F469197

General Info

Members Datasets Scaffolds Average Seq Length
612 301 1224 92

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_120149_c1|nmdc:mga0a205_120149_c1_2170_2490
Length 106
Sequence MPLKRYSGVHIMSLKVVIPTPLRKFTSGAEVVEIEAKTVKEALDILDAKFPGFRASVCDESGSLRRFINVYLDGEDVRFLENLATPVNDGSEIAIVPAISGGSVHL

Samples

Sample ID Description Type Environment
1 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
108 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
111 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
112 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
115 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
184 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
185 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
203 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
206 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
207 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
208 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
209 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
210 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
211 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
212 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
213 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
214 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
215 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
263 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
264 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
268 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
283 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
296 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
297 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
298 2891562705 Microbispora tritici MT50 Isolate Unclassified
299 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
300 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
301 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.28
Metatranscriptomes 4.58
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.29
Nodule 0.16
Rhizoplane 1.96
Rhizosphere 92.97
Stem 0
Stem Tuber 0
Unclassified 37.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0a205_120149_c1 3300050515 Bacteria 2527
2 MBSR1b_contig_859192 2162886012 Bacteria 1195
3 Ga0058859_10899915 3300004798 Bacteria 593
4 Ga0058863_11199301 3300004799 Unclassified 691
5 Ga0058860_11569542 3300004801 Unclassified 510
6 Ga0065712_10449218 3300005290 Unclassified 687
7 Ga0065712_10588234 3300005290 Unclassified 597
8 Ga0065707_10718889 3300005295 Bacteria 631
9 Ga0070658_10007832 3300005327 Bacteria 8608
10 Ga0070676_10477151 3300005328 Unclassified 881
11 Ga0070683_100670608 3300005329 Bacteria 993
12 Ga0070690_100377695 3300005330 Bacteria 1035
13 Ga0070690_100806897 3300005330 Unclassified 728
14 Ga0070670_100038647 3300005331 Unclassified 4104
15 Ga0070670_100069072 3300005331 Bacteria 3033
16 Ga0070670_100519882 3300005331 Bacteria 1060
17 Ga0070670_100754231 3300005331 Bacteria 877
18 Ga0068869_100903434 3300005334 Unclassified 764
19 Ga0068869_101431208 3300005334 Bacteria 612
20 Ga0070666_10007498 3300005335 Bacteria 6723
21 Ga0070666_10054394 3300005335 Unclassified 2700
22 Ga0070666_10990946 3300005335 Unclassified 623
23 Ga0070680_100871131 3300005336 Bacteria 777
24 Ga0070682_100396247 3300005337 Bacteria 1043
25 Ga0070682_100406731 3300005337 Bacteria 1031
26 Ga0068868_100002618 3300005338 Bacteria 12483
27 Ga0068868_100260058 3300005338 Bacteria 1463
28 Ga0068868_101168777 3300005338 Unclassified 710
29 Ga0070689_100215257 3300005340 Unclassified 1574
30 Ga0070689_100472478 3300005340 Unclassified 1070
31 Ga0070689_100550194 3300005340 Unclassified 994
32 Ga0070689_100715372 3300005340 Unclassified 875
33 Ga0070689_101841576 3300005340 Bacteria 552
34 Ga0070687_100035135 3300005343 Unclassified 2486
35 Ga0070687_101348664 3300005343 Unclassified 531
36 Ga0070661_100114773 3300005344 Unclassified 2014
37 Ga0070661_100521251 3300005344 Bacteria 953
38 Ga0070661_101485688 3300005344 Unclassified 571
39 Ga0070692_10196071 3300005345 Bacteria 1180
40 Ga0070669_100077675 3300005353 Bacteria 2467
41 Ga0070669_100211690 3300005353 Unclassified 1529
42 Ga0070669_101250125 3300005353 Unclassified 642
43 Ga0070669_101701522 3300005353 Unclassified 550
44 Ga0070675_100001361 3300005354 Bacteria 17901
45 Ga0070675_100006332 3300005354 Bacteria 9086
46 Ga0070675_100027260 3300005354 Unclassified 4589
47 Ga0070675_100289524 3300005354 Bacteria 1441
48 Ga0070675_100299845 3300005354 Unclassified 1416
49 Ga0070675_100327732 3300005354 Unclassified 1354
50 Ga0070671_100031847 3300005355 Bacteria 4359
51 Ga0070671_100063820 3300005355 Unclassified 3068
52 Ga0070671_100512155 3300005355 Bacteria 1033
53 Ga0070671_101166866 3300005355 Bacteria 677
54 Ga0070674_100842606 3300005356 Unclassified 795
55 Ga0070674_100859875 3300005356 Unclassified 787
56 Ga0070674_101280935 3300005356 Bacteria 653
57 Ga0070673_100003151 3300005364 Bacteria 10218
58 Ga0070673_100011000 3300005364 Bacteria 6160
59 Ga0070673_100679995 3300005364 Bacteria 944
60 Ga0070673_101007189 3300005364 Unclassified 776
61 Ga0070688_100061044 3300005365 Unclassified 2382
62 Ga0070688_100232458 3300005365 Unclassified 1305
63 Ga0070688_100340623 3300005365 Bacteria 1095
64 Ga0070688_100350981 3300005365 Bacteria 1080
65 Ga0070667_100003787 3300005367 Bacteria 12864
66 Ga0070667_100031673 3300005367 Unclassified 4408
67 Ga0070667_100063106 3300005367 Bacteria 3139
68 Ga0070709_10000043 3300005434 Bacteria 101915
69 Ga0070709_10871913 3300005434 Unclassified 710
70 Ga0070714_100796682 3300005435 Bacteria 915
71 Ga0070714_100954297 3300005435 Bacteria 834
72 Ga0070713_100276249 3300005436 Bacteria 1540
73 Ga0070713_100641001 3300005436 Bacteria 1011
74 Ga0070713_101155026 3300005436 Unclassified 749
75 Ga0070701_10985300 3300005438 Bacteria 587
76 Ga0070705_100147375 3300005440 Unclassified 1557
77 Ga0070705_100755814 3300005440 Unclassified 769
78 Ga0070705_101841265 3300005440 Unclassified 514
79 Ga0070700_101258742 3300005441 Bacteria 620
80 Ga0070708_100093180 3300005445 Bacteria 2746
81 Ga0070708_100192232 3300005445 Unclassified 1909
82 Ga0070708_101249957 3300005445 Unclassified 694
83 Ga0070708_101780876 3300005445 Bacteria 572
84 Ga0070681_10372761 3300005458 Bacteria 1338
85 Ga0068867_100796766 3300005459 Unclassified 842
86 Ga0068867_101452242 3300005459 Unclassified 637
87 Ga0068867_101683006 3300005459 Unclassified 594
88 Ga0070685_10051192 3300005466 Bacteria 2388
89 Ga0070685_11184743 3300005466 Unclassified 580
90 Ga0070685_11385070 3300005466 Bacteria 539
91 Ga0070706_100428483 3300005467 Bacteria 1231
92 Ga0070706_100575449 3300005467 Bacteria 1047
93 Ga0070706_101179843 3300005467 Bacteria 704
94 Ga0070706_101598412 3300005467 Bacteria 595
95 Ga0070707_100016217 3300005468 Bacteria 6992
96 Ga0070707_100410228 3300005468 Bacteria 1315
97 Ga0070707_100601487 3300005468 Bacteria 1062
98 Ga0070707_100849845 3300005468 Bacteria 877
99 Ga0070698_102206881 3300005471 Unclassified 504
100 Ga0070699_100097535 3300005518 Bacteria 2575
101 Ga0070699_101556016 3300005518 Unclassified 606
102 Ga0070699_102219716 3300005518 Unclassified 501
103 Ga0070684_100046671 3300005535 Bacteria 3753
104 Ga0070684_100623348 3300005535 Unclassified 1003
105 Ga0070672_100026217 3300005543 Bacteria 4333
106 Ga0070672_100176834 3300005543 Bacteria 1777
107 Ga0070672_102011829 3300005543 Bacteria 520
108 Ga0070686_100062718 3300005544 Unclassified 2406
109 Ga0070686_100206563 3300005544 Bacteria 1411
110 Ga0070686_100404940 3300005544 Bacteria 1038
111 Ga0070686_101745597 3300005544 Bacteria 529
112 Ga0070665_100838162 3300005548 Bacteria 933
113 Ga0070665_101042105 3300005548 Bacteria 830
114 Ga0068855_100019130 3300005563 Bacteria 8229
115 Ga0068855_100522871 3300005563 Unclassified 1287
116 Ga0070664_100000508 3300005564 Bacteria 29520
117 Ga0070664_100007161 3300005564 Bacteria 8992
118 Ga0070664_100246728 3300005564 Bacteria 1604
119 Ga0070664_100692409 3300005564 Unclassified 949
120 Ga0070664_100950398 3300005564 Bacteria 807
121 Ga0068857_101211003 3300005577 Unclassified 731
122 Ga0068857_101374921 3300005577 Unclassified 686
123 Ga0068854_100332502 3300005578 Bacteria 1238
124 Ga0068854_101038039 3300005578 Bacteria 728
125 Ga0068856_100024912 3300005614 Bacteria 5830
126 Ga0068852_102759160 3300005616 Bacteria 510
127 Ga0068859_100000468 3300005617 Bacteria 39887
128 Ga0068859_100025599 3300005617 Bacteria 5918
129 Ga0068859_101092011 3300005617 Bacteria 877
130 Ga0068859_101464406 3300005617 Unclassified 753
131 Ga0068859_103038032 3300005617 Unclassified 512
132 Ga0068864_100003866 3300005618 Bacteria 12333
133 Ga0068864_100142516 3300005618 Unclassified 2163
134 Ga0068864_100975216 3300005618 Bacteria 840
135 Ga0068866_10109197 3300005718 Bacteria 1540
136 Ga0068866_10717353 3300005718 Unclassified 687
137 Ga0068861_100797910 3300005719 Bacteria 886
138 Ga0068861_100884267 3300005719 Bacteria 845
139 Ga0068870_11161350 3300005840 Unclassified 557
140 Ga0068870_11407378 3300005840 Unclassified 511
141 Ga0068863_100000307 3300005841 Bacteria 50304
142 Ga0068863_100096976 3300005841 Unclassified 2799
143 Ga0068863_100207275 3300005841 Bacteria 1887
144 Ga0068863_100514921 3300005841 Unclassified 1179
145 Ga0068863_100630360 3300005841 Bacteria 1062
146 Ga0068863_102265787 3300005841 Bacteria 553
147 Ga0068858_100005580 3300005842 Bacteria 12309
148 Ga0068858_100301932 3300005842 Bacteria 1527
149 Ga0068858_100422823 3300005842 Unclassified 1281
150 Ga0068858_100456514 3300005842 Archaea 1232
151 Ga0068858_100475376 3300005842 Unclassified 1206
152 Ga0068858_101507819 3300005842 Bacteria 663
153 Ga0068858_102272733 3300005842 Unclassified 536
154 Ga0068860_100003605 3300005843 Bacteria 15911
155 Ga0068860_100095622 3300005843 Bacteria 2832
156 Ga0068860_102019566 3300005843 Unclassified 598
157 Ga0068862_100268343 3300005844 Unclassified 1560
158 Ga0068862_101157084 3300005844 Bacteria 771
159 Ga0081539_10087621 3300005985 Bacteria 1617
160 Ga0070717_10794981 3300006028 Unclassified 860
161 Ga0070717_11022431 3300006028 Bacteria 753
162 Ga0075365_10007308 3300006038 Bacteria 6173
163 Ga0075365_10045223 3300006038 Bacteria 2887
164 Ga0075365_10082823 3300006038 Bacteria 2176
165 Ga0075365_10334252 3300006038 Bacteria 1067
166 Ga0075363_100361443 3300006048 Bacteria 849
167 Ga0075364_10004026 3300006051 Bacteria 8437
168 Ga0070715_10452471 3300006163 Unclassified 725
169 Ga0070716_100325974 3300006173 Unclassified 1078
170 Ga0070712_100161379 3300006175 Bacteria 1731
171 Ga0075367_10019837 3300006178 Bacteria 3734
172 Ga0075367_10907805 3300006178 Unclassified 562
173 Ga0097621_100002253 3300006237 Bacteria 13193
174 Ga0097621_100266323 3300006237 Unclassified 1505
175 Ga0097621_100296419 3300006237 Bacteria 1427
176 Ga0097621_100607063 3300006237 Unclassified 1000
177 Ga0097621_101060820 3300006237 Bacteria 760
178 Ga0097621_101514961 3300006237 Bacteria 637
179 Ga0068871_100030378 3300006358 Bacteria 4254
180 Ga0068871_100042731 3300006358 Bacteria 3640
181 Ga0068871_100191837 3300006358 Bacteria 1760
182 Ga0068871_100472025 3300006358 Bacteria 1127
183 Ga0068871_101205770 3300006358 Unclassified 710
184 Ga0075428_100061741 3300006844 Bacteria 4104
185 Ga0075428_100152880 3300006844 Bacteria 2507
186 Ga0075428_100288146 3300006844 Bacteria 1767
187 Ga0075428_100302946 3300006844 Bacteria 1718
188 Ga0075428_101680057 3300006844 Unclassified 663
189 Ga0075428_101710998 3300006844 Bacteria 656
190 Ga0075431_100080376 3300006847 Unclassified 3366
191 Ga0075431_101336567 3300006847 Bacteria 677
192 Ga0075433_10084324 3300006852 Unclassified 2805
193 Ga0075433_10754028 3300006852 Bacteria 851
194 Ga0075433_10786129 3300006852 Unclassified 832
195 Ga0075433_10791958 3300006852 Unclassified 828
196 Ga0075433_10897200 3300006852 Bacteria 773
197 Ga0075434_100028312 3300006871 Bacteria 5504
198 Ga0075434_100124684 3300006871 Bacteria 2593
199 Ga0075434_100167927 3300006871 Unclassified 2214
200 Ga0075434_100192710 3300006871 Bacteria 2059
201 Ga0075434_100234032 3300006871 Bacteria 1857
202 Ga0075434_101421281 3300006871 Unclassified 704
203 Ga0075429_101037931 3300006880 Unclassified 716
204 Ga0068865_100289317 3300006881 Bacteria 1307
205 Ga0075436_100232794 3300006914 Unclassified 1309
206 Ga0075436_100832259 3300006914 Unclassified 688
207 Ga0075436_101240948 3300006914 Bacteria 563
208 Ga0075436_101379404 3300006914 Unclassified 534
209 Ga0075436_101383320 3300006914 Unclassified 533
210 Ga0097620_100000468 3300006931 Bacteria 39887
211 Ga0097620_100025601 3300006931 Bacteria 5918
212 Ga0097620_101092005 3300006931 Bacteria 877
213 Ga0097620_101320674 3300006931 Bacteria 795
214 Ga0097620_101464607 3300006931 Unclassified 753
215 Ga0097620_103036588 3300006931 Unclassified 512
216 Ga0075435_100113544 3300007076 Unclassified 2255
217 Ga0075435_100194871 3300007076 Unclassified 1716
218 Ga0075435_100404147 3300007076 Bacteria 1175
219 Ga0099794_10030767 3300007265 Bacteria 2509
220 Ga0105240_10036148 3300009093 Bacteria 6356
221 Ga0105240_10073726 3300009093 Bacteria 4215
222 Ga0111539_10006822 3300009094 Bacteria 14683
223 Ga0111539_10052305 3300009094 Bacteria 4862
224 Ga0111539_10236601 3300009094 Unclassified 2126
225 Ga0111539_10253050 3300009094 Bacteria 2051
226 Ga0111539_10256337 3300009094 Bacteria 2037
227 Ga0111539_11109893 3300009094 Bacteria 919
228 Ga0111539_12183347 3300009094 Unclassified 642
229 Ga0105247_10220836 3300009101 Bacteria 1283
230 Ga0105247_11619834 3300009101 Unclassified 532
231 Ga0114129_10003480 3300009147 Bacteria 22140
232 Ga0114129_10016779 3300009147 Bacteria 10426
233 Ga0114129_10062430 3300009147 Bacteria 5205
234 Ga0114129_10112769 3300009147 Unclassified 3750
235 Ga0114129_10176581 3300009147 Bacteria 2909
236 Ga0114129_10351096 3300009147 Unclassified 1954
237 Ga0114129_10626763 3300009147 Bacteria 1390
238 Ga0114129_10943953 3300009147 Bacteria 1090
239 Ga0105242_10298932 3300009176 Bacteria 1468
240 Ga0105242_13173302 3300009176 Unclassified 510
241 Ga0105248_10000090 3300009177 Bacteria 101891
242 Ga0105248_10001944 3300009177 Bacteria 22950
243 Ga0105248_10384220 3300009177 Bacteria 1581
244 Ga0105248_12162000 3300009177 Unclassified 633
245 Ga0105237_10343589 3300009545 Bacteria 1497
246 Ga0105237_11697694 3300009545 Unclassified 639
247 Ga0105249_11768239 3300009553 Bacteria 691
248 Ga0105249_11923181 3300009553 Bacteria 664
249 Ga0099796_10080180 3300010159 Bacteria 1195
250 Ga0105246_10534407 3300011119 Bacteria 1002
251 Ga0105246_10773398 3300011119 Unclassified 849
252 Ga0157339_1029708 3300012505 Bacteria 632
253 Ga0157370_10001553 3300013104 Bacteria 28453
254 Ga0157374_10163755 3300013296 Unclassified 2167
255 Ga0157378_10005269 3300013297 Bacteria 11359
256 Ga0157378_10136555 3300013297 Bacteria 2274
257 Ga0157378_10933362 3300013297 Unclassified 900
258 Ga0163162_10016243 3300013306 Bacteria 7282
259 Ga0163162_10026086 3300013306 Bacteria 5776
260 Ga0163162_10191071 3300013306 Bacteria 2175
261 Ga0163162_12403952 3300013306 Unclassified 606
262 Ga0157375_10000860 3300013308 Bacteria 26402
263 Ga0157375_10009916 3300013308 Bacteria 8378
264 Ga0157375_10578004 3300013308 Unclassified 1284
265 Ga0157375_10926355 3300013308 Archaea 1014
266 Ga0157375_12065566 3300013308 Bacteria 678
267 Ga0157375_13180224 3300013308 Unclassified 548
268 Ga0163163_10012034 3300014325 Bacteria 7872
269 Ga0163163_10227302 3300014325 Unclassified 1915
270 Ga0163163_10651090 3300014325 Unclassified 1117
271 Ga0163163_10709357 3300014325 Unclassified 1069
272 Ga0163163_11535612 3300014325 Unclassified 727
273 Ga0157380_10070761 3300014326 Bacteria 2820
274 Ga0157380_10539411 3300014326 Bacteria 1142
275 Ga0157380_13330594 3300014326 Unclassified 514
276 Ga0157377_10033093 3300014745 Unclassified 2819
277 Ga0157377_10609327 3300014745 Unclassified 780
278 Ga0157377_11773523 3300014745 Bacteria 500
279 Ga0157379_10000365 3300014968 Bacteria 36359
280 Ga0157379_10204077 3300014968 Bacteria 1788
281 Ga0157379_10959206 3300014968 Archaea 814
282 Ga0157379_12604983 3300014968 Unclassified 506
283 Ga0157376_10640934 3300014969 Unclassified 1062
284 Ga0157376_11369707 3300014969 Unclassified 738
285 Ga0163161_10024305 3300017792 Bacteria 4280
286 Ga0163161_11313830 3300017792 Bacteria 629
287 Ga0197907_10702820 3300020069 Bacteria 1958
288 Ga0206356_10609024 3300020070 Bacteria 513
289 Ga0206356_11259333 3300020070 Bacteria 1880
290 Ga0206355_1561209 3300020076 Unclassified 1022
291 Ga0206350_10899219 3300020080 Bacteria 3044
292 Ga0206354_11109983 3300020081 Unclassified 708
293 Ga0213873_10033831 3300021358 Bacteria 1285
294 Ga0213872_10274108 3300021361 Bacteria 706
295 Ga0213872_10432354 3300021361 Unclassified 530
296 Ga0213871_10129719 3300021441 Bacteria 756
297 Ga0224712_10008548 3300022467 Bacteria 3041
298 Ga0224572_1080103 3300024225 Unclassified 603
299 Ga0228598_1014144 3300024227 Bacteria 1579
300 Ga0207642_10231745 3300025899 Bacteria 1038
301 Ga0207642_10972953 3300025899 Unclassified 546
302 Ga0207680_10004218 3300025903 Bacteria 6804
303 Ga0207680_10128118 3300025903 Unclassified 1669
304 Ga0207680_10948726 3300025903 Unclassified 616
305 Ga0207680_11226811 3300025903 Unclassified 534
306 Ga0207685_10508782 3300025905 Bacteria 635
307 Ga0207699_10000013 3300025906 Bacteria 261480
308 Ga0207699_10497796 3300025906 Unclassified 879
309 Ga0207645_10729994 3300025907 Unclassified 673
310 Ga0207643_10951950 3300025908 Unclassified 556
311 Ga0207684_10253695 3300025910 Bacteria 1518
312 Ga0207684_10486091 3300025910 Bacteria 1059
313 Ga0207707_10359390 3300025912 Unclassified 1254
314 Ga0207695_10038969 3300025913 Bacteria 5111
315 Ga0207693_10352306 3300025915 Bacteria 1152
316 Ga0207662_10059080 3300025918 Bacteria 2297
317 Ga0207649_10092104 3300025920 Unclassified 1987
318 Ga0207649_10220392 3300025920 Bacteria 1351
319 Ga0207646_10016922 3300025922 Bacteria 6832
320 Ga0207646_10337332 3300025922 Bacteria 1362
321 Ga0207646_10547199 3300025922 Bacteria 1041
322 Ga0207646_11322797 3300025922 Bacteria 629
323 Ga0207646_11815793 3300025922 Bacteria 521
324 Ga0207681_10210894 3300025923 Bacteria 1497
325 Ga0207681_10370868 3300025923 Unclassified 1150
326 Ga0207681_10872511 3300025923 Unclassified 753
327 Ga0207650_10002732 3300025925 Bacteria 12184
328 Ga0207650_10064775 3300025925 Bacteria 2737
329 Ga0207650_10458798 3300025925 Bacteria 1061
330 Ga0207659_10000744 3300025926 Bacteria 19294
331 Ga0207659_10001735 3300025926 Bacteria 12925
332 Ga0207659_10006510 3300025926 Bacteria 7160
333 Ga0207659_10282348 3300025926 Unclassified 1358
334 Ga0207659_10400482 3300025926 Bacteria 1148
335 Ga0207659_11173020 3300025926 Unclassified 660
336 Ga0207700_10128944 3300025928 Bacteria 2062
337 Ga0207700_11253010 3300025928 Unclassified 661
338 Ga0207664_10924498 3300025929 Bacteria 783
339 Ga0207664_11130289 3300025929 Bacteria 700
340 Ga0207644_10061748 3300025931 Unclassified 2715
341 Ga0207644_10503495 3300025931 Bacteria 999
342 Ga0207706_10512545 3300025933 Bacteria 1035
343 Ga0207706_10600526 3300025933 Unclassified 945
344 Ga0207670_10538739 3300025936 Bacteria 952
345 Ga0207670_10677242 3300025936 Unclassified 852
346 Ga0207670_10727955 3300025936 Bacteria 823
347 Ga0207669_10185796 3300025937 Bacteria 1495
348 Ga0207704_10161147 3300025938 Bacteria 1596
349 Ga0207704_11383618 3300025938 Unclassified 603
350 Ga0207665_10472208 3300025939 Unclassified 965
351 Ga0207691_10246991 3300025940 Bacteria 1541
352 Ga0207691_10986941 3300025940 Unclassified 703
353 Ga0207691_11220425 3300025940 Bacteria 623
354 Ga0207711_10002120 3300025941 Bacteria 17916
355 Ga0207711_10062453 3300025941 Unclassified 3213
356 Ga0207689_10241928 3300025942 Bacteria 1492
357 Ga0207689_11729467 3300025942 Unclassified 518
358 Ga0207661_10690996 3300025944 Bacteria 938
359 Ga0207679_10008564 3300025945 Bacteria 6517
360 Ga0207679_10012849 3300025945 Bacteria 5475
361 Ga0207679_10757210 3300025945 Unclassified 884
362 Ga0207667_10174861 3300025949 Bacteria 2206
363 Ga0207667_11119181 3300025949 Unclassified 770
364 Ga0207651_10005321 3300025960 Bacteria 6596
365 Ga0207651_10151873 3300025960 Unclassified 1804
366 Ga0207651_10952428 3300025960 Bacteria 766
367 Ga0207712_10590765 3300025961 Unclassified 959
368 Ga0207668_10041369 3300025972 Bacteria 3115
369 Ga0207640_10750142 3300025981 Bacteria 841
370 Ga0207658_10014608 3300025986 Bacteria 5378
371 Ga0207658_11251458 3300025986 Unclassified 678
372 Ga0207658_11657811 3300025986 Bacteria 584
373 Ga0207677_10004186 3300026023 Bacteria 7719
374 Ga0207677_10691734 3300026023 Bacteria 904
375 Ga0207703_10021551 3300026035 Bacteria 5046
376 Ga0207703_10121938 3300026035 Bacteria 2239
377 Ga0207703_10261854 3300026035 Unclassified 1563
378 Ga0207703_10794145 3300026035 Unclassified 903
379 Ga0207703_11645621 3300026035 Unclassified 618
380 Ga0207703_11766066 3300026035 Unclassified 595
381 Ga0207678_10664196 3300026067 Unclassified 916
382 Ga0207708_10413854 3300026075 Bacteria 1117
383 Ga0207708_10932143 3300026075 Bacteria 753
384 Ga0207702_10096268 3300026078 Bacteria 2603
385 Ga0207702_11536933 3300026078 Bacteria 659
386 Ga0207641_10001588 3300026088 Bacteria 22188
387 Ga0207641_10042208 3300026088 Unclassified 3825
388 Ga0207641_10177057 3300026088 Bacteria 1951
389 Ga0207641_10277499 3300026088 Bacteria 1575
390 Ga0207641_10471230 3300026088 Bacteria 1216
391 Ga0207641_12197327 3300026088 Bacteria 552
392 Ga0207641_12381844 3300026088 Bacteria 528
393 Ga0207676_10003255 3300026095 Bacteria 11559
394 Ga0207676_10487935 3300026095 Unclassified 1168
395 Ga0207676_10613506 3300026095 Unclassified 1046
396 Ga0207674_10312822 3300026116 Unclassified 1520
397 Ga0207674_11922360 3300026116 Unclassified 558
398 Ga0207675_100637777 3300026118 Bacteria 1071
399 Ga0207675_101553147 3300026118 Bacteria 682
400 Ga0207698_12525465 3300026142 Bacteria 524
401 Ga0209968_1098610 3300027526 Unclassified 532
402 Ga0209974_10028246 3300027876 Unclassified 1857
403 Ga0207428_10007732 3300027907 Bacteria 9779
404 Ga0207428_10571709 3300027907 Unclassified 816
405 Ga0268266_10301481 3300028379 Unclassified 1495
406 Ga0268265_10205180 3300028380 Bacteria 1713
407 Ga0268265_10263619 3300028380 Unclassified 1533
408 Ga0268265_11153507 3300028380 Bacteria 771
409 Ga0268265_11464633 3300028380 Unclassified 686
410 Ga0268264_10009710 3300028381 Bacteria 7968
411 Ga0268264_10147827 3300028381 Bacteria 2103
412 Ga0265770_1008943 3300030878 Bacteria 1437
413 Ga0265765_1014032 3300030879 Bacteria 921
414 Ga0265760_10075817 3300031090 Bacteria 1037
415 Ga0265330_10066698 3300031235 Bacteria 1560
416 Ga0265332_10474481 3300031238 Bacteria 518
417 Ga0265329_10031760 3300031242 Bacteria 1714
418 Ga0265339_10037130 3300031249 Bacteria 2724
419 Ga0265331_10092014 3300031250 Bacteria 1401
420 Ga0265316_10540234 3300031344 Bacteria 830
421 Ga0307509_10056894 3300031507 Bacteria 4149
422 Ga0307410_11316674 3300031852 Bacteria 632
423 Ga0307406_10215643 3300031901 Bacteria 1423
424 Ga0307406_11059252 3300031901 Bacteria 698
425 Ga0307412_12302182 3300031911 Unclassified 503
426 Ga0307409_101995665 3300031995 Bacteria 610
427 Ga0307416_103819302 3300032002 Unclassified 504
428 Ga0307415_100347343 3300032126 Bacteria 1247
429 Ga0373938_0049949 3300034957 Unclassified 953
430 Ga0373926_0138752 3300035083 Bacteria 923
431 Ga0373926_0141468 3300035083 Bacteria 914
432 Ga0373940_0130518 3300035088 Unclassified 787
433 Ga0373923_0138946 3300035111 Unclassified 1097
434 Ga0373923_0572278 3300035111 Unclassified 555
435 Ga0373953_0315868 3300035117 Unclassified 683
436 Ga0373956_0182263 3300035119 Bacteria 993
437 Ga0373957_0211494 3300035120 Unclassified 810
438 Ga0373957_0344048 3300035120 Unclassified 636
439 Ga0373946_0221561 3300035171 Bacteria 914
440 Ga0373955_0065241 3300035172 Unclassified 2021
441 Ga0373955_0266314 3300035172 Unclassified 1029
442 Ga0373955_0488797 3300035172 Bacteria 751
443 Ga0373924_0159519 3300035410 Bacteria 989
444 Ga0373931_0076480 3300035691 Unclassified 1839
445 Ga0373931_0112563 3300035691 Bacteria 1546
446 Ga0373931_0808573 3300035691 Unclassified 625
447 Ga0373935_0782164 3300035692 Bacteria 704
448 Ga0373935_1037741 3300035692 Bacteria 609
449 Ga0373927_0074552 3300035695 Bacteria 2197
450 Ga0373927_0191319 3300035695 Bacteria 1342
451 Ga0373933_0644884 3300035724 Unclassified 696
452 Ga0373933_1163299 3300035724 Unclassified 508
453 Ga0373947_0380844 3300035725 Bacteria 950
454 Ga0373937_0091965 3300036401 Bacteria 2811
455 Ga0373937_0138065 3300036401 Bacteria 2280
456 Ga0373937_0237116 3300036401 Unclassified 1718
457 Ga0373937_0472168 3300036401 Bacteria 1191
458 Ga0373937_0961945 3300036401 Bacteria 803
459 Ga0265778_068772 3300036457 Unclassified 500
460 Ga0373925_0086841 3300037068 Bacteria 2387
461 Ga0373925_0167396 3300037068 Bacteria 1734
462 Ga0436364_0277246 3300037853 Unclassified 788
463 Ga0436364_0966861 3300037853 Unclassified 1762
464 Ga0436360_0434410 3300039438 Bacteria 2517
465 Ga0436361_0392786 3300039447 Unclassified 513
466 Ga0436361_0935906 3300039447 Unclassified 1178
467 Ga0436361_1048732 3300039447 Bacteria 796
468 Ga0436361_1176582 3300039447 Bacteria 1182
469 Ga0436362_0339898 3300039453 Unclassified 734
470 Ga0436362_0729416 3300039453 Bacteria 2646
471 Ga0439438_056996 3300041405 Bacteria 983
472 Ga0451797_1046847 3300041453 Bacteria 515
473 Ga0451795_1648187 3300041456 Bacteria 904
474 Ga0451800_1686886 3300041459 Bacteria 573
475 Ga0451806_281751 3300041462 Bacteria 1113
476 Ga0451807_0755638 3300041486 Bacteria 805
477 Ga0451807_1689975 3300041486 Bacteria 640
478 Ga0451833_0610775 3300041491 Bacteria 1498
479 Ga0451837_0970169 3300041494 Bacteria 929
480 Ga0451839_1071801 3300041496 Bacteria 1094
481 Ga0451843_0203364 3300041509 Bacteria 1164
482 Ga0451855_1018911 3300041511 Bacteria 683
483 Ga0451853_2231291 3300041512 Bacteria 2099
484 Ga0451577_0971632 3300042876 Unclassified 763
485 Ga0466966_0100680 3300044684 Bacteria 1787
486 Ga0451576_2498432 3300045051 Unclassified 528
487 Ga0466967_0097317 3300045976 Bacteria 2686
488 Ga0466967_0487274 3300045976 Bacteria 1209
489 Ga0495592_0026896 3300046454 Unclassified 4361
490 Ga0495629_0113133 3300046459 Bacteria 1892
491 Ga0495629_0590722 3300046459 Bacteria 743
492 Ga0495651_0218809 3300046462 Bacteria 1320
493 Ga0495651_0532011 3300046462 Unclassified 749
494 Ga0495580_0248184 3300046472 Unclassified 1219
495 Ga0495639_0147970 3300046475 Unclassified 1132
496 Ga0495608_0011519 3300046511 Bacteria 6154
497 Ga0495618_0143187 3300046514 Bacteria 1529
498 Ga0495618_0761011 3300046514 Unclassified 566
499 Ga0495628_0515654 3300046516 Bacteria 862
500 Ga0495630_0476617 3300046517 Bacteria 957
501 Ga0495652_0337297 3300046529 Unclassified 1084
502 Ga0495640_0054729 3300046533 Bacteria 2732
503 Ga0495586_0102180 3300046535 Bacteria 1591
504 Ga0495586_0174972 3300046535 Bacteria 1213
505 Ga0495645_0323205 3300046543 Bacteria 1001
506 Ga0495633_0492950 3300046558 Unclassified 552
507 Ga0495667_0006451 3300046559 Bacteria 7963
508 Ga0495634_0085429 3300046642 Bacteria 2056
509 Ga0495635_0168114 3300046663 Bacteria 1492
510 Ga0495657_0030386 3300046675 Bacteria 3784
511 Ga0495599_0042792 3300046678 Unclassified 2843
512 Ga0495599_0066368 3300046678 Unclassified 2254
513 Ga0495658_0037746 3300046683 Bacteria 2672
514 Ga0495658_0043161 3300046683 Unclassified 2521
515 Ga0495658_0057077 3300046683 Bacteria 2229
516 Ga0495658_0057152 3300046683 Unclassified 2228
517 Ga0495613_0212663 3300046689 Bacteria 1359
518 Ga0495613_0730049 3300046689 Bacteria 650
519 Ga0495581_0503995 3300047315 Unclassified 704
520 Ga0495604_0105627 3300047317 Bacteria 2061
521 Ga0495636_0426580 3300047318 Bacteria 634
522 Ga0495674_0510534 3300047319 Bacteria 960
523 Ga0495674_1448764 3300047319 Unclassified 510
524 Ga0495675_0119328 3300047444 Unclassified 1643
525 Ga0495684_0310442 3300047471 Unclassified 1130
526 Ga0495602_0118246 3300048088 Bacteria 2138
527 Ga0495602_0871307 3300048088 Unclassified 601
528 Ga0495614_0304741 3300048089 Unclassified 737
529 Ga0496104_0317937 3300048907 Bacteria 1470
530 Ga0496104_0365190 3300048907 Bacteria 1356
531 Ga0496108_1463055 3300048911 Unclassified 570
532 Ga0496110_1796550 3300048913 Bacteria 523
533 Ga0496114_0726755 3300048917 Bacteria 869
534 Ga0496114_1342924 3300048917 Unclassified 602
535 Ga0496122_0107356 3300048925 Bacteria 1845
536 Ga0501034_0622414 3300049571 Bacteria 983
537 Ga0501038_0452972 3300049574 Unclassified 986
538 Ga0501040_0470072 3300049576 Bacteria 906
539 Ga0501046_0283273 3300049580 Bacteria 1214
540 Ga0501067_0115830 3300049583 Bacteria 1491
541 Ga0501069_0789927 3300049585 Bacteria 575
542 Ga0501071_0120252 3300049587 Bacteria 1947
543 Ga0501075_0244521 3300049591 Bacteria 1368
544 Ga0501077_0895592 3300049593 Unclassified 571
545 Ga0501079_0218993 3300049741 Bacteria 1487
546 Ga0501081_0031893 3300049743 Unclassified 3572
547 nmdc:mga0yw44_299660_c1 3300050492 Bacteria 1077
548 nmdc:mga0yw44_843005_c1 3300050492 Bacteria 622
549 nmdc:mga0k408_484533_c1 3300050493 Bacteria 733
550 nmdc:mga06z11_28040_c1 3300050494 Bacteria 2698
551 nmdc:mga05p37_19452_c1 3300050507 Bacteria 8214
552 nmdc:mga05p37_220932_c1 3300050507 Bacteria 2286
553 nmdc:mga05p37_314284_c1 3300050507 Bacteria 1856
554 nmdc:mga05p37_41823_c1 3300050507 Bacteria 5628
555 nmdc:mga05p37_585422_c1 3300050507 Bacteria 1263
556 nmdc:mga05p37_87863_c1 3300050507 Unclassified 3832
557 nmdc:mga05p37_879319_c1 3300050507 Bacteria 969
558 nmdc:mga09592_10765_c1 3300050508 Bacteria 7436
559 nmdc:mga0qj67_138712_c1 3300050509 Bacteria 1971
560 nmdc:mga0qj67_1543638_c1 3300050509 Unclassified 510
561 nmdc:mga0qj67_870718_c1 3300050509 Bacteria 711
562 nmdc:mga06r32_1383552_c1 3300050510 Unclassified 646
563 nmdc:mga06r32_160935_c1 3300050510 Bacteria 2227
564 nmdc:mga06r32_724986_c1 3300050510 Unclassified 959
565 nmdc:mga08y16_11770_c1 3300050511 Bacteria 9191
566 nmdc:mga08y16_2137169_c1 3300050511 Unclassified 507
567 nmdc:mga08y16_5632_c1 3300050511 Bacteria 13120
568 nmdc:mga08y16_629024_c1 3300050511 Bacteria 1079
569 nmdc:mga08y16_93604_c1 3300050511 Bacteria 3130
570 nmdc:mga0n895_18107_c1 3300050512 Bacteria 6512
571 nmdc:mga0n895_196379_c1 3300050512 Bacteria 2049
572 nmdc:mga0n895_37646_c1 3300050512 Bacteria 4681
573 nmdc:mga0n895_409497_c1 3300050512 Bacteria 1371
574 nmdc:mga0n895_414308_c1 3300050512 Bacteria 1362
575 nmdc:mga0n895_68989_c1 3300050512 Bacteria 3502
576 nmdc:mga0n895_733154_c1 3300050512 Unclassified 982
577 nmdc:mga0rr50_314340_c1 3300050513 Bacteria 1312
578 nmdc:mga0rr50_481831_c1 3300050513 Unclassified 1054
579 nmdc:mga0rr50_531227_c1 3300050513 Unclassified 1001
580 nmdc:mga08x19_247641_c1 3300050514 Unclassified 1230
581 nmdc:mga0a205_705128_c1 3300050515 Bacteria 859
582 nmdc:mga0a205_818562_c1 3300050515 Unclassified 779
583 nmdc:mga0a205_90183_c1 3300050515 Unclassified 2962
584 nmdc:mga0a205_97070_c1 3300050515 Bacteria 2846
585 Ga0495612_0239988 3300053078 Bacteria 805
586 Ga0495619_0166586 3300053085 Bacteria 1523
587 Ga0495619_0856904 3300053085 Bacteria 613
588 Ga0500556_0004848 3300053104 Bacteria 3816
589 Ga0500568_0326065 3300053139 Bacteria 557
590 Ga0501084_1164872 3300054114 Unclassified 647
591 Ga0590075_024506 3300059424 Bacteria 1514
592 Ga0587066_106429 3300059490 Bacteria 645
593 Ga0587085_084813 3300059506 Unclassified 644
594 Ga0587085_101668 3300059506 Unclassified 608
595 Ga0587088_103701 3300059508 Unclassified 638
596 Ga0587091_136607 3300059511 Unclassified 610
597 Ga0587091_216429 3300059511 Unclassified 522
598 Ga0587128_066410 3300059630 Unclassified 693
599 Ga0587067_194202 3300059640 Unclassified 536
600 Ga0587069_090026 3300059642 Unclassified 612
601 Ga0587072_195379 3300059643 Bacteria 512
602 Ga0587076_081159 3300059645 Unclassified 692
603 Ga0587107_134659 3300059652 Bacteria 522
604 Ga0587120_027079 3300059659 Unclassified 571
605 Ga0587060_018590 3300060243 Unclassified 650
606 2856744597 2856741275 Bacteria 8096094
607 2891398902 2891395885 Bacteria 9251614
608 2891559112 2891554331 Bacteria 8812224
609 2891569557 2891562705 Bacteria 8039471
610 8004022977 8004021418 Bacteria 4313954
611 8004027186 8004025490 Bacteria 4327753
612 8054613659 8054609563 Bacteria 5170090
613 nmdc:mga0a205_120149_c1
614 MBSR1b_contig_859192
615 Ga0058859_10899915
616 Ga0058863_11199301
617 Ga0058860_11569542
618 Ga0065712_10449218
619 Ga0065712_10588234
620 Ga0065707_10718889
621 Ga0070658_10007832
622 Ga0070676_10477151
623 Ga0070683_100670608
624 Ga0070690_100377695
625 Ga0070690_100806897
626 Ga0070670_100038647
627 Ga0070670_100069072
628 Ga0070670_100519882
629 Ga0070670_100754231
630 Ga0068869_100903434
631 Ga0068869_101431208
632 Ga0070666_10007498
633 Ga0070666_10054394
634 Ga0070666_10990946
635 Ga0070680_100871131
636 Ga0070682_100396247
637 Ga0070682_100406731
638 Ga0068868_100002618
639 Ga0068868_100260058
640 Ga0068868_101168777
641 Ga0070689_100215257
642 Ga0070689_100472478
643 Ga0070689_100550194
644 Ga0070689_100715372
645 Ga0070689_101841576
646 Ga0070687_100035135
647 Ga0070687_101348664
648 Ga0070661_100114773
649 Ga0070661_100521251
650 Ga0070661_101485688
651 Ga0070692_10196071
652 Ga0070669_100077675
653 Ga0070669_100211690
654 Ga0070669_101250125
655 Ga0070669_101701522
656 Ga0070675_100001361
657 Ga0070675_100006332
658 Ga0070675_100027260
659 Ga0070675_100289524
660 Ga0070675_100299845
661 Ga0070675_100327732
662 Ga0070671_100031847
663 Ga0070671_100063820
664 Ga0070671_100512155
665 Ga0070671_101166866
666 Ga0070674_100842606
667 Ga0070674_100859875
668 Ga0070674_101280935
669 Ga0070673_100003151
670 Ga0070673_100011000
671 Ga0070673_100679995
672 Ga0070673_101007189
673 Ga0070688_100061044
674 Ga0070688_100232458
675 Ga0070688_100340623
676 Ga0070688_100350981
677 Ga0070667_100003787
678 Ga0070667_100031673
679 Ga0070667_100063106
680 Ga0070709_10000043
681 Ga0070709_10871913
682 Ga0070714_100796682
683 Ga0070714_100954297
684 Ga0070713_100276249
685 Ga0070713_100641001
686 Ga0070713_101155026
687 Ga0070701_10985300
688 Ga0070705_100147375
689 Ga0070705_100755814
690 Ga0070705_101841265
691 Ga0070700_101258742
692 Ga0070708_100093180
693 Ga0070708_100192232
694 Ga0070708_101249957
695 Ga0070708_101780876
696 Ga0070681_10372761
697 Ga0068867_100796766
698 Ga0068867_101452242
699 Ga0068867_101683006
700 Ga0070685_10051192
701 Ga0070685_11184743
702 Ga0070685_11385070
703 Ga0070706_100428483
704 Ga0070706_100575449
705 Ga0070706_101179843
706 Ga0070706_101598412
707 Ga0070707_100016217
708 Ga0070707_100410228
709 Ga0070707_100601487
710 Ga0070707_100849845
711 Ga0070698_102206881
712 Ga0070699_100097535
713 Ga0070699_101556016
714 Ga0070699_102219716
715 Ga0070684_100046671
716 Ga0070684_100623348
717 Ga0070672_100026217
718 Ga0070672_100176834
719 Ga0070672_102011829
720 Ga0070686_100062718
721 Ga0070686_100206563
722 Ga0070686_100404940
723 Ga0070686_101745597
724 Ga0070665_100838162
725 Ga0070665_101042105
726 Ga0068855_100019130
727 Ga0068855_100522871
728 Ga0070664_100000508
729 Ga0070664_100007161
730 Ga0070664_100246728
731 Ga0070664_100692409
732 Ga0070664_100950398
733 Ga0068857_101211003
734 Ga0068857_101374921
735 Ga0068854_100332502
736 Ga0068854_101038039
737 Ga0068856_100024912
738 Ga0068852_102759160
739 Ga0068859_100000468
740 Ga0068859_100025599
741 Ga0068859_101092011
742 Ga0068859_101464406
743 Ga0068859_103038032
744 Ga0068864_100003866
745 Ga0068864_100142516
746 Ga0068864_100975216
747 Ga0068866_10109197
748 Ga0068866_10717353
749 Ga0068861_100797910
750 Ga0068861_100884267
751 Ga0068870_11161350
752 Ga0068870_11407378
753 Ga0068863_100000307
754 Ga0068863_100096976
755 Ga0068863_100207275
756 Ga0068863_100514921
757 Ga0068863_100630360
758 Ga0068863_102265787
759 Ga0068858_100005580
760 Ga0068858_100301932
761 Ga0068858_100422823
762 Ga0068858_100456514
763 Ga0068858_100475376
764 Ga0068858_101507819
765 Ga0068858_102272733
766 Ga0068860_100003605
767 Ga0068860_100095622
768 Ga0068860_102019566
769 Ga0068862_100268343
770 Ga0068862_101157084
771 Ga0081539_10087621
772 Ga0070717_10794981
773 Ga0070717_11022431
774 Ga0075365_10007308
775 Ga0075365_10045223
776 Ga0075365_10082823
777 Ga0075365_10334252
778 Ga0075363_100361443
779 Ga0075364_10004026
780 Ga0070715_10452471
781 Ga0070716_100325974
782 Ga0070712_100161379
783 Ga0075367_10019837
784 Ga0075367_10907805
785 Ga0097621_100002253
786 Ga0097621_100266323
787 Ga0097621_100296419
788 Ga0097621_100607063
789 Ga0097621_101060820
790 Ga0097621_101514961
791 Ga0068871_100030378
792 Ga0068871_100042731
793 Ga0068871_100191837
794 Ga0068871_100472025
795 Ga0068871_101205770
796 Ga0075428_100061741
797 Ga0075428_100152880
798 Ga0075428_100288146
799 Ga0075428_100302946
800 Ga0075428_101680057
801 Ga0075428_101710998
802 Ga0075431_100080376
803 Ga0075431_101336567
804 Ga0075433_10084324
805 Ga0075433_10754028
806 Ga0075433_10786129
807 Ga0075433_10791958
808 Ga0075433_10897200
809 Ga0075434_100028312
810 Ga0075434_100124684
811 Ga0075434_100167927
812 Ga0075434_100192710
813 Ga0075434_100234032
814 Ga0075434_101421281
815 Ga0075429_101037931
816 Ga0068865_100289317
817 Ga0075436_100232794
818 Ga0075436_100832259
819 Ga0075436_101240948
820 Ga0075436_101379404
821 Ga0075436_101383320
822 Ga0097620_100000468
823 Ga0097620_100025601
824 Ga0097620_101092005
825 Ga0097620_101320674
826 Ga0097620_101464607
827 Ga0097620_103036588
828 Ga0075435_100113544
829 Ga0075435_100194871
830 Ga0075435_100404147
831 Ga0099794_10030767
832 Ga0105240_10036148
833 Ga0105240_10073726
834 Ga0111539_10006822
835 Ga0111539_10052305
836 Ga0111539_10236601
837 Ga0111539_10253050
838 Ga0111539_10256337
839 Ga0111539_11109893
840 Ga0111539_12183347
841 Ga0105247_10220836
842 Ga0105247_11619834
843 Ga0114129_10003480
844 Ga0114129_10016779
845 Ga0114129_10062430
846 Ga0114129_10112769
847 Ga0114129_10176581
848 Ga0114129_10351096
849 Ga0114129_10626763
850 Ga0114129_10943953
851 Ga0105242_10298932
852 Ga0105242_13173302
853 Ga0105248_10000090
854 Ga0105248_10001944
855 Ga0105248_10384220
856 Ga0105248_12162000
857 Ga0105237_10343589
858 Ga0105237_11697694
859 Ga0105249_11768239
860 Ga0105249_11923181
861 Ga0099796_10080180
862 Ga0105246_10534407
863 Ga0105246_10773398
864 Ga0157339_1029708
865 Ga0157370_10001553
866 Ga0157374_10163755
867 Ga0157378_10005269
868 Ga0157378_10136555
869 Ga0157378_10933362
870 Ga0163162_10016243
871 Ga0163162_10026086
872 Ga0163162_10191071
873 Ga0163162_12403952
874 Ga0157375_10000860
875 Ga0157375_10009916
876 Ga0157375_10578004
877 Ga0157375_10926355
878 Ga0157375_12065566
879 Ga0157375_13180224
880 Ga0163163_10012034
881 Ga0163163_10227302
882 Ga0163163_10651090
883 Ga0163163_10709357
884 Ga0163163_11535612
885 Ga0157380_10070761
886 Ga0157380_10539411
887 Ga0157380_13330594
888 Ga0157377_10033093
889 Ga0157377_10609327
890 Ga0157377_11773523
891 Ga0157379_10000365
892 Ga0157379_10204077
893 Ga0157379_10959206
894 Ga0157379_12604983
895 Ga0157376_10640934
896 Ga0157376_11369707
897 Ga0163161_10024305
898 Ga0163161_11313830
899 Ga0197907_10702820
900 Ga0206356_10609024
901 Ga0206356_11259333
902 Ga0206355_1561209
903 Ga0206350_10899219
904 Ga0206354_11109983
905 Ga0213873_10033831
906 Ga0213872_10274108
907 Ga0213872_10432354
908 Ga0213871_10129719
909 Ga0224712_10008548
910 Ga0224572_1080103
911 Ga0228598_1014144
912 Ga0207642_10231745
913 Ga0207642_10972953
914 Ga0207680_10004218
915 Ga0207680_10128118
916 Ga0207680_10948726
917 Ga0207680_11226811
918 Ga0207685_10508782
919 Ga0207699_10000013
920 Ga0207699_10497796
921 Ga0207645_10729994
922 Ga0207643_10951950
923 Ga0207684_10253695
924 Ga0207684_10486091
925 Ga0207707_10359390
926 Ga0207695_10038969
927 Ga0207693_10352306
928 Ga0207662_10059080
929 Ga0207649_10092104
930 Ga0207649_10220392
931 Ga0207646_10016922
932 Ga0207646_10337332
933 Ga0207646_10547199
934 Ga0207646_11322797
935 Ga0207646_11815793
936 Ga0207681_10210894
937 Ga0207681_10370868
938 Ga0207681_10872511
939 Ga0207650_10002732
940 Ga0207650_10064775
941 Ga0207650_10458798
942 Ga0207659_10000744
943 Ga0207659_10001735
944 Ga0207659_10006510
945 Ga0207659_10282348
946 Ga0207659_10400482
947 Ga0207659_11173020
948 Ga0207700_10128944
949 Ga0207700_11253010
950 Ga0207664_10924498
951 Ga0207664_11130289
952 Ga0207644_10061748
953 Ga0207644_10503495
954 Ga0207706_10512545
955 Ga0207706_10600526
956 Ga0207670_10538739
957 Ga0207670_10677242
958 Ga0207670_10727955
959 Ga0207669_10185796
960 Ga0207704_10161147
961 Ga0207704_11383618
962 Ga0207665_10472208
963 Ga0207691_10246991
964 Ga0207691_10986941
965 Ga0207691_11220425
966 Ga0207711_10002120
967 Ga0207711_10062453
968 Ga0207689_10241928
969 Ga0207689_11729467
970 Ga0207661_10690996
971 Ga0207679_10008564
972 Ga0207679_10012849
973 Ga0207679_10757210
974 Ga0207667_10174861
975 Ga0207667_11119181
976 Ga0207651_10005321
977 Ga0207651_10151873
978 Ga0207651_10952428
979 Ga0207712_10590765
980 Ga0207668_10041369
981 Ga0207640_10750142
982 Ga0207658_10014608
983 Ga0207658_11251458
984 Ga0207658_11657811
985 Ga0207677_10004186
986 Ga0207677_10691734
987 Ga0207703_10021551
988 Ga0207703_10121938
989 Ga0207703_10261854
990 Ga0207703_10794145
991 Ga0207703_11645621
992 Ga0207703_11766066
993 Ga0207678_10664196
994 Ga0207708_10413854
995 Ga0207708_10932143
996 Ga0207702_10096268
997 Ga0207702_11536933
998 Ga0207641_10001588
999 Ga0207641_10042208
1000 Ga0207641_10177057
1001 Ga0207641_10277499
1002 Ga0207641_10471230
1003 Ga0207641_12197327
1004 Ga0207641_12381844
1005 Ga0207676_10003255
1006 Ga0207676_10487935
1007 Ga0207676_10613506
1008 Ga0207674_10312822
1009 Ga0207674_11922360
1010 Ga0207675_100637777
1011 Ga0207675_101553147
1012 Ga0207698_12525465
1013 Ga0209968_1098610
1014 Ga0209974_10028246
1015 Ga0207428_10007732
1016 Ga0207428_10571709
1017 Ga0268266_10301481
1018 Ga0268265_10205180
1019 Ga0268265_10263619
1020 Ga0268265_11153507
1021 Ga0268265_11464633
1022 Ga0268264_10009710
1023 Ga0268264_10147827
1024 Ga0265770_1008943
1025 Ga0265765_1014032
1026 Ga0265760_10075817
1027 Ga0265330_10066698
1028 Ga0265332_10474481
1029 Ga0265329_10031760
1030 Ga0265339_10037130
1031 Ga0265331_10092014
1032 Ga0265316_10540234
1033 Ga0307509_10056894
1034 Ga0307410_11316674
1035 Ga0307406_10215643
1036 Ga0307406_11059252
1037 Ga0307412_12302182
1038 Ga0307409_101995665
1039 Ga0307416_103819302
1040 Ga0307415_100347343
1041 Ga0373938_0049949
1042 Ga0373926_0138752
1043 Ga0373926_0141468
1044 Ga0373940_0130518
1045 Ga0373923_0138946
1046 Ga0373923_0572278
1047 Ga0373953_0315868
1048 Ga0373956_0182263
1049 Ga0373957_0211494
1050 Ga0373957_0344048
1051 Ga0373946_0221561
1052 Ga0373955_0065241
1053 Ga0373955_0266314
1054 Ga0373955_0488797
1055 Ga0373924_0159519
1056 Ga0373931_0076480
1057 Ga0373931_0112563
1058 Ga0373931_0808573
1059 Ga0373935_0782164
1060 Ga0373935_1037741
1061 Ga0373927_0074552
1062 Ga0373927_0191319
1063 Ga0373933_0644884
1064 Ga0373933_1163299
1065 Ga0373947_0380844
1066 Ga0373937_0091965
1067 Ga0373937_0138065
1068 Ga0373937_0237116
1069 Ga0373937_0472168
1070 Ga0373937_0961945
1071 Ga0265778_068772
1072 Ga0373925_0086841
1073 Ga0373925_0167396
1074 Ga0436364_0277246
1075 Ga0436364_0966861
1076 Ga0436360_0434410
1077 Ga0436361_0392786
1078 Ga0436361_0935906
1079 Ga0436361_1048732
1080 Ga0436361_1176582
1081 Ga0436362_0339898
1082 Ga0436362_0729416
1083 Ga0439438_056996
1084 Ga0451797_1046847
1085 Ga0451795_1648187
1086 Ga0451800_1686886
1087 Ga0451806_281751
1088 Ga0451807_0755638
1089 Ga0451807_1689975
1090 Ga0451833_0610775
1091 Ga0451837_0970169
1092 Ga0451839_1071801
1093 Ga0451843_0203364
1094 Ga0451855_1018911
1095 Ga0451853_2231291
1096 Ga0451577_0971632
1097 Ga0466966_0100680
1098 Ga0451576_2498432
1099 Ga0466967_0097317
1100 Ga0466967_0487274
1101 Ga0495592_0026896
1102 Ga0495629_0113133
1103 Ga0495629_0590722
1104 Ga0495651_0218809
1105 Ga0495651_0532011
1106 Ga0495580_0248184
1107 Ga0495639_0147970
1108 Ga0495608_0011519
1109 Ga0495618_0143187
1110 Ga0495618_0761011
1111 Ga0495628_0515654
1112 Ga0495630_0476617
1113 Ga0495652_0337297
1114 Ga0495640_0054729
1115 Ga0495586_0102180
1116 Ga0495586_0174972
1117 Ga0495645_0323205
1118 Ga0495633_0492950
1119 Ga0495667_0006451
1120 Ga0495634_0085429
1121 Ga0495635_0168114
1122 Ga0495657_0030386
1123 Ga0495599_0042792
1124 Ga0495599_0066368
1125 Ga0495658_0037746
1126 Ga0495658_0043161
1127 Ga0495658_0057077
1128 Ga0495658_0057152
1129 Ga0495613_0212663
1130 Ga0495613_0730049
1131 Ga0495581_0503995
1132 Ga0495604_0105627
1133 Ga0495636_0426580
1134 Ga0495674_0510534
1135 Ga0495674_1448764
1136 Ga0495675_0119328
1137 Ga0495684_0310442
1138 Ga0495602_0118246
1139 Ga0495602_0871307
1140 Ga0495614_0304741
1141 Ga0496104_0317937
1142 Ga0496104_0365190
1143 Ga0496108_1463055
1144 Ga0496110_1796550
1145 Ga0496114_0726755
1146 Ga0496114_1342924
1147 Ga0496122_0107356
1148 Ga0501034_0622414
1149 Ga0501038_0452972
1150 Ga0501040_0470072
1151 Ga0501046_0283273
1152 Ga0501067_0115830
1153 Ga0501069_0789927
1154 Ga0501071_0120252
1155 Ga0501075_0244521
1156 Ga0501077_0895592
1157 Ga0501079_0218993
1158 Ga0501081_0031893
1159 nmdc:mga0yw44_299660_c1
1160 nmdc:mga0yw44_843005_c1
1161 nmdc:mga0k408_484533_c1
1162 nmdc:mga06z11_28040_c1
1163 nmdc:mga05p37_19452_c1
1164 nmdc:mga05p37_220932_c1
1165 nmdc:mga05p37_314284_c1
1166 nmdc:mga05p37_41823_c1
1167 nmdc:mga05p37_585422_c1
1168 nmdc:mga05p37_87863_c1
1169 nmdc:mga05p37_879319_c1
1170 nmdc:mga09592_10765_c1
1171 nmdc:mga0qj67_138712_c1
1172 nmdc:mga0qj67_1543638_c1
1173 nmdc:mga0qj67_870718_c1
1174 nmdc:mga06r32_1383552_c1
1175 nmdc:mga06r32_160935_c1
1176 nmdc:mga06r32_724986_c1
1177 nmdc:mga08y16_11770_c1
1178 nmdc:mga08y16_2137169_c1
1179 nmdc:mga08y16_5632_c1
1180 nmdc:mga08y16_629024_c1
1181 nmdc:mga08y16_93604_c1
1182 nmdc:mga0n895_18107_c1
1183 nmdc:mga0n895_196379_c1
1184 nmdc:mga0n895_37646_c1
1185 nmdc:mga0n895_409497_c1
1186 nmdc:mga0n895_414308_c1
1187 nmdc:mga0n895_68989_c1
1188 nmdc:mga0n895_733154_c1
1189 nmdc:mga0rr50_314340_c1
1190 nmdc:mga0rr50_481831_c1
1191 nmdc:mga0rr50_531227_c1
1192 nmdc:mga08x19_247641_c1
1193 nmdc:mga0a205_705128_c1
1194 nmdc:mga0a205_818562_c1
1195 nmdc:mga0a205_90183_c1
1196 nmdc:mga0a205_97070_c1
1197 Ga0495612_0239988
1198 Ga0495619_0166586
1199 Ga0495619_0856904
1200 Ga0500556_0004848
1201 Ga0500568_0326065
1202 Ga0501084_1164872
1203 Ga0590075_024506
1204 Ga0587066_106429
1205 Ga0587085_084813
1206 Ga0587085_101668
1207 Ga0587088_103701
1208 Ga0587091_136607
1209 Ga0587091_216429
1210 Ga0587128_066410
1211 Ga0587067_194202
1212 Ga0587069_090026
1213 Ga0587072_195379
1214 Ga0587076_081159
1215 Ga0587107_134659
1216 Ga0587120_027079
1217 Ga0587060_018590
1218 2856744597
1219 2891398902
1220 2891559112
1221 2891569557
1222 8004022977
1223 8004027186
1224 8054613659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

16

102

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.9655 3 88
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9633 3 91
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9424 3 91
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.9236 3 88
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.8887 4 86
ID Description Score Start End Superfamily
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9633 3 91 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9424 3 91 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8796 4 86 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8607 2 88 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8512 4 86 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A7V9DA72-F1-model_v4 MoaD family protein 0.9918 1 91
AF-A0A1Q7B304-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9915 3 87
AF-A0A382PRL3-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9905 1 87
AF-A0A5N9ASV9-F1-model_v4 MoaD/ThiS family protein 0.9897 1 91
AF-A0A2E7R553-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9864 3 91

Map