F469215

General Info

Members Datasets Scaffolds Average Seq Length
613 327 1226 180

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10038904|rootH2_100389042
Length 211
Sequence VRAAKRDPRLKAEAATEWPDRMRLSCDFARVMRKAACLSVLLLALVAMPGLAQAQTGFDRRGSDYSKFEVKSGDPAVCAARCERDSRCRAWAFSYPRTENSAAICWLKNKVTGCTEATCCVSGVRGAGVIEPTRGPIEYSIDRVGGDYRSFDLPNPDPEGAPCRAACEGENRCRAWTYVRPGYSGTAARCNLKAKLTPPRKKPCCISGVVR

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
112 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
113 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
187 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
191 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
198 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
202 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
203 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
228 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
250 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
251 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
285 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
291 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
292 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
293 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
294 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
295 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
298 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
299 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
301 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
302 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
311 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
314 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
315 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
318 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
319 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
320 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
321 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
322 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
323 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
324 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
325 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
326 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
327 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.61
Nodule 0
Rhizoplane 11.09
Rhizosphere 85.32
Stem 0
Stem Tuber 0
Unclassified 10.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10038904 3300003320 Bacteria 1007
2 RicEn_FSXC4353_g1 2010549000 Bacteria 839
3 JGI24742J22300_10057319 3300002244 Bacteria 712
4 JGI25405J52794_10000695 3300003911 Bacteria 5108
5 Ga0065712_10022848 3300005290 Bacteria 1564
6 Ga0065707_10142933 3300005295 Bacteria 1749
7 Ga0070658_10091084 3300005327 Bacteria 2513
8 Ga0070676_10092327 3300005328 Bacteria 1856
9 Ga0070676_10324665 3300005328 Bacteria 1051
10 Ga0070683_100492925 3300005329 Bacteria 1170
11 Ga0070690_100046447 3300005330 Bacteria 2761
12 Ga0070690_100058818 3300005330 Bacteria 2469
13 Ga0070690_100384719 3300005330 Unclassified 1026
14 Ga0070670_100088143 3300005331 Bacteria 2667
15 Ga0070670_100654359 3300005331 Bacteria 943
16 Ga0070677_10127431 3300005333 Bacteria 1157
17 Ga0068869_101403392 3300005334 Bacteria 618
18 Ga0070666_10016802 3300005335 Bacteria 4686
19 Ga0070666_10121297 3300005335 Bacteria 1813
20 Ga0070680_100002046 3300005336 Bacteria 14868
21 Ga0070682_100223179 3300005337 Bacteria 1342
22 Ga0070682_100575689 3300005337 Bacteria 885
23 Ga0068868_100310826 3300005338 Bacteria 1341
24 Ga0070660_100216912 3300005339 Bacteria 1554
25 Ga0070660_100267935 3300005339 Unclassified 1395
26 Ga0070689_100025126 3300005340 Bacteria 4474
27 Ga0070689_100046662 3300005340 Bacteria 3339
28 Ga0070689_100245255 3300005340 Bacteria 1477
29 Ga0070691_10410769 3300005341 Bacteria 765
30 Ga0070687_100183634 3300005343 Bacteria 1255
31 Ga0070661_100013570 3300005344 Bacteria 5720
32 Ga0070668_100153252 3300005347 Bacteria 1865
33 Ga0070668_100295674 3300005347 Bacteria 1357
34 Ga0070669_100332392 3300005353 Bacteria 1229
35 Ga0070675_100609117 3300005354 Bacteria 991
36 Ga0070671_100027065 3300005355 Bacteria 4717
37 Ga0070671_101274453 3300005355 Unclassified 648
38 Ga0070674_100014390 3300005356 Bacteria 4921
39 Ga0070674_100229238 3300005356 Bacteria 1449
40 Ga0070673_100059374 3300005364 Bacteria 3027
41 Ga0070673_100084637 3300005364 Bacteria 2579
42 Ga0070673_100607848 3300005364 Bacteria 998
43 Ga0070688_100061794 3300005365 Bacteria 2369
44 Ga0070688_100089283 3300005365 Bacteria 2011
45 Ga0070659_100060493 3300005366 Bacteria 2992
46 Ga0070667_100267987 3300005367 Bacteria 1531
47 Ga0070703_10037513 3300005406 Unclassified 1494
48 Ga0070709_10014374 3300005434 Bacteria 4477
49 Ga0070714_100301791 3300005435 Unclassified 1493
50 Ga0070713_100008992 3300005436 Bacteria 7120
51 Ga0070713_100050100 3300005436 Bacteria 3448
52 Ga0070713_100222008 3300005436 Bacteria 1714
53 Ga0070710_10007324 3300005437 Bacteria 5338
54 Ga0070701_10219250 3300005438 Bacteria 1134
55 Ga0070701_10399874 3300005438 Bacteria 870
56 Ga0070705_100128762 3300005440 Bacteria 1648
57 Ga0070700_100407865 3300005441 Bacteria 1024
58 Ga0070694_100240556 3300005444 Unclassified 1365
59 Ga0070708_100024579 3300005445 Bacteria 5142
60 Ga0070708_100510329 3300005445 Bacteria 1134
61 Ga0070663_100140246 3300005455 Bacteria 1845
62 Ga0070663_100343701 3300005455 Bacteria 1206
63 Ga0070678_100032207 3300005456 Bacteria 3626
64 Ga0070678_100366154 3300005456 Bacteria 1243
65 Ga0070678_100978729 3300005456 Bacteria 777
66 Ga0070681_10006973 3300005458 Bacteria 10994
67 Ga0070681_10087027 3300005458 Bacteria 3077
68 Ga0070681_10250828 3300005458 Bacteria 1683
69 Ga0070681_10842553 3300005458 Bacteria 834
70 Ga0068867_100113052 3300005459 Bacteria 2088
71 Ga0068867_100350472 3300005459 Bacteria 1232
72 Ga0070685_10027705 3300005466 Bacteria 3134
73 Ga0070685_10094869 3300005466 Bacteria 1812
74 Ga0070706_100867349 3300005467 Unclassified 834
75 Ga0070707_100057665 3300005468 Bacteria 3725
76 Ga0070698_100081190 3300005471 Bacteria 3237
77 Ga0070699_100001130 3300005518 Bacteria 24873
78 Ga0070679_100134808 3300005530 Bacteria 2450
79 Ga0070679_100254445 3300005530 Unclassified 1712
80 Ga0070679_100605241 3300005530 Bacteria 1039
81 Ga0070684_100097704 3300005535 Bacteria 2619
82 Ga0070672_100235557 3300005543 Bacteria 1539
83 Ga0070672_100540335 3300005543 Bacteria 1011
84 Ga0070686_100096661 3300005544 Bacteria 1986
85 Ga0070686_100172013 3300005544 Bacteria 1533
86 Ga0070686_100294229 3300005544 Unclassified 1202
87 Ga0070686_100326504 3300005544 Bacteria 1146
88 Ga0070695_100215970 3300005545 Bacteria 1379
89 Ga0070693_100203594 3300005547 Bacteria 1287
90 Ga0070693_100209043 3300005547 Bacteria 1272
91 Ga0070665_101124859 3300005548 Bacteria 797
92 Ga0070704_100046381 3300005549 Bacteria 3030
93 Ga0068855_100558831 3300005563 Unclassified 1238
94 Ga0070664_100123518 3300005564 Bacteria 2269
95 Ga0068857_100584932 3300005577 Bacteria 1054
96 Ga0068856_100260143 3300005614 Bacteria 1751
97 Ga0070702_100120821 3300005615 Bacteria 1640
98 Ga0070702_100178656 3300005615 Bacteria 1387
99 Ga0070702_100598943 3300005615 Unclassified 826
100 Ga0068859_100211320 3300005617 Bacteria 2027
101 Ga0068864_100077013 3300005618 Bacteria 2916
102 Ga0068866_10530156 3300005718 Bacteria 784
103 Ga0068861_100041334 3300005719 Bacteria 3453
104 Ga0068861_100847115 3300005719 Bacteria 862
105 Ga0068861_101816544 3300005719 Unclassified 605
106 Ga0068870_10267891 3300005840 Bacteria 1066
107 Ga0068863_100274054 3300005841 Bacteria 1634
108 Ga0068858_100544856 3300005842 Bacteria 1123
109 Ga0068860_100182669 3300005843 Bacteria 2027
110 Ga0068862_100891428 3300005844 Bacteria 874
111 Ga0081455_10004196 3300005937 Bacteria 16242
112 Ga0081455_10010083 3300005937 Bacteria 9640
113 Ga0081455_10017150 3300005937 Bacteria 6955
114 Ga0081455_10059641 3300005937 Bacteria 3221
115 Ga0081455_10145553 3300005937 Bacteria 1834
116 Ga0081455_10149523 3300005937 Bacteria 1802
117 Ga0081538_10002850 3300005981 Bacteria 16534
118 Ga0081538_10020233 3300005981 Bacteria 4911
119 Ga0081540_1011356 3300005983 Bacteria 5957
120 Ga0081540_1083862 3300005983 Bacteria 1424
121 Ga0070717_10013260 3300006028 Bacteria 6308
122 Ga0075365_10031107 3300006038 Bacteria 3422
123 Ga0075365_10883304 3300006038 Bacteria 630
124 Ga0075364_10231418 3300006051 Unclassified 1255
125 Ga0075432_10001992 3300006058 Bacteria 6782
126 Ga0070715_10033157 3300006163 Bacteria 2109
127 Ga0070715_10538258 3300006163 Unclassified 675
128 Ga0070716_100021666 3300006173 Bacteria 3389
129 Ga0070716_100296703 3300006173 Unclassified 1122
130 Ga0070712_100320371 3300006175 Bacteria 1260
131 Ga0075367_10139845 3300006178 Bacteria 1500
132 Ga0075369_10185928 3300006186 Bacteria 957
133 Ga0097621_100107458 3300006237 Bacteria 2354
134 Ga0068871_100791628 3300006358 Bacteria 873
135 Ga0075428_100003294 3300006844 Bacteria 17662
136 Ga0075428_100048016 3300006844 Bacteria 4687
137 Ga0075428_100196978 3300006844 Bacteria 2179
138 Ga0075430_100002812 3300006846 Bacteria 14556
139 Ga0075430_100543028 3300006846 Unclassified 959
140 Ga0075431_100003875 3300006847 Bacteria 14556
141 Ga0075433_10000085 3300006852 Bacteria 42956
142 Ga0075433_10187890 3300006852 Bacteria 1838
143 Ga0075433_10291247 3300006852 Unclassified 1446
144 Ga0075434_100000251 3300006871 Bacteria 37702
145 Ga0075434_100113886 3300006871 Bacteria 2717
146 Ga0075434_101408620 3300006871 Bacteria 707
147 Ga0075429_100025713 3300006880 Bacteria 5112
148 Ga0075429_100149343 3300006880 Bacteria 2046
149 Ga0068865_100074913 3300006881 Bacteria 2412
150 Ga0075436_100178467 3300006914 Bacteria 1500
151 Ga0075436_100266329 3300006914 Bacteria 1223
152 Ga0075436_100396966 3300006914 Bacteria 999
153 Ga0075436_100793731 3300006914 Unclassified 705
154 Ga0097620_100211314 3300006931 Bacteria 2027
155 Ga0075435_100035098 3300007076 Bacteria 3978
156 Ga0075435_100058935 3300007076 Bacteria 3111
157 Ga0075435_100075631 3300007076 Bacteria 2758
158 Ga0075435_100243179 3300007076 Bacteria 1531
159 Ga0075435_100336349 3300007076 Bacteria 1293
160 Ga0099794_10037485 3300007265 Bacteria 2295
161 Ga0099794_10109201 3300007265 Bacteria 1385
162 Ga0105251_10019939 3300009011 Bacteria 3529
163 Ga0111539_10000250 3300009094 Bacteria 64548
164 Ga0111539_10092087 3300009094 Bacteria 3562
165 Ga0111539_10115108 3300009094 Bacteria 3154
166 Ga0111539_10398338 3300009094 Bacteria 1603
167 Ga0111539_10440436 3300009094 Bacteria 1517
168 Ga0111539_11016763 3300009094 Bacteria 964
169 Ga0111539_11939466 3300009094 Unclassified 683
170 Ga0105245_10122929 3300009098 Bacteria 2426
171 Ga0105245_10457062 3300009098 Bacteria 1286
172 Ga0105247_10087140 3300009101 Bacteria 1977
173 Ga0114129_10005184 3300009147 Bacteria 18351
174 Ga0114129_10006771 3300009147 Bacteria 16267
175 Ga0114129_10141575 3300009147 Bacteria 3296
176 Ga0114129_10143328 3300009147 Bacteria 3274
177 Ga0114129_10791556 3300009147 Bacteria 1210
178 Ga0114129_11476718 3300009147 Unclassified 836
179 Ga0114129_12544092 3300009147 Unclassified 611
180 Ga0105243_10041625 3300009148 Bacteria 3593
181 Ga0105243_10213872 3300009148 Bacteria 1699
182 Ga0105241_10025291 3300009174 Bacteria 4412
183 Ga0105241_10482535 3300009174 Bacteria 1102
184 Ga0105242_10239354 3300009176 Bacteria 1631
185 Ga0105242_11241568 3300009176 Bacteria 766
186 Ga0105248_10032144 3300009177 Bacteria 5865
187 Ga0105248_10225019 3300009177 Bacteria 2112
188 Ga0105248_11647920 3300009177 Bacteria 727
189 Ga0105237_10079301 3300009545 Bacteria 3273
190 Ga0105238_10034389 3300009551 Bacteria 5157
191 Ga0105238_10226493 3300009551 Bacteria 1846
192 Ga0105249_10173263 3300009553 Bacteria 2094
193 Ga0105249_10314593 3300009553 Bacteria 1575
194 Ga0105249_10493899 3300009553 Bacteria 1268
195 Ga0105246_10082067 3300011119 Bacteria 2300
196 Ga0105246_10113546 3300011119 Bacteria 1994
197 Ga0157336_1002923 3300012477 Bacteria 998
198 Ga0157335_1002134 3300012492 Bacteria 1165
199 Ga0157326_1008136 3300012513 Bacteria 1140
200 Ga0157373_10199232 3300013100 Bacteria 1411
201 Ga0157374_10206634 3300013296 Bacteria 1924
202 Ga0157374_10261433 3300013296 Bacteria 1705
203 Ga0157378_10612475 3300013297 Bacteria 1101
204 Ga0157378_11552217 3300013297 Unclassified 707
205 Ga0163162_10053933 3300013306 Bacteria 4042
206 Ga0163162_10083174 3300013306 Bacteria 3274
207 Ga0163162_10374216 3300013306 Bacteria 1558
208 Ga0163162_11264783 3300013306 Unclassified 838
209 Ga0157375_10138583 3300013308 Bacteria 2558
210 Ga0157375_10464351 3300013308 Bacteria 1431
211 Ga0157375_10528360 3300013308 Bacteria 1342
212 Ga0157375_10538509 3300013308 Bacteria 1330
213 Ga0157375_11072323 3300013308 Bacteria 942
214 Ga0163163_10320540 3300014325 Bacteria 1603
215 Ga0157380_10140213 3300014326 Bacteria 2076
216 Ga0157380_10899909 3300014326 Bacteria 911
217 Ga0157379_10442067 3300014968 Bacteria 1199
218 Ga0157379_10652862 3300014968 Bacteria 985
219 Ga0157379_10928097 3300014968 Bacteria 827
220 Ga0157376_10662174 3300014969 Bacteria 1045
221 Ga0163161_10134688 3300017792 Bacteria 1866
222 Ga0163161_10715060 3300017792 Bacteria 835
223 Ga0213872_10036375 3300021361 Bacteria 2250
224 Ga0213876_10135194 3300021384 Bacteria 1311
225 Ga0207697_10068439 3300025315 Bacteria 1485
226 Ga0207653_10079164 3300025885 Bacteria 1135
227 Ga0207688_10326661 3300025901 Bacteria 942
228 Ga0207685_10009903 3300025905 Bacteria 2789
229 Ga0207685_10383086 3300025905 Unclassified 717
230 Ga0207699_10023185 3300025906 Bacteria 3375
231 Ga0207645_10047199 3300025907 Bacteria 2750
232 Ga0207645_10095926 3300025907 Bacteria 1910
233 Ga0207654_10011268 3300025911 Bacteria 4558
234 Ga0207671_10055320 3300025914 Bacteria 2940
235 Ga0207693_10005210 3300025915 Bacteria 10887
236 Ga0207693_10277248 3300025915 Bacteria 1314
237 Ga0207660_10078483 3300025917 Bacteria 2419
238 Ga0207662_10041423 3300025918 Bacteria 2712
239 Ga0207662_10063606 3300025918 Bacteria 2219
240 Ga0207662_10353927 3300025918 Bacteria 987
241 Ga0207657_10104493 3300025919 Bacteria 2346
242 Ga0207657_10180513 3300025919 Bacteria 1706
243 Ga0207649_10067158 3300025920 Bacteria 2275
244 Ga0207652_10486737 3300025921 Bacteria 1111
245 Ga0207652_10504699 3300025921 Unclassified 1089
246 Ga0207646_10183694 3300025922 Unclassified 1889
247 Ga0207681_10190144 3300025923 Bacteria 1570
248 Ga0207694_10117623 3300025924 Bacteria 2119
249 Ga0207650_10108659 3300025925 Bacteria 2144
250 Ga0207650_10396968 3300025925 Bacteria 1141
251 Ga0207659_10097796 3300025926 Bacteria 2206
252 Ga0207700_10027894 3300025928 Bacteria 3960
253 Ga0207644_10001559 3300025931 Bacteria 14794
254 Ga0207644_10056707 3300025931 Bacteria 2827
255 Ga0207644_10417998 3300025931 Bacteria 1098
256 Ga0207644_11020624 3300025931 Bacteria 694
257 Ga0207686_10039471 3300025934 Bacteria 2865
258 Ga0207686_10452395 3300025934 Bacteria 988
259 Ga0207709_10085431 3300025935 Bacteria 2046
260 Ga0207709_10118234 3300025935 Bacteria 1785
261 Ga0207709_10178544 3300025935 Bacteria 1497
262 Ga0207670_10002470 3300025936 Bacteria 9703
263 Ga0207670_10236579 3300025936 Bacteria 1405
264 Ga0207670_10542495 3300025936 Bacteria 949
265 Ga0207669_10013358 3300025937 Bacteria 4075
266 Ga0207669_10745270 3300025937 Bacteria 808
267 Ga0207704_10126585 3300025938 Bacteria 1760
268 Ga0207704_10913494 3300025938 Bacteria 739
269 Ga0207665_10001895 3300025939 Bacteria 14095
270 Ga0207665_10417479 3300025939 Bacteria 1024
271 Ga0207691_10190615 3300025940 Bacteria 1788
272 Ga0207691_10556244 3300025940 Bacteria 972
273 Ga0207711_10014256 3300025941 Bacteria 6602
274 Ga0207689_10172219 3300025942 Bacteria 1785
275 Ga0207661_10660354 3300025944 Bacteria 961
276 Ga0207679_10468876 3300025945 Bacteria 1119
277 Ga0207667_10408258 3300025949 Unclassified 1383
278 Ga0207651_10048950 3300025960 Bacteria 2860
279 Ga0207651_10058020 3300025960 Bacteria 2673
280 Ga0207651_10195381 3300025960 Bacteria 1617
281 Ga0207651_10547624 3300025960 Bacteria 1006
282 Ga0207712_10300516 3300025961 Bacteria 1317
283 Ga0207712_10860294 3300025961 Bacteria 800
284 Ga0207668_10038731 3300025972 Bacteria 3203
285 Ga0207668_10386140 3300025972 Bacteria 1180
286 Ga0207668_10426792 3300025972 Bacteria 1126
287 Ga0207640_11021200 3300025981 Bacteria 728
288 Ga0207658_10518317 3300025986 Bacteria 1064
289 Ga0207658_10945459 3300025986 Bacteria 785
290 Ga0207703_10061935 3300026035 Bacteria 3065
291 Ga0207703_10074937 3300026035 Bacteria 2803
292 Ga0207678_10032429 3300026067 Bacteria 4552
293 Ga0207678_10390756 3300026067 Bacteria 1203
294 Ga0207708_10073016 3300026075 Bacteria 2629
295 Ga0207708_10199163 3300026075 Unclassified 1597
296 Ga0207702_10200580 3300026078 Bacteria 1849
297 Ga0207702_10291201 3300026078 Bacteria 1547
298 Ga0207641_10779911 3300026088 Bacteria 945
299 Ga0207648_10216167 3300026089 Bacteria 1702
300 Ga0207648_10555592 3300026089 Bacteria 1055
301 Ga0207676_10006064 3300026095 Bacteria 8528
302 Ga0207676_10062481 3300026095 Bacteria 2954
303 Ga0207675_100066724 3300026118 Bacteria 3363
304 Ga0207675_100407355 3300026118 Bacteria 1341
305 Ga0207675_100988755 3300026118 Bacteria 859
306 Ga0207683_10003110 3300026121 Bacteria 14500
307 Ga0207683_10013892 3300026121 Bacteria 6866
308 Ga0209179_1042549 3300027512 Bacteria 959
309 Ga0207428_10000111 3300027907 Bacteria 111333
310 Ga0207428_10412611 3300027907 Bacteria 988
311 Ga0268266_10021015 3300028379 Bacteria 5563
312 Ga0268266_10266585 3300028379 Bacteria 1589
313 Ga0265334_10103755 3300028573 Bacteria 1027
314 Ga0265338_10150530 3300028800 Bacteria 1808
315 Ga0265330_10103673 3300031235 Bacteria 1217
316 Ga0265332_10089912 3300031238 Bacteria 1299
317 Ga0265325_10000637 3300031241 Bacteria 25504
318 Ga0265325_10031519 3300031241 Unclassified 2836
319 Ga0265325_10282918 3300031241 Bacteria 743
320 Ga0265325_10329572 3300031241 Unclassified 677
321 Ga0265340_10006771 3300031247 Bacteria 6271
322 Ga0265340_10031547 3300031247 Bacteria 2649
323 Ga0265340_10077553 3300031247 Bacteria 1567
324 Ga0265339_10081073 3300031249 Bacteria 1715
325 Ga0265339_10182143 3300031249 Bacteria 1045
326 Ga0265339_10328234 3300031249 Unclassified 725
327 Ga0265339_10364265 3300031249 Bacteria 679
328 Ga0265316_10112488 3300031344 Bacteria 2061
329 Ga0265313_10043677 3300031595 Bacteria 2193
330 Ga0265342_10020960 3300031712 Bacteria 4180
331 Ga0265342_10082802 3300031712 Bacteria 1850
332 Ga0265342_10155344 3300031712 Bacteria 1268
333 Ga0265342_10514856 3300031712 Bacteria 609
334 Ga0373958_0020626 3300034819 Bacteria 1216
335 Ga0373938_0025038 3300034957 Bacteria 1239
336 Ga0373934_0159917 3300035086 Unclassified 924
337 Ga0373940_0006358 3300035088 Bacteria 2618
338 Ga0373940_0099958 3300035088 Bacteria 879
339 Ga0373944_0012444 3300035089 Bacteria 2345
340 Ga0373952_0020032 3300035092 Bacteria 1398
341 Ga0373952_0055377 3300035092 Bacteria 956
342 Ga0373932_0005832 3300035112 Bacteria 2901
343 Ga0373939_0002529 3300035114 Bacteria 4300
344 Ga0373939_0044395 3300035114 Bacteria 1353
345 Ga0373941_0010208 3300035115 Bacteria 2391
346 Ga0373945_0079861 3300035116 Unclassified 1251
347 Ga0373945_0414197 3300035116 Bacteria 592
348 Ga0373954_0088649 3300035118 Bacteria 1484
349 Ga0373957_0029417 3300035120 Bacteria 2007
350 Ga0373960_0023332 3300035121 Bacteria 1665
351 Ga0373960_0032637 3300035121 Bacteria 1463
352 Ga0373960_0136234 3300035121 Bacteria 828
353 Ga0373943_0004134 3300035170 Bacteria 6586
354 Ga0373946_0026442 3300035171 Bacteria 2289
355 Ga0373946_0109152 3300035171 Bacteria 1250
356 Ga0373942_0038016 3300035207 Bacteria 1303
357 Ga0373942_0074306 3300035207 Bacteria 998
358 Ga0373961_0137363 3300035241 Bacteria 823
359 Ga0373962_0076416 3300035242 Bacteria 1009
360 Ga0373924_0020958 3300035410 Bacteria 2546
361 Ga0373924_0103468 3300035410 Unclassified 1226
362 Ga0373931_0104126 3300035691 Bacteria 1600
363 Ga0373931_0201980 3300035691 Bacteria 1188
364 Ga0373931_0205593 3300035691 Bacteria 1178
365 Ga0373935_0004969 3300035692 Bacteria 7823
366 Ga0373935_0427721 3300035692 Bacteria 954
367 Ga0373935_0601799 3300035692 Bacteria 804
368 Ga0373927_0005207 3300035695 Bacteria 8994
369 Ga0373927_0066102 3300035695 Bacteria 2339
370 Ga0373927_0086953 3300035695 Bacteria 2029
371 Ga0373927_0317101 3300035695 Bacteria 1026
372 Ga0373947_0000702 3300035725 Bacteria 19933
373 Ga0373947_0236705 3300035725 Bacteria 1204
374 Ga0373947_0910287 3300035725 Unclassified 600
375 Ga0373937_0013397 3300036401 Bacteria 7222
376 Ga0373937_0239340 3300036401 Bacteria 1710
377 Ga0373937_0483417 3300036401 Bacteria 1176
378 Ga0373937_1041666 3300036401 Bacteria 767
379 Ga0373925_0005285 3300037068 Bacteria 9639
380 Ga0373925_0006553 3300037068 Bacteria 8560
381 Ga0373925_0067631 3300037068 Bacteria 2695
382 Ga0436364_0735467 3300037853 Unclassified 1185
383 Ga0436365_0303003 3300039437 Bacteria 610
384 Ga0436365_1342060 3300039437 Bacteria 3738
385 Ga0436361_0822087 3300039447 Bacteria 15373
386 Ga0436362_0872148 3300039453 Bacteria 1365
387 Ga0466961_0576872 3300044693 Bacteria 677
388 Ga0466963_0274944 3300044694 Unclassified 1183
389 Ga0466971_0173933 3300044719 Bacteria 1011
390 Ga0466958_0242601 3300045836 Unclassified 1151
391 Ga0466967_0094440 3300045976 Bacteria 2723
392 Ga0466967_0798886 3300045976 Bacteria 937
393 Ga0495603_0018129 3300046455 Bacteria 4258
394 Ga0495629_0001654 3300046459 Bacteria 17497
395 Ga0495638_0031157 3300046460 Bacteria 3428
396 Ga0495638_0061112 3300046460 Bacteria 2329
397 Ga0495580_0061307 3300046472 Bacteria 2641
398 Ga0495582_0004158 3300046473 Bacteria 8138
399 Ga0495582_0038790 3300046473 Bacteria 2621
400 Ga0495605_0235953 3300046474 Unclassified 786
401 Ga0495594_0039057 3300046499 Bacteria 2593
402 Ga0495594_0339200 3300046499 Bacteria 856
403 Ga0495607_0060116 3300046501 Bacteria 2164
404 Ga0495620_0125578 3300046515 Bacteria 1009
405 Ga0495628_0019124 3300046516 Bacteria 5665
406 Ga0495663_0027653 3300046525 Bacteria 1665
407 Ga0495663_0093836 3300046525 Bacteria 981
408 Ga0495652_0356055 3300046529 Unclassified 1047
409 Ga0495640_0364110 3300046533 Bacteria 891
410 Ga0495598_0004338 3300046537 Bacteria 3064
411 Ga0495598_0045351 3300046537 Unclassified 1302
412 Ga0495621_0008638 3300046539 Bacteria 3064
413 Ga0495645_0253098 3300046543 Unclassified 1170
414 Ga0495667_0125428 3300046559 Bacteria 1657
415 Ga0495656_0103115 3300046615 Bacteria 1322
416 Ga0495656_0179349 3300046615 Bacteria 1040
417 Ga0495668_0560984 3300046616 Unclassified 630
418 Ga0495588_0013125 3300046674 Bacteria 3938
419 Ga0495599_0202541 3300046678 Unclassified 1219
420 Ga0495599_0713757 3300046678 Bacteria 577
421 Ga0495646_0035520 3300046680 Bacteria 3091
422 Ga0495658_0003916 3300046683 Bacteria 7353
423 Ga0495613_0110644 3300046689 Bacteria 1979
424 Ga0495624_0283904 3300046690 Bacteria 999
425 Ga0495600_0381052 3300046809 Bacteria 880
426 Ga0495604_0058061 3300047317 Bacteria 2973
427 Ga0495674_0032799 3300047319 Bacteria 4707
428 Ga0495676_0044491 3300047321 Bacteria 3624
429 Ga0495676_0454826 3300047321 Bacteria 844
430 Ga0495680_0011680 3300047322 Bacteria 7757
431 Ga0495679_035907 3300047446 Bacteria 1568
432 Ga0495593_0020094 3300047673 Bacteria 3740
433 Ga0495602_0148818 3300048088 Bacteria 1843
434 Ga0495602_0180931 3300048088 Bacteria 1626
435 Ga0495615_0093390 3300048090 Unclassified 841
436 Ga0496100_0009764 3300048903 Bacteria 5402
437 Ga0496100_0048108 3300048903 Bacteria 2751
438 Ga0496100_0187157 3300048903 Bacteria 1501
439 Ga0496101_0010054 3300048904 Bacteria 6236
440 Ga0496101_0191955 3300048904 Bacteria 1576
441 Ga0496101_1019600 3300048904 Bacteria 651
442 Ga0496102_0022921 3300048905 Bacteria 5538
443 Ga0496102_0023824 3300048905 Bacteria 5439
444 Ga0496102_0113526 3300048905 Bacteria 2527
445 Ga0496102_0209474 3300048905 Bacteria 1838
446 Ga0496102_0629832 3300048905 Bacteria 996
447 Ga0496102_1208214 3300048905 Bacteria 675
448 Ga0496103_0005932 3300048906 Bacteria 7302
449 Ga0496103_0237833 3300048906 Bacteria 1171
450 Ga0496103_0473416 3300048906 Bacteria 802
451 Ga0496104_0003340 3300048907 Bacteria 13851
452 Ga0496104_0003588 3300048907 Bacteria 13403
453 Ga0496104_0033443 3300048907 Bacteria 4789
454 Ga0496104_0054818 3300048907 Bacteria 3768
455 Ga0496104_0240002 3300048907 Bacteria 1724
456 Ga0496104_0551448 3300048907 Bacteria 1063
457 Ga0496105_0004588 3300048908 Bacteria 10405
458 Ga0496105_0013332 3300048908 Bacteria 6523
459 Ga0496105_0052819 3300048908 Bacteria 3357
460 Ga0496105_0612995 3300048908 Bacteria 843
461 Ga0496106_0001837 3300048909 Bacteria 15900
462 Ga0496106_0018095 3300048909 Bacteria 5210
463 Ga0496106_0360077 3300048909 Bacteria 1168
464 Ga0496106_0646231 3300048909 Bacteria 845
465 Ga0496106_0769705 3300048909 Bacteria 765
466 Ga0496106_0907573 3300048909 Bacteria 695
467 Ga0496107_0000272 3300048910 Bacteria 27458
468 Ga0496107_0004871 3300048910 Bacteria 9120
469 Ga0496107_0302944 3300048910 Bacteria 1189
470 Ga0496107_0801414 3300048910 Bacteria 690
471 Ga0496108_0021105 3300048911 Bacteria 5351
472 Ga0496108_0022872 3300048911 Bacteria 5143
473 Ga0496108_0058700 3300048911 Bacteria 3235
474 Ga0496108_0072083 3300048911 Bacteria 2915
475 Ga0496108_0212544 3300048911 Bacteria 1679
476 Ga0496108_1270521 3300048911 Unclassified 620
477 Ga0496109_0007061 3300048912 Bacteria 9476
478 Ga0496109_0029689 3300048912 Bacteria 4898
479 Ga0496109_0138660 3300048912 Bacteria 2274
480 Ga0496110_0025000 3300048913 Bacteria 5098
481 Ga0496110_0028476 3300048913 Bacteria 4798
482 Ga0496110_0797668 3300048913 Unclassified 848
483 Ga0496110_0805812 3300048913 Bacteria 843
484 Ga0496111_0044823 3300048914 Bacteria 3179
485 Ga0496111_0106732 3300048914 Bacteria 2061
486 Ga0496111_0230546 3300048914 Bacteria 1375
487 Ga0496111_0420247 3300048914 Bacteria 987
488 Ga0496112_0089655 3300048915 Bacteria 3043
489 Ga0496112_0105482 3300048915 Bacteria 2788
490 Ga0496112_0682857 3300048915 Bacteria 955
491 Ga0496113_0010083 3300048916 Bacteria 6231
492 Ga0496113_0048327 3300048916 Bacteria 3165
493 Ga0496113_0402597 3300048916 Unclassified 1099
494 Ga0496113_0571367 3300048916 Bacteria 906
495 Ga0496114_0007484 3300048917 Bacteria 8632
496 Ga0496114_0026852 3300048917 Bacteria 4717
497 Ga0496114_0042701 3300048917 Bacteria 3758
498 Ga0496114_0605268 3300048917 Bacteria 966
499 Ga0496115_0003882 3300048918 Bacteria 10775
500 Ga0496115_0015338 3300048918 Bacteria 5810
501 Ga0496115_0029910 3300048918 Bacteria 4282
502 Ga0496115_0210873 3300048918 Bacteria 1604
503 Ga0496115_0886890 3300048918 Bacteria 688
504 Ga0501031_0034777 3300049568 Bacteria 3288
505 Ga0501031_0099284 3300049568 Bacteria 1900
506 Ga0501031_0309263 3300049568 Unclassified 1024
507 Ga0501032_0020015 3300049569 Bacteria 4668
508 Ga0501033_0020871 3300049570 Bacteria 4944
509 Ga0501034_0234366 3300049571 Bacteria 1783
510 Ga0501034_0330118 3300049571 Bacteria 1457
511 Ga0501034_0705059 3300049571 Bacteria 907
512 Ga0501036_0050920 3300049572 Bacteria 3506
513 Ga0501037_0058117 3300049573 Bacteria 2822
514 Ga0501038_0301133 3300049574 Bacteria 1258
515 Ga0501039_0230032 3300049575 Bacteria 1458
516 Ga0501041_0378324 3300049577 Unclassified 896
517 Ga0501041_0518164 3300049577 Unclassified 759
518 Ga0501042_0187772 3300049578 Bacteria 1491
519 Ga0501042_0321448 3300049578 Unclassified 1118
520 Ga0501043_0181321 3300049579 Bacteria 1640
521 Ga0501046_0077023 3300049580 Bacteria 2582
522 Ga0501046_0569294 3300049580 Bacteria 806
523 Ga0501047_0004229 3300049581 Bacteria 13514
524 Ga0501047_0954555 3300049581 Bacteria 671
525 Ga0501048_0031882 3300049582 Bacteria 3811
526 Ga0501067_0278886 3300049583 Bacteria 931
527 Ga0501068_0048245 3300049584 Bacteria 2570
528 Ga0501068_0223627 3300049584 Bacteria 1197
529 Ga0501069_0026819 3300049585 Bacteria 3156
530 Ga0501070_0164655 3300049586 Bacteria 1827
531 Ga0501070_0455778 3300049586 Bacteria 1031
532 Ga0501071_0088787 3300049587 Bacteria 2268
533 Ga0501072_0344870 3300049588 Unclassified 1183
534 Ga0501073_0018318 3300049589 Bacteria 5060
535 Ga0501073_0029078 3300049589 Bacteria 3948
536 Ga0501074_0011514 3300049590 Bacteria 6430
537 Ga0501075_0141457 3300049591 Bacteria 1834
538 Ga0501075_0641327 3300049591 Unclassified 810
539 Ga0501076_0261758 3300049592 Bacteria 1416
540 Ga0501076_0320112 3300049592 Unclassified 1272
541 Ga0501076_0899817 3300049592 Bacteria 730
542 Ga0501077_0563156 3300049593 Unclassified 731
543 Ga0501079_0022020 3300049741 Bacteria 4883
544 Ga0501079_0134340 3300049741 Bacteria 1926
545 Ga0501080_0072146 3300049742 Bacteria 3212
546 Ga0501081_0050584 3300049743 Bacteria 2863
547 Ga0501081_0203023 3300049743 Bacteria 1438
548 Ga0501083_0019363 3300049744 Bacteria 4742
549 Ga0501083_0044505 3300049744 Bacteria 3005
550 Ga0501044_0084433 3300049823 Bacteria 3209
551 Ga0501044_0163190 3300049823 Bacteria 2203
552 Ga0501044_0712996 3300049823 Unclassified 888
553 Ga0501045_0091601 3300049824 Bacteria 2247
554 nmdc:mga0yw44_139378_c1 3300050492 Bacteria 1575
555 nmdc:mga0yw44_8662_c1 3300050492 Bacteria 5085
556 nmdc:mga07m45_635796_c1 3300050496 Unclassified 615
557 nmdc:mga05p37_387936_c1 3300050507 Bacteria 1634
558 nmdc:mga05p37_59_c1 3300050507 Bacteria 95449
559 nmdc:mga05p37_76610_c1 3300050507 Bacteria 4117
560 nmdc:mga09592_131916_c1 3300050508 Bacteria 2150
561 nmdc:mga0qj67_101461_c1 3300050509 Bacteria 2320
562 nmdc:mga0qj67_339_c1 3300050509 Bacteria 32351
563 nmdc:mga0qj67_552741_c1 3300050509 Unclassified 923
564 nmdc:mga06r32_252_c1 3300050510 Bacteria 44145
565 nmdc:mga06r32_69305_c1 3300050510 Bacteria 3408
566 nmdc:mga08y16_781166_c1 3300050511 Bacteria 949
567 nmdc:mga08y16_95_c1 3300050511 Bacteria 74728
568 nmdc:mga0n895_1208385_c1 3300050512 Bacteria 730
569 nmdc:mga0n895_163927_c1 3300050512 Bacteria 2254
570 nmdc:mga0n895_32687_c1 3300050512 Bacteria 4995
571 nmdc:mga0n895_56_c1 3300050512 Bacteria 65877
572 nmdc:mga0n895_636214_c1 3300050512 Bacteria 1067
573 nmdc:mga0rr50_181501_c1 3300050513 Bacteria 1721
574 nmdc:mga0rr50_256052_c1 3300050513 Bacteria 1455
575 nmdc:mga0rr50_3585_c1 3300050513 Bacteria 8971
576 nmdc:mga08x19_108284_c1 3300050514 Bacteria 1851
577 nmdc:mga08x19_211536_c1 3300050514 Bacteria 1331
578 nmdc:mga08x19_664368_c1 3300050514 Unclassified 739
579 nmdc:mga0a205_144043_c2 3300050515 Bacteria 1637
580 nmdc:mga0a205_23_c1 3300050515 Bacteria 88424
581 nmdc:mga0a205_523344_c1 3300050515 Bacteria 1042
582 nmdc:mga0a205_81524_c1 3300050515 Bacteria 3125
583 Ga0495601_0037120 3300053077 Bacteria 3046
584 Ga0495601_0043790 3300053077 Bacteria 2811
585 Ga0495601_0113848 3300053077 Bacteria 1753
586 Ga0495601_0241930 3300053077 Bacteria 1178
587 Ga0495612_0032208 3300053078 Bacteria 2117
588 Ga0495612_0130711 3300053078 Bacteria 1084
589 Ga0500610_0077355 3300053079 Bacteria 1734
590 Ga0495595_0078114 3300053084 Bacteria 1573
591 Ga0495595_0087092 3300053084 Bacteria 1495
592 Ga0495595_0150200 3300053084 Bacteria 1146
593 Ga0495619_0000470 3300053085 Bacteria 27189
594 Ga0495619_0064546 3300053085 Bacteria 2441
595 Ga0495619_0160382 3300053085 Bacteria 1553
596 Ga0500651_0015106 3300053093 Bacteria 4735
597 Ga0500642_0194800 3300053130 Unclassified 944
598 Ga0500658_0071766 3300053134 Bacteria 1463
599 Ga0500604_0091087 3300053151 Unclassified 996
600 Ga0500627_0308350 3300053158 Bacteria 690
601 Ga0500609_009855 3300053731 Unclassified 1286
602 Ga0501084_0185261 3300054114 Bacteria 1757
603 Ga0501082_0078532 3300060353 Bacteria 2847
604 Ga0501082_0372974 3300060353 Bacteria 1245
605 Ga0501082_0440115 3300060353 Bacteria 1139
606 Ga0501082_0649481 3300060353 Unclassified 923
607 Ga0501082_0846864 3300060353 Bacteria 800
608 Ga0466962_0030777 3300061719 Bacteria 2570
609 Ga0530510_0132941 3300061734 Bacteria 1831
610 Ga0530510_0198984 3300061734 Unclassified 1488
611 Ga0530510_0580268 3300061734 Bacteria 852
612 Ga0530510_0670809 3300061734 Bacteria 790
613 2643758535 2643221547 Bacteria 4740017
614 rootH2_10038904
615 RicEn_FSXC4353_g1
616 JGI24742J22300_10057319
617 JGI25405J52794_10000695
618 Ga0065712_10022848
619 Ga0065707_10142933
620 Ga0070658_10091084
621 Ga0070676_10092327
622 Ga0070676_10324665
623 Ga0070683_100492925
624 Ga0070690_100046447
625 Ga0070690_100058818
626 Ga0070690_100384719
627 Ga0070670_100088143
628 Ga0070670_100654359
629 Ga0070677_10127431
630 Ga0068869_101403392
631 Ga0070666_10016802
632 Ga0070666_10121297
633 Ga0070680_100002046
634 Ga0070682_100223179
635 Ga0070682_100575689
636 Ga0068868_100310826
637 Ga0070660_100216912
638 Ga0070660_100267935
639 Ga0070689_100025126
640 Ga0070689_100046662
641 Ga0070689_100245255
642 Ga0070691_10410769
643 Ga0070687_100183634
644 Ga0070661_100013570
645 Ga0070668_100153252
646 Ga0070668_100295674
647 Ga0070669_100332392
648 Ga0070675_100609117
649 Ga0070671_100027065
650 Ga0070671_101274453
651 Ga0070674_100014390
652 Ga0070674_100229238
653 Ga0070673_100059374
654 Ga0070673_100084637
655 Ga0070673_100607848
656 Ga0070688_100061794
657 Ga0070688_100089283
658 Ga0070659_100060493
659 Ga0070667_100267987
660 Ga0070703_10037513
661 Ga0070709_10014374
662 Ga0070714_100301791
663 Ga0070713_100008992
664 Ga0070713_100050100
665 Ga0070713_100222008
666 Ga0070710_10007324
667 Ga0070701_10219250
668 Ga0070701_10399874
669 Ga0070705_100128762
670 Ga0070700_100407865
671 Ga0070694_100240556
672 Ga0070708_100024579
673 Ga0070708_100510329
674 Ga0070663_100140246
675 Ga0070663_100343701
676 Ga0070678_100032207
677 Ga0070678_100366154
678 Ga0070678_100978729
679 Ga0070681_10006973
680 Ga0070681_10087027
681 Ga0070681_10250828
682 Ga0070681_10842553
683 Ga0068867_100113052
684 Ga0068867_100350472
685 Ga0070685_10027705
686 Ga0070685_10094869
687 Ga0070706_100867349
688 Ga0070707_100057665
689 Ga0070698_100081190
690 Ga0070699_100001130
691 Ga0070679_100134808
692 Ga0070679_100254445
693 Ga0070679_100605241
694 Ga0070684_100097704
695 Ga0070672_100235557
696 Ga0070672_100540335
697 Ga0070686_100096661
698 Ga0070686_100172013
699 Ga0070686_100294229
700 Ga0070686_100326504
701 Ga0070695_100215970
702 Ga0070693_100203594
703 Ga0070693_100209043
704 Ga0070665_101124859
705 Ga0070704_100046381
706 Ga0068855_100558831
707 Ga0070664_100123518
708 Ga0068857_100584932
709 Ga0068856_100260143
710 Ga0070702_100120821
711 Ga0070702_100178656
712 Ga0070702_100598943
713 Ga0068859_100211320
714 Ga0068864_100077013
715 Ga0068866_10530156
716 Ga0068861_100041334
717 Ga0068861_100847115
718 Ga0068861_101816544
719 Ga0068870_10267891
720 Ga0068863_100274054
721 Ga0068858_100544856
722 Ga0068860_100182669
723 Ga0068862_100891428
724 Ga0081455_10004196
725 Ga0081455_10010083
726 Ga0081455_10017150
727 Ga0081455_10059641
728 Ga0081455_10145553
729 Ga0081455_10149523
730 Ga0081538_10002850
731 Ga0081538_10020233
732 Ga0081540_1011356
733 Ga0081540_1083862
734 Ga0070717_10013260
735 Ga0075365_10031107
736 Ga0075365_10883304
737 Ga0075364_10231418
738 Ga0075432_10001992
739 Ga0070715_10033157
740 Ga0070715_10538258
741 Ga0070716_100021666
742 Ga0070716_100296703
743 Ga0070712_100320371
744 Ga0075367_10139845
745 Ga0075369_10185928
746 Ga0097621_100107458
747 Ga0068871_100791628
748 Ga0075428_100003294
749 Ga0075428_100048016
750 Ga0075428_100196978
751 Ga0075430_100002812
752 Ga0075430_100543028
753 Ga0075431_100003875
754 Ga0075433_10000085
755 Ga0075433_10187890
756 Ga0075433_10291247
757 Ga0075434_100000251
758 Ga0075434_100113886
759 Ga0075434_101408620
760 Ga0075429_100025713
761 Ga0075429_100149343
762 Ga0068865_100074913
763 Ga0075436_100178467
764 Ga0075436_100266329
765 Ga0075436_100396966
766 Ga0075436_100793731
767 Ga0097620_100211314
768 Ga0075435_100035098
769 Ga0075435_100058935
770 Ga0075435_100075631
771 Ga0075435_100243179
772 Ga0075435_100336349
773 Ga0099794_10037485
774 Ga0099794_10109201
775 Ga0105251_10019939
776 Ga0111539_10000250
777 Ga0111539_10092087
778 Ga0111539_10115108
779 Ga0111539_10398338
780 Ga0111539_10440436
781 Ga0111539_11016763
782 Ga0111539_11939466
783 Ga0105245_10122929
784 Ga0105245_10457062
785 Ga0105247_10087140
786 Ga0114129_10005184
787 Ga0114129_10006771
788 Ga0114129_10141575
789 Ga0114129_10143328
790 Ga0114129_10791556
791 Ga0114129_11476718
792 Ga0114129_12544092
793 Ga0105243_10041625
794 Ga0105243_10213872
795 Ga0105241_10025291
796 Ga0105241_10482535
797 Ga0105242_10239354
798 Ga0105242_11241568
799 Ga0105248_10032144
800 Ga0105248_10225019
801 Ga0105248_11647920
802 Ga0105237_10079301
803 Ga0105238_10034389
804 Ga0105238_10226493
805 Ga0105249_10173263
806 Ga0105249_10314593
807 Ga0105249_10493899
808 Ga0105246_10082067
809 Ga0105246_10113546
810 Ga0157336_1002923
811 Ga0157335_1002134
812 Ga0157326_1008136
813 Ga0157373_10199232
814 Ga0157374_10206634
815 Ga0157374_10261433
816 Ga0157378_10612475
817 Ga0157378_11552217
818 Ga0163162_10053933
819 Ga0163162_10083174
820 Ga0163162_10374216
821 Ga0163162_11264783
822 Ga0157375_10138583
823 Ga0157375_10464351
824 Ga0157375_10528360
825 Ga0157375_10538509
826 Ga0157375_11072323
827 Ga0163163_10320540
828 Ga0157380_10140213
829 Ga0157380_10899909
830 Ga0157379_10442067
831 Ga0157379_10652862
832 Ga0157379_10928097
833 Ga0157376_10662174
834 Ga0163161_10134688
835 Ga0163161_10715060
836 Ga0213872_10036375
837 Ga0213876_10135194
838 Ga0207697_10068439
839 Ga0207653_10079164
840 Ga0207688_10326661
841 Ga0207685_10009903
842 Ga0207685_10383086
843 Ga0207699_10023185
844 Ga0207645_10047199
845 Ga0207645_10095926
846 Ga0207654_10011268
847 Ga0207671_10055320
848 Ga0207693_10005210
849 Ga0207693_10277248
850 Ga0207660_10078483
851 Ga0207662_10041423
852 Ga0207662_10063606
853 Ga0207662_10353927
854 Ga0207657_10104493
855 Ga0207657_10180513
856 Ga0207649_10067158
857 Ga0207652_10486737
858 Ga0207652_10504699
859 Ga0207646_10183694
860 Ga0207681_10190144
861 Ga0207694_10117623
862 Ga0207650_10108659
863 Ga0207650_10396968
864 Ga0207659_10097796
865 Ga0207700_10027894
866 Ga0207644_10001559
867 Ga0207644_10056707
868 Ga0207644_10417998
869 Ga0207644_11020624
870 Ga0207686_10039471
871 Ga0207686_10452395
872 Ga0207709_10085431
873 Ga0207709_10118234
874 Ga0207709_10178544
875 Ga0207670_10002470
876 Ga0207670_10236579
877 Ga0207670_10542495
878 Ga0207669_10013358
879 Ga0207669_10745270
880 Ga0207704_10126585
881 Ga0207704_10913494
882 Ga0207665_10001895
883 Ga0207665_10417479
884 Ga0207691_10190615
885 Ga0207691_10556244
886 Ga0207711_10014256
887 Ga0207689_10172219
888 Ga0207661_10660354
889 Ga0207679_10468876
890 Ga0207667_10408258
891 Ga0207651_10048950
892 Ga0207651_10058020
893 Ga0207651_10195381
894 Ga0207651_10547624
895 Ga0207712_10300516
896 Ga0207712_10860294
897 Ga0207668_10038731
898 Ga0207668_10386140
899 Ga0207668_10426792
900 Ga0207640_11021200
901 Ga0207658_10518317
902 Ga0207658_10945459
903 Ga0207703_10061935
904 Ga0207703_10074937
905 Ga0207678_10032429
906 Ga0207678_10390756
907 Ga0207708_10073016
908 Ga0207708_10199163
909 Ga0207702_10200580
910 Ga0207702_10291201
911 Ga0207641_10779911
912 Ga0207648_10216167
913 Ga0207648_10555592
914 Ga0207676_10006064
915 Ga0207676_10062481
916 Ga0207675_100066724
917 Ga0207675_100407355
918 Ga0207675_100988755
919 Ga0207683_10003110
920 Ga0207683_10013892
921 Ga0209179_1042549
922 Ga0207428_10000111
923 Ga0207428_10412611
924 Ga0268266_10021015
925 Ga0268266_10266585
926 Ga0265334_10103755
927 Ga0265338_10150530
928 Ga0265330_10103673
929 Ga0265332_10089912
930 Ga0265325_10000637
931 Ga0265325_10031519
932 Ga0265325_10282918
933 Ga0265325_10329572
934 Ga0265340_10006771
935 Ga0265340_10031547
936 Ga0265340_10077553
937 Ga0265339_10081073
938 Ga0265339_10182143
939 Ga0265339_10328234
940 Ga0265339_10364265
941 Ga0265316_10112488
942 Ga0265313_10043677
943 Ga0265342_10020960
944 Ga0265342_10082802
945 Ga0265342_10155344
946 Ga0265342_10514856
947 Ga0373958_0020626
948 Ga0373938_0025038
949 Ga0373934_0159917
950 Ga0373940_0006358
951 Ga0373940_0099958
952 Ga0373944_0012444
953 Ga0373952_0020032
954 Ga0373952_0055377
955 Ga0373932_0005832
956 Ga0373939_0002529
957 Ga0373939_0044395
958 Ga0373941_0010208
959 Ga0373945_0079861
960 Ga0373945_0414197
961 Ga0373954_0088649
962 Ga0373957_0029417
963 Ga0373960_0023332
964 Ga0373960_0032637
965 Ga0373960_0136234
966 Ga0373943_0004134
967 Ga0373946_0026442
968 Ga0373946_0109152
969 Ga0373942_0038016
970 Ga0373942_0074306
971 Ga0373961_0137363
972 Ga0373962_0076416
973 Ga0373924_0020958
974 Ga0373924_0103468
975 Ga0373931_0104126
976 Ga0373931_0201980
977 Ga0373931_0205593
978 Ga0373935_0004969
979 Ga0373935_0427721
980 Ga0373935_0601799
981 Ga0373927_0005207
982 Ga0373927_0066102
983 Ga0373927_0086953
984 Ga0373927_0317101
985 Ga0373947_0000702
986 Ga0373947_0236705
987 Ga0373947_0910287
988 Ga0373937_0013397
989 Ga0373937_0239340
990 Ga0373937_0483417
991 Ga0373937_1041666
992 Ga0373925_0005285
993 Ga0373925_0006553
994 Ga0373925_0067631
995 Ga0436364_0735467
996 Ga0436365_0303003
997 Ga0436365_1342060
998 Ga0436361_0822087
999 Ga0436362_0872148
1000 Ga0466961_0576872
1001 Ga0466963_0274944
1002 Ga0466971_0173933
1003 Ga0466958_0242601
1004 Ga0466967_0094440
1005 Ga0466967_0798886
1006 Ga0495603_0018129
1007 Ga0495629_0001654
1008 Ga0495638_0031157
1009 Ga0495638_0061112
1010 Ga0495580_0061307
1011 Ga0495582_0004158
1012 Ga0495582_0038790
1013 Ga0495605_0235953
1014 Ga0495594_0039057
1015 Ga0495594_0339200
1016 Ga0495607_0060116
1017 Ga0495620_0125578
1018 Ga0495628_0019124
1019 Ga0495663_0027653
1020 Ga0495663_0093836
1021 Ga0495652_0356055
1022 Ga0495640_0364110
1023 Ga0495598_0004338
1024 Ga0495598_0045351
1025 Ga0495621_0008638
1026 Ga0495645_0253098
1027 Ga0495667_0125428
1028 Ga0495656_0103115
1029 Ga0495656_0179349
1030 Ga0495668_0560984
1031 Ga0495588_0013125
1032 Ga0495599_0202541
1033 Ga0495599_0713757
1034 Ga0495646_0035520
1035 Ga0495658_0003916
1036 Ga0495613_0110644
1037 Ga0495624_0283904
1038 Ga0495600_0381052
1039 Ga0495604_0058061
1040 Ga0495674_0032799
1041 Ga0495676_0044491
1042 Ga0495676_0454826
1043 Ga0495680_0011680
1044 Ga0495679_035907
1045 Ga0495593_0020094
1046 Ga0495602_0148818
1047 Ga0495602_0180931
1048 Ga0495615_0093390
1049 Ga0496100_0009764
1050 Ga0496100_0048108
1051 Ga0496100_0187157
1052 Ga0496101_0010054
1053 Ga0496101_0191955
1054 Ga0496101_1019600
1055 Ga0496102_0022921
1056 Ga0496102_0023824
1057 Ga0496102_0113526
1058 Ga0496102_0209474
1059 Ga0496102_0629832
1060 Ga0496102_1208214
1061 Ga0496103_0005932
1062 Ga0496103_0237833
1063 Ga0496103_0473416
1064 Ga0496104_0003340
1065 Ga0496104_0003588
1066 Ga0496104_0033443
1067 Ga0496104_0054818
1068 Ga0496104_0240002
1069 Ga0496104_0551448
1070 Ga0496105_0004588
1071 Ga0496105_0013332
1072 Ga0496105_0052819
1073 Ga0496105_0612995
1074 Ga0496106_0001837
1075 Ga0496106_0018095
1076 Ga0496106_0360077
1077 Ga0496106_0646231
1078 Ga0496106_0769705
1079 Ga0496106_0907573
1080 Ga0496107_0000272
1081 Ga0496107_0004871
1082 Ga0496107_0302944
1083 Ga0496107_0801414
1084 Ga0496108_0021105
1085 Ga0496108_0022872
1086 Ga0496108_0058700
1087 Ga0496108_0072083
1088 Ga0496108_0212544
1089 Ga0496108_1270521
1090 Ga0496109_0007061
1091 Ga0496109_0029689
1092 Ga0496109_0138660
1093 Ga0496110_0025000
1094 Ga0496110_0028476
1095 Ga0496110_0797668
1096 Ga0496110_0805812
1097 Ga0496111_0044823
1098 Ga0496111_0106732
1099 Ga0496111_0230546
1100 Ga0496111_0420247
1101 Ga0496112_0089655
1102 Ga0496112_0105482
1103 Ga0496112_0682857
1104 Ga0496113_0010083
1105 Ga0496113_0048327
1106 Ga0496113_0402597
1107 Ga0496113_0571367
1108 Ga0496114_0007484
1109 Ga0496114_0026852
1110 Ga0496114_0042701
1111 Ga0496114_0605268
1112 Ga0496115_0003882
1113 Ga0496115_0015338
1114 Ga0496115_0029910
1115 Ga0496115_0210873
1116 Ga0496115_0886890
1117 Ga0501031_0034777
1118 Ga0501031_0099284
1119 Ga0501031_0309263
1120 Ga0501032_0020015
1121 Ga0501033_0020871
1122 Ga0501034_0234366
1123 Ga0501034_0330118
1124 Ga0501034_0705059
1125 Ga0501036_0050920
1126 Ga0501037_0058117
1127 Ga0501038_0301133
1128 Ga0501039_0230032
1129 Ga0501041_0378324
1130 Ga0501041_0518164
1131 Ga0501042_0187772
1132 Ga0501042_0321448
1133 Ga0501043_0181321
1134 Ga0501046_0077023
1135 Ga0501046_0569294
1136 Ga0501047_0004229
1137 Ga0501047_0954555
1138 Ga0501048_0031882
1139 Ga0501067_0278886
1140 Ga0501068_0048245
1141 Ga0501068_0223627
1142 Ga0501069_0026819
1143 Ga0501070_0164655
1144 Ga0501070_0455778
1145 Ga0501071_0088787
1146 Ga0501072_0344870
1147 Ga0501073_0018318
1148 Ga0501073_0029078
1149 Ga0501074_0011514
1150 Ga0501075_0141457
1151 Ga0501075_0641327
1152 Ga0501076_0261758
1153 Ga0501076_0320112
1154 Ga0501076_0899817
1155 Ga0501077_0563156
1156 Ga0501079_0022020
1157 Ga0501079_0134340
1158 Ga0501080_0072146
1159 Ga0501081_0050584
1160 Ga0501081_0203023
1161 Ga0501083_0019363
1162 Ga0501083_0044505
1163 Ga0501044_0084433
1164 Ga0501044_0163190
1165 Ga0501044_0712996
1166 Ga0501045_0091601
1167 nmdc:mga0yw44_139378_c1
1168 nmdc:mga0yw44_8662_c1
1169 nmdc:mga07m45_635796_c1
1170 nmdc:mga05p37_387936_c1
1171 nmdc:mga05p37_59_c1
1172 nmdc:mga05p37_76610_c1
1173 nmdc:mga09592_131916_c1
1174 nmdc:mga0qj67_101461_c1
1175 nmdc:mga0qj67_339_c1
1176 nmdc:mga0qj67_552741_c1
1177 nmdc:mga06r32_252_c1
1178 nmdc:mga06r32_69305_c1
1179 nmdc:mga08y16_781166_c1
1180 nmdc:mga08y16_95_c1
1181 nmdc:mga0n895_1208385_c1
1182 nmdc:mga0n895_163927_c1
1183 nmdc:mga0n895_32687_c1
1184 nmdc:mga0n895_56_c1
1185 nmdc:mga0n895_636214_c1
1186 nmdc:mga0rr50_181501_c1
1187 nmdc:mga0rr50_256052_c1
1188 nmdc:mga0rr50_3585_c1
1189 nmdc:mga08x19_108284_c1
1190 nmdc:mga08x19_211536_c1
1191 nmdc:mga08x19_664368_c1
1192 nmdc:mga0a205_144043_c2
1193 nmdc:mga0a205_23_c1
1194 nmdc:mga0a205_523344_c1
1195 nmdc:mga0a205_81524_c1
1196 Ga0495601_0037120
1197 Ga0495601_0043790
1198 Ga0495601_0113848
1199 Ga0495601_0241930
1200 Ga0495612_0032208
1201 Ga0495612_0130711
1202 Ga0500610_0077355
1203 Ga0495595_0078114
1204 Ga0495595_0087092
1205 Ga0495595_0150200
1206 Ga0495619_0000470
1207 Ga0495619_0064546
1208 Ga0495619_0160382
1209 Ga0500651_0015106
1210 Ga0500642_0194800
1211 Ga0500658_0071766
1212 Ga0500604_0091087
1213 Ga0500627_0308350
1214 Ga0500609_009855
1215 Ga0501084_0185261
1216 Ga0501082_0078532
1217 Ga0501082_0372974
1218 Ga0501082_0440115
1219 Ga0501082_0649481
1220 Ga0501082_0846864
1221 Ga0466962_0030777
1222 Ga0530510_0132941
1223 Ga0530510_0198984
1224 Ga0530510_0580268
1225 Ga0530510_0670809
1226 2643758535

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14295

PAN_4

PAN domain

58

108

0.99

PF14295

PAN_4

PAN domain

141

193

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ryw-assembly1.cif.gz_A copper oxidase from colletotrichum graminicola 0.7709 116 189
2y8s-assembly1.cif.gz_A co-structure of an ama1 mutant (y230a) with a surface exposed region of ron2 from toxoplasma gondii 0.7548 32 108
2x2z-assembly1.cif.gz_A crystal structure ama1 from toxoplasma gondii 0.728 32 108
2y8t-assembly1.cif.gz_A co-structure of ama1 with a surface exposed region of ron2 from toxoplasma gondii 0.6974 32 108
2x2z-assembly4.cif.gz_E crystal structure ama1 from toxoplasma gondii 0.6951 32 107
ID Description Score Start End Superfamily
af_Q7YX17_16_91_3.50.4.10 Alpha Beta;3-Layer(bba) Sandwich;Hepatocyte Growth Factor;Hepatocyte Growth Factor 0.8817 30 104 3.50.4.10
af_A0A0G2K4I9_19_110_3.50.4.10 Alpha Beta;3-Layer(bba) Sandwich;Hepatocyte Growth Factor;Hepatocyte Growth Factor 0.8564 32 104 3.50.4.10
af_H8W3Y1_489_559_3.50.4.10 Alpha Beta;3-Layer(bba) Sandwich;Hepatocyte Growth Factor;Hepatocyte Growth Factor 0.847 116 188 3.50.4.10
2f83A02 Alpha Beta;3-Layer(bba) Sandwich;Hepatocyte Growth Factor;Hepatocyte Growth Factor 0.8406 32 104 3.50.4.10
af_A4HS27_301_365_3.50.4.10 Alpha Beta;3-Layer(bba) Sandwich;Hepatocyte Growth Factor;Hepatocyte Growth Factor 0.8357 119 188 3.50.4.10
ID Description Score Start End GO Terms
AF-A0A7K4B2N7-F1-model_v4 Apple domain-containing protein 0.973 118 189
AF-A0A1V5AWY6-F1-model_v4 Apple domain-containing protein 0.972 33 104
AF-A0A6I0EL99-F1-model_v4 Apple domain-containing protein 0.9718 118 189
AF-A0A0K8PA51-F1-model_v4 Protein containing PAN domain/Ricin-type beta-trefoil lectin domain 0.9704 32 103 GO:0005576
GO:0006508
GO:0016020
GO:0030246
AF-A0A1R4H3L7-F1-model_v4 Bulb-type lectin domain-containing protein 0.9677 31 103

Map