344_1360 | 338 |
| 529 | 3300047470 | Ga0495681_0085708 | Ga0495681_0085708_312_1328 | 338 |
| 530 | 3300047471 | Ga0495684_0011170 | Ga0495684_0011170_2279_3295 | 338 |
| 531 | 3300047471 | Ga0495684_0011170 | Ga0495684_0011170_5749_6765 | 338 |
| 532 | 3300047471 | Ga0495684_0024291 | Ga0495684_0024291_3370_4386 | 338 |
| 533 | 3300047471 | Ga0495684_0226812 | Ga0495684_0226812_62_1078 | 338 |
| 534 | 3300047472 | Ga0495686_0110207 | Ga0495686_0110207_435_1451 | 338 |
| 535 | 3300047673 | Ga0495593_0017246 | Ga0495593_0017246_2150_3166 | 338 |
| 536 | 3300047673 | Ga0495593_0159859 | Ga0495593_0159859_94_1110 | 338 |
| 537 | 3300047673 | Ga0495593_0160358 | Ga0495593_0160358_76_1092 | 338 |
| 538 | 3300048088 | Ga0495602_0067537 | Ga0495602_0067537_1774_2790 | 338 |
| 539 | 3300048090 | Ga0495615_0032145 | Ga0495615_0032145_112_1128 | 338 |
| 540 | 3300048904 | Ga0496101_0276821 | Ga0496101_0276821_262_1278 | 338 |
| 541 | 3300048905 | Ga0496102_0473808 | Ga0496102_0473808_28_1044 | 338 |
| 542 | 3300048907 | Ga0496104_0326366 | Ga0496104_0326366_338_1354 | 338 |
| 543 | 3300048907 | Ga0496104_0368405 | Ga0496104_0368405_315_1331 | 338 |
| 544 | 3300048908 | Ga0496105_0290349 | Ga0496105_0290349_79_1095 | 338 |
| 545 | 3300048909 | Ga0496106_0356153 | Ga0496106_0356153_56_1072 | 338 |
| 546 | 3300048910 | Ga0496107_0259124 | Ga0496107_0259124_72_1088 | 338 |
| 547 | 3300048912 | Ga0496109_0233534 | Ga0496109_0233534_44_1060 | 338 |
| 548 | 3300048912 | Ga0496109_0481646 | Ga0496109_0481646_86_1102 | 338 |
| 549 | 3300048915 | Ga0496112_0458281 | Ga0496112_0458281_167_1183 | 338 |
| 550 | 3300048916 | Ga0496113_0322447 | Ga0496113_0322447_128_1144 | 338 |
| 551 | 3300048918 | Ga0496115_0351258 | Ga0496115_0351258_43_1059 | 338 |
| 552 | 3300048924 | Ga0496121_0209843 | Ga0496121_0209843_216_1232 | 338 |
| 553 | 3300048929 | Ga0496126_0017981 | Ga0496126_0017981_3149_4165 | 338 |
| 554 | 3300048929 | Ga0496126_0018102 | Ga0496126_0018102_1074_2090 | 338 |
| 555 | 3300049460 | Ga0495682_0017855 | Ga0495682_0017855_654_1799 | 338 |
| 556 | 3300050494 | nmdc:mga06z11_89660_c1 | nmdc:mga06z11_89660_c1_123_1139 | 338 |
| 557 | 3300050507 | nmdc:mga05p37_112454_c1 | nmdc:mga05p37_112454_c1_116_1132 | 338 |
| 558 | 3300050507 | nmdc:mga05p37_123381_c1 | nmdc:mga05p37_123381_c1_155_1171 | 338 |
| 559 | 3300050507 | nmdc:mga05p37_14284_c1 | nmdc:mga05p37_14284_c1_1473_2489 | 338 |
| 560 | 3300050507 | nmdc:mga05p37_146065_c1 | nmdc:mga05p37_146065_c1_1828_2847 | 338 |
| 561 | 3300050507 | nmdc:mga05p37_17548_c1 | nmdc:mga05p37_17548_c1_6711_7727 | 338 |
| 562 | 3300050507 | nmdc:mga05p37_437098_c1 | nmdc:mga05p37_437098_c1_163_1179 | 338 |
| 563 | 3300050507 | nmdc:mga05p37_49656_c1 | nmdc:mga05p37_49656_c1_3988_5004 | 338 |
| 564 | 3300050507 | nmdc:mga05p37_595796_c1 | nmdc:mga05p37_595796_c1_144_1160 | 338 |
| 565 | 3300050507 | nmdc:mga05p37_728489_c1 | nmdc:mga05p37_728489_c1_33_1049 | 338 |
| 566 | 3300050508 | nmdc:mga09592_208552_c1 | nmdc:mga09592_208552_c1_404_1420 | 338 |
| 567 | 3300050508 | nmdc:mga09592_36353_c1 | nmdc:mga09592_36353_c1_127_1143 | 338 |
| 568 | 3300050509 | nmdc:mga0qj67_360557_c1 | nmdc:mga0qj67_360557_c1_136_1152 | 338 |
| 569 | 3300050509 | nmdc:mga0qj67_8436_c1 | nmdc:mga0qj67_8436_c1_981_1997 | 338 |
| 570 | 3300050510 | nmdc:mga06r32_185010_c1 | nmdc:mga06r32_185010_c1_872_1888 | 338 |
| 571 | 3300050510 | nmdc:mga06r32_446199_c1 | nmdc:mga06r32_446199_c1_17_1033 | 338 |
| 572 | 3300050510 | nmdc:mga06r32_470308_c1 | nmdc:mga06r32_470308_c1_144_1160 | 338 |
| 573 | 3300050510 | nmdc:mga06r32_84544_c1 | nmdc:mga06r32_84544_c1_35_1051 | 338 |
| 574 | 3300050511 | nmdc:mga08y16_203101_c1 | nmdc:mga08y16_203101_c1_797_1813 | 338 |
| 575 | 3300050511 | nmdc:mga08y16_3173_c1 | nmdc:mga08y16_3173_c1_15984_17000 | 338 |
| 576 | 3300050511 | nmdc:mga08y16_35747_c1 | nmdc:mga08y16_35747_c1_3323_4339 | 338 |
| 577 | 3300050511 | nmdc:mga08y16_384793_c1 | nmdc:mga08y16_384793_c1_307_1323 | 338 |
| 578 | 3300050511 | nmdc:mga08y16_48876_c1 | nmdc:mga08y16_48876_c1_3052_4068 | 338 |
| 579 | 3300050512 | nmdc:mga0n895_212286_c1 | nmdc:mga0n895_212286_c1_143_1159 | 338 |
| 580 | 3300050512 | nmdc:mga0n895_244118_c1 | nmdc:mga0n895_244118_c1_80_1096 | 338 |
| 581 | 3300050512 | nmdc:mga0n895_43428_c1 | nmdc:mga0n895_43428_c1_169_1185 | 338 |
| 582 | 3300050512 | nmdc:mga0n895_45830_c1 | nmdc:mga0n895_45830_c1_72_1088 | 338 |
| 583 | 3300050512 | nmdc:mga0n895_472588_c1 | nmdc:mga0n895_472588_c1_73_1089 | 338 |
| 584 | 3300050513 | nmdc:mga0rr50_21931_c1 | nmdc:mga0rr50_21931_c1_104_1120 | 338 |
| 585 | 3300050513 | nmdc:mga0rr50_268197_c1 | nmdc:mga0rr50_268197_c1_347_1363 | 338 |
| 586 | 3300050513 | nmdc:mga0rr50_385129_c1 | nmdc:mga0rr50_385129_c1_116_1132 | 338 |
| 587 | 3300050515 | nmdc:mga0a205_217821_c1 | nmdc:mga0a205_217821_c1_672_1688 | 338 |
| 588 | 3300050515 | nmdc:mga0a205_232891_c1 | nmdc:mga0a205_232891_c1_45_1061 | 338 |
| 589 | 3300050515 | nmdc:mga0a205_386752_c1 | nmdc:mga0a205_386752_c1_130_1149 | 338 |
| 590 | 3300053077 | Ga0495601_0023857 | Ga0495601_0023857_2247_3263 | 338 |
| 591 | 3300053077 | Ga0495601_0041306 | Ga0495601_0041306_20_1036 | 338 |
| 592 | 3300053077 | Ga0495601_0077238 | Ga0495601_0077238_17_1033 | 338 |
| 593 | 3300053077 | Ga0495601_0158363 | Ga0495601_0158363_51_1067 | 338 |
| 594 | 3300053077 | Ga0495601_0210708 | Ga0495601_0210708_220_1236 | 338 |
| 595 | 3300053078 | Ga0495612_0002936 | Ga0495612_0002936_2550_3566 | 338 |
| 596 | 3300053078 | Ga0495612_0046030 | Ga0495612_0046030_273_1289 | 338 |
| 597 | 3300053083 | Ga0495655_0011717 | Ga0495655_0011717_207_1223 | 338 |
| 598 | 3300053083 | Ga0495655_0030035 | Ga0495655_0030035_271_1287 | 338 |
| 599 | 3300053083 | Ga0495655_0033692 | Ga0495655_0033692_98_1114 | 338 |
| 600 | 3300053084 | Ga0495595_0102350 | Ga0495595_0102350_75_1091 | 338 |
| 601 | 3300053084 | Ga0495595_0108675 | Ga0495595_0108675_257_1273 | 338 |
| 602 | 3300053084 | Ga0495595_0140993 | Ga0495595_0140993_78_1094 | 338 |
| 603 | 3300053085 | Ga0495619_0001546 | Ga0495619_0001546_3807_4823 | 338 |
| 604 | 3300053085 | Ga0495619_0028063 | Ga0495619_0028063_2413_3429 | 338 |
| 605 | 3300053085 | Ga0495619_0028657 | Ga0495619_0028657_2482_3498 | 338 |
| 606 | 3300053085 | Ga0495619_0035955 | Ga0495619_0035955_87_1103 | 338 |
| 607 | 3300053093 | Ga0500651_0000666 | Ga0500651_0000666_4126_5271 | 338 |
| 608 | 3300053134 | Ga0500658_0000628 | Ga0500658_0000628_5630_6775 | 338 |
| 609 | 3300053139 | Ga0500568_0003547 | Ga0500568_0003547_482_1498 | 338 |
| 610 | 3300053142 | Ga0500577_0040697 | Ga0500577_0040697_62_1207 | 338 |
| 611 | 3300053158 | Ga0500627_0003802 | Ga0500627_0003802_2198_3343 | 338 |
| 612 | 3300053161 | Ga0500634_0013459 | Ga0500634_0013459_701_1846 | 338 |
| 613 | 3300053728 | Ga0500657_104062 | Ga0500657_104062_25_1041 | 338 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar