F469176

General Info

Members Datasets Scaffolds Average Seq Length
612 312 580 249

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0000267|Ga0495638_0000267_27838_28698
Length 286
Sequence MRFHNGSIEVWNYGGTSDGIGRLHPVSLHRGRTLFQEHGMKQLVAFDLDGTLAESKQPLREPMGDALADLLGVAHVAVISGGDWPQFEKQVASRLPARADLTRLWLMPTTGTKLYRYDGAWSAVYAELFDDAQKQAIFAAFDESLKATGFVPEQTWGERIEDRGSQITFSALGQQAPLDAKEHWDPDFAKRKVIQVDLRKRLPGLSINMGGATSIDITREGVDKAYGLKKLRDASGIELDAMMFIGDAIFPGGNDYPAKELGLDTVRVRDPEETLSVIAAIVACQK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
5 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
6 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
7 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
8 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
9 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
10 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
11 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
12 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
13 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
14 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
15 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
16 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
17 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
18 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
19 2909042592 Labrys sp. LIt4 Isolate Nodule
20 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
21 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
22 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
23 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
24 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
25 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
26 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
27 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
28 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
29 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
30 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
31 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
32 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
33 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
34 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
35 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
36 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
37 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
38 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
39 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
40 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
41 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
42 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
43 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
120 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
121 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
190 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
191 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
192 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
195 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
196 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
212 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
213 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
214 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
215 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
216 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
217 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
225 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
239 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
247 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
248 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
249 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
250 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
266 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
267 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
268 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
269 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
278 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
283 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
284 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
285 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
286 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
287 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
288 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
289 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
290 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
291 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
292 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
293 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
294 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
295 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
296 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
297 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
298 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
299 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
300 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
301 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
302 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
303 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
304 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
305 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
306 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
307 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
308 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
309 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
310 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
311 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
312 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.77
Metatranscriptomes 0
Isolates 5.23

Biome Distribution

Category Percentage (%)
Aerial Root 0.82
Bulb 0
Endosphere 23.53
Nodule 0.16
Rhizoplane 2.45
Rhizosphere 60.46
Stem 0
Stem Tuber 0
Unclassified 12.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2866031 2162886007 Bacteria 47061
2 SwRhRL2b_contig_860484 2162886007 Bacteria 1628
3 JGI24736J21556_1008730 3300001904 Bacteria 1681
4 JGI24741J21665_1007135 3300001915 Bacteria 2188
5 JGI24740J21852_10042393 3300001979 Bacteria 1364
6 JGI24739J22299_10000601 3300001989 Bacteria 12967
7 JGI24739J22299_10002449 3300001989 Bacteria 7159
8 JGI24739J22299_10004424 3300001989 Bacteria 5384
9 JGI24737J22298_10000720 3300001990 Bacteria 11643
10 JGI24737J22298_10071114 3300001990 Bacteria 1039
11 JGI24735J21928_10001166 3300002067 Bacteria 9407
12 JGI24735J21928_10008108 3300002067 Bacteria 3407
13 JGI24735J21928_10027700 3300002067 Bacteria 1697
14 JGI24735J21928_10034178 3300002067 Bacteria 1500
15 JGI24738J21930_10000330 3300002075 Bacteria 13051
16 JGI24738J21930_10000338 3300002075 Bacteria 12810
17 JGI24738J21930_10000440 3300002075 Bacteria 11750
18 JGI24738J21930_10010342 3300002075 Bacteria 2078
19 JGI24744J21845_10004368 3300002077 Bacteria 2921
20 JGI24751J29686_10001912 3300002459 Bacteria 4252
21 JGI25157J39369_1018117 3300002741 Bacteria 851
22 JGI25150J39212_1000020 3300002774 Bacteria 134928
23 JGI25165J46597_1000073 3300003214 Bacteria 192140
24 JGI25165J46597_1000188 3300003214 Bacteria 92329
25 JGI25153J46596_10000017 3300003215 Bacteria 274325
26 rootL2_10165951 3300003322 Bacteria 1372
27 Ga0055542_1004389 3300003762 Bacteria 3446
28 Ga0055536_1000713 3300003781 Bacteria 22261
29 Ga0055536_1011158 3300003781 Bacteria 3484
30 Ga0055530_10005655 3300003791 Bacteria 5854
31 Ga0055530_10008737 3300003791 Bacteria 4006
32 Ga0055530_10044614 3300003791 Bacteria 1062
33 Ga0055531_10003646 3300003794 Bacteria 9711
34 Ga0055531_10022471 3300003794 Bacteria 2402
35 Ga0055531_10045466 3300003794 Bacteria 1218
36 Ga0055531_10046828 3300003794 Bacteria 1184
37 Ga0065165_1004847 3300005262 Bacteria 7999
38 Ga0065704_10000192 3300005289 Bacteria 216848
39 Ga0065704_10006257 3300005289 Bacteria 2774
40 Ga0065704_10111589 3300005289 Bacteria 1950
41 Ga0065707_10101327 3300005295 Bacteria 2872
42 Ga0070658_10033853 3300005327 Bacteria 4111
43 Ga0070658_10041598 3300005327 Bacteria 3708
44 Ga0070658_10358454 3300005327 Bacteria 1249
45 Ga0070658_10528373 3300005327 Bacteria 1020
46 Ga0070676_10002175 3300005328 Bacteria 9989
47 Ga0068869_100000848 3300005334 Bacteria 17540
48 Ga0070666_10040596 3300005335 Bacteria 3106
49 Ga0068868_100000154 3300005338 Bacteria 44616
50 Ga0068868_100147581 3300005338 Bacteria 1935
51 Ga0070660_100000544 3300005339 Bacteria 25288
52 Ga0070660_100174061 3300005339 Bacteria 1740
53 Ga0070660_100211179 3300005339 Bacteria 1576
54 Ga0070660_100409501 3300005339 Bacteria 1122
55 Ga0070660_100438185 3300005339 Bacteria 1083
56 Ga0070661_100092363 3300005344 Bacteria 2242
57 Ga0070668_100615823 3300005347 Bacteria 951
58 Ga0070673_100000023 3300005364 Bacteria 91936
59 Ga0070659_100059344 3300005366 Bacteria 3021
60 Ga0070659_100059457 3300005366 Bacteria 3018
61 Ga0070659_100066008 3300005366 Bacteria 2867
62 Ga0070659_100075161 3300005366 Bacteria 2692
63 Ga0070659_100663842 3300005366 Bacteria 899
64 Ga0070667_100001100 3300005367 Bacteria 24778
65 Ga0070663_100001998 3300005455 Bacteria 11388
66 Ga0070678_100054021 3300005456 Bacteria 2924
67 Ga0070662_100002062 3300005457 Bacteria 12318
68 Ga0070662_100081846 3300005457 Bacteria 2406
69 Ga0070662_100131072 3300005457 Bacteria 1933
70 Ga0070681_10094688 3300005458 Bacteria 2935
71 Ga0068867_100000007 3300005459 Bacteria 148726
72 Ga0070684_100180891 3300005535 Bacteria 1917
73 Ga0068853_100023296 3300005539 Bacteria 5181
74 Ga0068853_100025947 3300005539 Bacteria 4918
75 Ga0068853_100069304 3300005539 Bacteria 3068
76 Ga0070672_100042427 3300005543 Bacteria 3503
77 Ga0070693_100281806 3300005547 Bacteria 1113
78 Ga0070665_100004652 3300005548 Bacteria 14330
79 Ga0068855_100000029 3300005563 Bacteria 171278
80 Ga0068855_100001148 3300005563 Bacteria 32786
81 Ga0068855_100191725 3300005563 Bacteria 2305
82 Ga0068855_100449801 3300005563 Bacteria 1406
83 Ga0070664_100424026 3300005564 Bacteria 1219
84 Ga0068857_100055573 3300005577 Bacteria 3513
85 Ga0068854_100000027 3300005578 Bacteria 117836
86 Ga0068854_100066764 3300005578 Bacteria 2619
87 Ga0068854_100154085 3300005578 Bacteria 1774
88 Ga0068854_100218332 3300005578 Bacteria 1507
89 Ga0068856_100004098 3300005614 Bacteria 14566
90 Ga0068852_100004278 3300005616 Bacteria 10072
91 Ga0068852_100006260 3300005616 Bacteria 8587
92 Ga0068852_100025178 3300005616 Bacteria 4818
93 Ga0068852_100129866 3300005616 Bacteria 2319
94 Ga0068852_100182937 3300005616 Bacteria 1972
95 Ga0068864_100002125 3300005618 Bacteria 16383
96 Ga0068866_10012667 3300005718 Bacteria 3680
97 Ga0068858_100000228 3300005842 Bacteria 60736
98 Ga0068858_100001700 3300005842 Bacteria 22479
99 Ga0068860_100286162 3300005843 Bacteria 1612
100 Ga0075365_10178714 3300006038 Bacteria 1483
101 Ga0075368_10000055 3300006042 Bacteria 27866
102 Ga0075368_10000168 3300006042 Bacteria 17741
103 Ga0075368_10000967 3300006042 Bacteria 8953
104 Ga0075368_10032193 3300006042 Bacteria 2035
105 Ga0075363_100006130 3300006048 Bacteria 5429
106 Ga0075363_100017846 3300006048 Bacteria 3527
107 Ga0075363_100096373 3300006048 Bacteria 1633
108 Ga0075364_10206394 3300006051 Bacteria 1332
109 Ga0075362_10002811 3300006177 Bacteria 5939
110 Ga0075362_10034881 3300006177 Bacteria 2195
111 Ga0075367_10000109 3300006178 Bacteria 23429
112 Ga0075367_10000289 3300006178 Bacteria 17620
113 Ga0075367_10006417 3300006178 Bacteria 5939
114 Ga0075367_10049680 3300006178 Bacteria 2473
115 Ga0075369_10095090 3300006186 Bacteria 1332
116 Ga0075369_10155901 3300006186 Bacteria 1045
117 Ga0075366_10037690 3300006195 Bacteria 2855
118 Ga0075366_10076800 3300006195 Bacteria 1993
119 Ga0075366_10143533 3300006195 Bacteria 1444
120 Ga0097621_100002061 3300006237 Bacteria 13748
121 Ga0075370_10000257 3300006353 Bacteria 18995
122 Ga0075370_10026515 3300006353 Bacteria 3211
123 Ga0075370_10050753 3300006353 Bacteria 2353
124 Ga0075370_10085395 3300006353 Bacteria 1817
125 Ga0075370_10125899 3300006353 Bacteria 1493
126 Ga0068871_100002074 3300006358 Bacteria 13555
127 Ga0068865_100000010 3300006881 Bacteria 159548
128 Ga0105240_10013748 3300009093 Bacteria 11095
129 Ga0105240_10017476 3300009093 Bacteria 9666
130 Ga0105240_10070818 3300009093 Bacteria 4313
131 Ga0105240_10304868 3300009093 Bacteria 1821
132 Ga0105245_10002089 3300009098 Bacteria 18117
133 Ga0105245_10009485 3300009098 Bacteria 8488
134 Ga0114129_10149346 3300009147 Bacteria 3198
135 Ga0105243_10000950 3300009148 Bacteria 27049
136 Ga0105243_10056170 3300009148 Bacteria 3129
137 Ga0105243_10294328 3300009148 Bacteria 1468
138 Ga0105243_10715950 3300009148 Bacteria 977
139 Ga0105241_10045550 3300009174 Bacteria 3328
140 Ga0105241_10415116 3300009174 Bacteria 1183
141 Ga0105242_10000210 3300009176 Bacteria 45627
142 Ga0105248_10010320 3300009177 Bacteria 10279
143 Ga0105248_10017254 3300009177 Bacteria 7955
144 Ga0105237_10010097 3300009545 Bacteria 10069
145 Ga0105237_10051294 3300009545 Bacteria 4144
146 Ga0105237_10458234 3300009545 Bacteria 1281
147 Ga0105237_10585404 3300009545 Bacteria 1123
148 Ga0105238_10027777 3300009551 Bacteria 5766
149 Ga0105238_10226524 3300009551 Bacteria 1846
150 Ga0105238_10473056 3300009551 Bacteria 1252
151 Ga0105249_10017303 3300009553 Bacteria 6400
152 Ga0105148_100253 3300009978 Bacteria 7295
153 Ga0105239_10000025 3300010375 Bacteria 254049
154 Ga0105239_10004123 3300010375 Bacteria 17464
155 Ga0105239_10031481 3300010375 Bacteria 5833
156 Ga0105239_10046782 3300010375 Bacteria 4741
157 Ga0105246_10000472 3300011119 Bacteria 21681
158 Ga0157373_10047916 3300013100 Bacteria 3047
159 Ga0157373_10084627 3300013100 Bacteria 2235
160 Ga0157373_10264350 3300013100 Bacteria 1218
161 Ga0157371_10211638 3300013102 Bacteria 1391
162 Ga0157370_10000203 3300013104 Bacteria 75249
163 Ga0157370_10074058 3300013104 Bacteria 3212
164 Ga0157369_10057364 3300013105 Bacteria 4202
165 Ga0157369_10203149 3300013105 Bacteria 2079
166 Ga0157369_10511326 3300013105 Bacteria 1242
167 Ga0157374_10000830 3300013296 Bacteria 27049
168 Ga0157374_10045139 3300013296 Bacteria 4078
169 Ga0157374_10071508 3300013296 Bacteria 3271
170 Ga0157374_10103118 3300013296 Bacteria 2737
171 Ga0157378_10001477 3300013297 Bacteria 21228
172 Ga0157378_10084028 3300013297 Bacteria 2882
173 Ga0157378_10166335 3300013297 Bacteria 2066
174 Ga0163162_10001078 3300013306 Bacteria 25383
175 Ga0163162_10446220 3300013306 Bacteria 1426
176 Ga0157372_10010036 3300013307 Bacteria 10070
177 Ga0157372_10058023 3300013307 Bacteria 4327
178 Ga0157372_10179976 3300013307 Bacteria 2447
179 Ga0157372_10339814 3300013307 Bacteria 1749
180 Ga0157375_10002120 3300013308 Bacteria 17145
181 Ga0157376_10000047 3300014969 Bacteria 107974
182 Ga0183363_1002 3300015690 Bacteria 425040
183 Ga0163161_10013007 3300017792 Bacteria 5783
184 Ga0207427_101974 3300025231 Bacteria 6255
185 Ga0207425_1000022 3300025245 Bacteria 355305
186 Ga0209646_1021491 3300025246 Bacteria 926
187 Ga0209026_1002441 3300025250 Bacteria 6982
188 Ga0209026_1004353 3300025250 Bacteria 4235
189 Ga0209148_1000061 3300025254 Bacteria 349575
190 Ga0209148_1001013 3300025254 Bacteria 17719
191 Ga0209129_1000286 3300025258 Bacteria 48191
192 Ga0209233_1000120 3300025261 Bacteria 233311
193 Ga0209233_1000142 3300025261 Bacteria 192193
194 Ga0209565_1007352 3300025263 Bacteria 2981
195 Ga0209455_1000692 3300025272 Bacteria 19864
196 Ga0209675_1000126 3300025291 Bacteria 104792
197 Ga0209676_1000566 3300025292 Bacteria 55814
198 Ga0209676_1008708 3300025292 Bacteria 4479
199 Ga0209676_1009141 3300025292 Bacteria 4313
200 Ga0209676_1026483 3300025292 Bacteria 1840
201 Ga0209025_1001464 3300025294 Bacteria 30863
202 Ga0209025_1019511 3300025294 Bacteria 3766
203 Ga0209025_1075443 3300025294 Bacteria 1173
204 Ga0209758_1000004 3300025297 Bacteria 1375322
205 Ga0209050_1000001 3300025298 Bacteria 3563507
206 Ga0209050_1000047 3300025298 Bacteria 380561
207 Ga0209050_1000127 3300025298 Bacteria 187951
208 Ga0209051_1000246 3300025303 Bacteria 91170
209 Ga0209257_1000517 3300025304 Bacteria 67082
210 Ga0209257_1002394 3300025304 Bacteria 18771
211 Ga0209257_1002888 3300025304 Bacteria 15965
212 Ga0209257_1010863 3300025304 Bacteria 4507
213 Ga0209257_1030916 3300025304 Bacteria 1720
214 Ga0207697_10086321 3300025315 Bacteria 1326
215 Ga0207656_10059287 3300025321 Bacteria 1675
216 Ga0207642_10007810 3300025899 Bacteria 3631
217 Ga0207688_10080907 3300025901 Bacteria 1855
218 Ga0207680_10022733 3300025903 Bacteria 3414
219 Ga0207647_10000270 3300025904 Bacteria 42605
220 Ga0207647_10016335 3300025904 Bacteria 5068
221 Ga0207647_10017291 3300025904 Bacteria 4902
222 Ga0207647_10051484 3300025904 Bacteria 2545
223 Ga0207647_10054292 3300025904 Bacteria 2466
224 Ga0207647_10065747 3300025904 Bacteria 2200
225 Ga0207645_10029542 3300025907 Bacteria 3533
226 Ga0207705_10000316 3300025909 Bacteria 44059
227 Ga0207705_10000963 3300025909 Bacteria 23546
228 Ga0207705_10009514 3300025909 Bacteria 7072
229 Ga0207705_10369159 3300025909 Bacteria 1107
230 Ga0207705_10525168 3300025909 Bacteria 920
231 Ga0207654_10342347 3300025911 Bacteria 1027
232 Ga0207695_10008358 3300025913 Bacteria 12966
233 Ga0207695_10041776 3300025913 Bacteria 4905
234 Ga0207695_10057479 3300025913 Bacteria 4040
235 Ga0207671_10002163 3300025914 Bacteria 21356
236 Ga0207671_10098859 3300025914 Bacteria 2208
237 Ga0207671_10107147 3300025914 Bacteria 2122
238 Ga0207657_10003918 3300025919 Bacteria 15794
239 Ga0207657_10049263 3300025919 Bacteria 3673
240 Ga0207657_10057737 3300025919 Bacteria 3343
241 Ga0207649_10067641 3300025920 Bacteria 2269
242 Ga0207681_10047485 3300025923 Bacteria 2893
243 Ga0207694_10217153 3300025924 Bacteria 1559
244 Ga0207650_10203060 3300025925 Bacteria 1589
245 Ga0207687_10006744 3300025927 Bacteria 7566
246 Ga0207687_10027727 3300025927 Bacteria 3802
247 Ga0207644_10224943 3300025931 Bacteria 1489
248 Ga0207690_10077238 3300025932 Bacteria 2314
249 Ga0207690_10123350 3300025932 Bacteria 1885
250 Ga0207690_10207593 3300025932 Bacteria 1491
251 Ga0207690_10227985 3300025932 Bacteria 1429
252 Ga0207690_10430273 3300025932 Bacteria 1057
253 Ga0207706_10004159 3300025933 Bacteria 13640
254 Ga0207706_10019782 3300025933 Bacteria 6053
255 Ga0207706_10103379 3300025933 Bacteria 2506
256 Ga0207709_10000050 3300025935 Bacteria 234391
257 Ga0207704_10000020 3300025938 Bacteria 148847
258 Ga0207711_10005221 3300025941 Bacteria 11005
259 Ga0207711_10056418 3300025941 Bacteria 3376
260 Ga0207689_10001541 3300025942 Bacteria 21894
261 Ga0207661_10055536 3300025944 Bacteria 3177
262 Ga0207667_10000035 3300025949 Bacteria 301056
263 Ga0207667_10004932 3300025949 Bacteria 16295
264 Ga0207667_10075657 3300025949 Bacteria 3495
265 Ga0207667_10131103 3300025949 Bacteria 2582
266 Ga0207667_10697721 3300025949 Bacteria 1018
267 Ga0207651_10000005 3300025960 Bacteria 246132
268 Ga0207712_10097162 3300025961 Bacteria 2182
269 Ga0207668_10273471 3300025972 Bacteria 1382
270 Ga0207640_10000145 3300025981 Bacteria 51603
271 Ga0207640_10056590 3300025981 Bacteria 2575
272 Ga0207640_10059222 3300025981 Bacteria 2527
273 Ga0207640_10332653 3300025981 Bacteria 1214
274 Ga0207658_10000571 3300025986 Bacteria 33340
275 Ga0207677_10000373 3300026023 Bacteria 31103
276 Ga0207703_10000976 3300026035 Bacteria 27501
277 Ga0207703_10004598 3300026035 Bacteria 11293
278 Ga0207639_10002511 3300026041 Bacteria 12308
279 Ga0207639_10007809 3300026041 Bacteria 7304
280 Ga0207639_10332655 3300026041 Bacteria 1352
281 Ga0207678_10005889 3300026067 Bacteria 10929
282 Ga0207678_10249930 3300026067 Bacteria 1518
283 Ga0207678_10320657 3300026067 Bacteria 1333
284 Ga0207702_10003711 3300026078 Bacteria 13808
285 Ga0207702_10012620 3300026078 Bacteria 7034
286 Ga0207702_10037699 3300026078 Bacteria 4047
287 Ga0207702_10245821 3300026078 Bacteria 1678
288 Ga0207648_10000017 3300026089 Bacteria 148699
289 Ga0207676_10000190 3300026095 Bacteria 53850
290 Ga0207676_10348384 3300026095 Bacteria 1369
291 Ga0207674_10015748 3300026116 Bacteria 8294
292 Ga0207674_10022819 3300026116 Bacteria 6715
293 Ga0207674_10776312 3300026116 Bacteria 925
294 Ga0207674_10892142 3300026116 Bacteria 857
295 Ga0207683_10029414 3300026121 Bacteria 4757
296 Ga0207698_10000712 3300026142 Bacteria 19239
297 Ga0207698_10036634 3300026142 Bacteria 3603
298 Ga0207698_10036776 3300026142 Bacteria 3598
299 Ga0207698_10038607 3300026142 Bacteria 3530
300 Ga0207698_10713009 3300026142 Bacteria 999
301 Ga0209813_10000048 3300027866 Bacteria 48973
302 Ga0209813_10000191 3300027866 Bacteria 19193
303 Ga0209813_10000220 3300027866 Bacteria 17618
304 Ga0268266_10889770 3300028379 Bacteria 861
305 Ga0268264_10245060 3300028381 Bacteria 1662
306 Ga0307517_10026027 3300028786 Bacteria 7113
307 Ga0307513_10061622 3300031456 Bacteria 3971
308 Ga0307513_10256515 3300031456 Bacteria 1541
309 Ga0307508_10004238 3300031616 Bacteria 14080
310 Ga0307510_10191540 3300033180 Bacteria 1592
311 Ga0373946_0289600 3300035171 Bacteria 807
312 Ga0395899_0002116 3300037312 Bacteria 16321
313 Ga0395899_0317704 3300037312 Bacteria 1050
314 Ga0395900_0260720 3300037418 Bacteria 1731
315 Ga0395905_0497526 3300037471 Bacteria 1119
316 Ga0436364_1389735 3300037853 Bacteria 3606
317 Ga0395901_0245370 3300038443 Bacteria 1867
318 Ga0436365_1211005 3300039437 Bacteria 1323
319 Ga0436363_0389907 3300039450 Bacteria 1756
320 Ga0451802_0044966 3300041460 Bacteria 2341
321 Ga0451806_660356 3300041462 Bacteria 3795
322 Ga0451804_0756293 3300041463 Bacteria 1937
323 Ga0451807_2284404 3300041486 Bacteria 1071
324 Ga0451853_1879690 3300041512 Bacteria 3625
325 Ga0439448_0002573 3300042005 Bacteria 4944
326 Ga0439448_0003494 3300042005 Bacteria 4352
327 Ga0439448_0027604 3300042005 Bacteria 1790
328 Ga0439448_0038338 3300042005 Bacteria 1542
329 Ga0439455_0000252 3300042012 Bacteria 6482
330 Ga0439455_0000304 3300042012 Bacteria 6168
331 Ga0439455_0054729 3300042012 Bacteria 1048
332 Ga0439458_0000255 3300042157 Bacteria 12956
333 Ga0439458_0000305 3300042157 Bacteria 12201
334 Ga0439458_0026115 3300042157 Bacteria 1372
335 Ga0466972_0274254 3300044658 Bacteria 788
336 Ga0466966_0019647 3300044684 Bacteria 4445
337 Ga0466963_0008961 3300044694 Bacteria 6006
338 Ga0466964_0012394 3300044706 Bacteria 3226
339 Ga0466964_0018224 3300044706 Bacteria 2692
340 Ga0466971_0000834 3300044719 Bacteria 12515
341 Ga0466968_0054687 3300044735 Bacteria 1711
342 Ga0466970_0012023 3300044765 Bacteria 4420
343 Ga0466957_0274396 3300044842 Bacteria 1127
344 Ga0466960_0014885 3300044901 Bacteria 3342
345 Ga0495627_000582 3300046453 Bacteria 29200
346 Ga0495629_0157525 3300046459 Bacteria 1578
347 Ga0495638_0000267 3300046460 Bacteria 70470
348 Ga0495638_0080909 3300046460 Bacteria 1973
349 Ga0495638_0144399 3300046460 Bacteria 1386
350 Ga0495638_0156654 3300046460 Bacteria 1317
351 Ga0495650_0001090 3300046471 Bacteria 29761
352 Ga0495650_0049328 3300046471 Bacteria 1749
353 Ga0495605_0069453 3300046474 Bacteria 1668
354 Ga0495584_0014651 3300046491 Bacteria 3995
355 Ga0495596_0000196 3300046500 Bacteria 41923
356 Ga0495596_0000537 3300046500 Bacteria 23841
357 Ga0495607_0016964 3300046501 Bacteria 4688
358 Ga0495607_0047613 3300046501 Bacteria 2511
359 Ga0495583_0000030 3300046506 Bacteria 254970
360 Ga0495583_0000252 3300046506 Bacteria 88617
361 Ga0495606_0044223 3300046507 Bacteria 2964
362 Ga0495606_0116794 3300046507 Bacteria 1602
363 Ga0495610_0000081 3300046512 Bacteria 113513
364 Ga0495610_0001175 3300046512 Bacteria 23733
365 Ga0495610_0003890 3300046512 Bacteria 11329
366 Ga0495610_0027251 3300046512 Bacteria 3039
367 Ga0495610_0047804 3300046512 Bacteria 2103
368 Ga0495620_0013539 3300046515 Bacteria 4173
369 Ga0495632_0000007 3300046519 Bacteria 343246
370 Ga0495632_0000306 3300046519 Bacteria 47401
371 Ga0495632_0027007 3300046519 Bacteria 3013
372 Ga0495637_0000569 3300046520 Bacteria 26380
373 Ga0495637_0033327 3300046520 Bacteria 2263
374 Ga0495637_0077167 3300046520 Bacteria 1334
375 Ga0495643_0000042 3300046522 Bacteria 229665
376 Ga0495643_0000304 3300046522 Bacteria 68483
377 Ga0495643_0007419 3300046522 Bacteria 7074
378 Ga0495643_0021213 3300046522 Bacteria 3731
379 Ga0495648_0037584 3300046524 Bacteria 3109
380 Ga0495663_0000005 3300046525 Bacteria 342265
381 Ga0495663_0018295 3300046525 Bacteria 1995
382 Ga0495654_0034814 3300046530 Bacteria 2539
383 Ga0495654_0043751 3300046530 Bacteria 2218
384 Ga0495609_0007089 3300046538 Bacteria 5641
385 Ga0495622_0006810 3300046557 Bacteria 5304
386 Ga0495633_0000491 3300046558 Bacteria 39973
387 Ga0495633_0001879 3300046558 Bacteria 15338
388 Ga0495668_0000001 3300046616 Bacteria 1013420
389 Ga0495611_0098653 3300046648 Bacteria 1355
390 Ga0495611_0256250 3300046648 Bacteria 810
391 Ga0495625_0000671 3300046660 Bacteria 48757
392 Ga0495625_0002401 3300046660 Bacteria 20305
393 Ga0495625_0035771 3300046660 Bacteria 3657
394 Ga0495625_0050839 3300046660 Bacteria 2972
395 Ga0495625_0057335 3300046660 Bacteria 2770
396 Ga0495625_0063243 3300046660 Bacteria 2614
397 Ga0495625_0085854 3300046660 Bacteria 2184
398 Ga0495661_0033156 3300046665 Bacteria 3259
399 Ga0495670_0013380 3300046691 Bacteria 4036
400 Ga0495670_0028819 3300046691 Bacteria 2753
401 Ga0495670_0243820 3300046691 Bacteria 957
402 Ga0495671_0000011 3300046692 Bacteria 365582
403 Ga0495671_0000126 3300046692 Bacteria 68483
404 Ga0495671_0042256 3300046692 Bacteria 2292
405 Ga0495671_0115065 3300046692 Bacteria 1313
406 Ga0495671_0123561 3300046692 Bacteria 1262
407 Ga0495676_0203871 3300047321 Bacteria 1373
408 Ga0495677_0034004 3300047445 Bacteria 1859
409 Ga0495673_0000013 3300047469 Bacteria 612902
410 Ga0495681_0000517 3300047470 Bacteria 29470
411 Ga0495681_0002422 3300047470 Bacteria 13333
412 Ga0495681_0041330 3300047470 Bacteria 2239
413 Ga0495686_0000063 3300047472 Bacteria 228575
414 Ga0495686_0000082 3300047472 Bacteria 200115
415 Ga0495686_0000401 3300047472 Bacteria 68555
416 Ga0495686_0000661 3300047472 Bacteria 46810
417 Ga0495686_0009632 3300047472 Bacteria 6938
418 Ga0495686_0020603 3300047472 Bacteria 4395
419 Ga0495686_0027175 3300047472 Bacteria 3738
420 Ga0495686_0082333 3300047472 Bacteria 1964
421 Ga0495686_0104101 3300047472 Bacteria 1709
422 Ga0495615_0000020 3300048090 Bacteria 53202
423 Ga0495626_0000298 3300048091 Bacteria 53039
424 Ga0496102_0197094 3300048905 Unclassified 1898
425 Ga0496102_0586199 3300048905 Bacteria 1038
426 Ga0496103_0348167 3300048906 Bacteria 953
427 Ga0496110_0050768 3300048913 Bacteria 3643
428 Ga0496110_0609108 3300048913 Bacteria 990
429 Ga0496111_0033642 3300048914 Bacteria 3657
430 Ga0496111_0107898 3300048914 Bacteria 2050
431 Ga0496111_0413687 3300048914 Bacteria 996
432 Ga0496113_0092142 3300048916 Bacteria 2337
433 Ga0496115_0000285 3300048918 Bacteria 43764
434 Ga0496116_0000035 3300048919 Bacteria 402424
435 Ga0496116_0047806 3300048919 Bacteria 2877
436 Ga0496117_0011402 3300048920 Bacteria 7961
437 Ga0496117_0043351 3300048920 Bacteria 3272
438 Ga0496117_0047825 3300048920 Bacteria 3063
439 Ga0496117_0057221 3300048920 Bacteria 2710
440 Ga0496117_0119468 3300048920 Bacteria 1622
441 Ga0496118_0015807 3300048921 Bacteria 6962
442 Ga0496118_0030413 3300048921 Bacteria 4507
443 Ga0496118_0035164 3300048921 Bacteria 4074
444 Ga0496118_0036903 3300048921 Bacteria 3943
445 Ga0496118_0139977 3300048921 Bacteria 1536
446 Ga0496119_0033280 3300048922 Bacteria 3421
447 Ga0496119_0052623 3300048922 Bacteria 2493
448 Ga0496120_0102515 3300048923 Bacteria 1509
449 Ga0496121_0000105 3300048924 Bacteria 191437
450 Ga0496121_0000579 3300048924 Bacteria 68757
451 Ga0496121_0000671 3300048924 Bacteria 63867
452 Ga0496121_0002960 3300048924 Bacteria 24756
453 Ga0496121_0002979 3300048924 Bacteria 24637
454 Ga0496121_0003092 3300048924 Bacteria 24067
455 Ga0496121_0003231 3300048924 Bacteria 23434
456 Ga0496121_0030578 3300048924 Bacteria 4943
457 Ga0496122_0005685 3300048925 Bacteria 14721
458 Ga0496122_0018901 3300048925 Bacteria 6329
459 Ga0496122_0026933 3300048925 Bacteria 4935
460 Ga0496123_0000159 3300048926 Bacteria 136014
461 Ga0496123_0002459 3300048926 Bacteria 22941
462 Ga0496123_0003542 3300048926 Bacteria 17370
463 Ga0496123_0003707 3300048926 Bacteria 16803
464 Ga0496124_0002365 3300048927 Bacteria 24886
465 Ga0496124_0005911 3300048927 Bacteria 13541
466 Ga0496124_0015727 3300048927 Bacteria 7234
467 Ga0496124_0030523 3300048927 Bacteria 4783
468 Ga0496124_0038486 3300048927 Bacteria 4153
469 Ga0496124_0046585 3300048927 Bacteria 3712
470 Ga0496124_0067837 3300048927 Bacteria 2966
471 Ga0496124_0090965 3300048927 Bacteria 2487
472 Ga0496124_0155365 3300048927 Bacteria 1790
473 Ga0496124_0235082 3300048927 Bacteria 1367
474 Ga0496124_0262178 3300048927 Bacteria 1271
475 Ga0496125_0012910 3300048928 Bacteria 8247
476 Ga0496125_0031437 3300048928 Bacteria 4731
477 Ga0496125_0040553 3300048928 Bacteria 3992
478 Ga0496125_0121127 3300048928 Bacteria 1866
479 Ga0496125_0215487 3300048928 Bacteria 1242
480 Ga0496126_0000077 3300048929 Bacteria 231592
481 Ga0496126_0001878 3300048929 Bacteria 30558
482 Ga0496126_0014533 3300048929 Bacteria 7953
483 Ga0496126_0058122 3300048929 Bacteria 3487
484 Ga0496126_0112148 3300048929 Bacteria 2375
485 Ga0496126_0196016 3300048929 Bacteria 1708
486 Ga0496126_0320266 3300048929 Bacteria 1275
487 Ga0495682_0125592 3300049460 Bacteria 918
488 Ga0501033_0000215 3300049570 Bacteria 55477
489 Ga0501036_0095571 3300049572 Bacteria 2512
490 Ga0501037_0145969 3300049573 Bacteria 1692
491 Ga0501038_0106928 3300049574 Bacteria 2321
492 Ga0501043_0072900 3300049579 Bacteria 2697
493 Ga0501047_0001117 3300049581 Bacteria 26643
494 Ga0501047_0009954 3300049581 Bacteria 8991
495 Ga0501073_0212203 3300049589 Bacteria 1338
496 Ga0501211_001344 3300049658 Bacteria 2623
497 Ga0501223_000064 3300049663 Bacteria 34167
498 Ga0501235_001360 3300049669 Bacteria 5179
499 Ga0501225_0000063 3300049705 Bacteria 34813
500 Ga0501245_005207 3300049708 Bacteria 1799
501 Ga0501044_0000160 3300049823 Bacteria 83543
502 Ga0501044_0079519 3300049823 Bacteria 3322
503 Ga0501044_0256729 3300049823 Bacteria 1687
504 nmdc:mga03683_10661_c1 3300050489 Bacteria 3302
505 nmdc:mga03683_16551_c1 3300050489 Bacteria 2772
506 nmdc:mga03683_927_c1 3300050489 Bacteria 8482
507 nmdc:mga03n38_30348_c1 3300050490 Bacteria 2272
508 nmdc:mga03n38_82620_c1 3300050490 Bacteria 1513
509 nmdc:mga00v17_11965_c1 3300050491 Bacteria 4776
510 nmdc:mga00v17_1563_c1 3300050491 Bacteria 11955
511 nmdc:mga00v17_3583_c1 3300050491 Bacteria 8021
512 nmdc:mga0yw44_158276_c1 3300050492 Bacteria 1482
513 nmdc:mga0yw44_330966_c1 3300050492 Bacteria 1024
514 nmdc:mga0k408_149619_c1 3300050493 Bacteria 1390
515 nmdc:mga0k408_3784_c1 3300050493 Bacteria 8022
516 nmdc:mga0k408_39900_c2 3300050493 Bacteria 2077
517 nmdc:mga06z11_117_c1 3300050494 Bacteria 32760
518 nmdc:mga06z11_295_c1 3300050494 Bacteria 19152
519 nmdc:mga04h51_162_c1 3300050495 Bacteria 19154
520 nmdc:mga04h51_178_c1 3300050495 Bacteria 17872
521 nmdc:mga04h51_29230_c1 3300050495 Bacteria 1725
522 nmdc:mga04h51_656_c1 3300050495 Bacteria 8066
523 nmdc:mga07m45_21157_c1 3300050496 Bacteria 3539
524 nmdc:mga07m45_22_c1 3300050496 Bacteria 117399
525 nmdc:mga07m45_40998_c1 3300050496 Bacteria 2592
526 nmdc:mga07m45_70616_c1 3300050496 Bacteria 1383
527 nmdc:mga07m45_9859_c1 3300050496 Bacteria 4968
528 nmdc:mga05p37_127775_c1 3300050507 Bacteria 3120
529 nmdc:mga0sz30_144328_c1 3300050516 Bacteria 1052
530 nmdc:mga0sz30_48389_c1 3300050516 Bacteria 1799
531 nmdc:mga0sz30_714_c2 3300050516 Bacteria 2578
532 Ga0495619_0384861 3300053085 Bacteria 969
533 Ga0500643_000385 3300053087 Bacteria 34308
534 Ga0500643_002094 3300053087 Bacteria 10622
535 Ga0500647_0066437 3300053091 Bacteria 1734
536 Ga0500651_0345311 3300053093 Bacteria 845
537 Ga0500641_0061888 3300053096 Bacteria 1560
538 Ga0500555_000163 3300053103 Bacteria 31013
539 Ga0500592_001641 3300053116 Bacteria 3633
540 Ga0500594_0009144 3300053118 Bacteria 2276
541 Ga0500597_019103 3300053120 Bacteria 2670
542 Ga0500607_000065 3300053121 Bacteria 74437
543 Ga0500607_000386 3300053121 Bacteria 42198
544 Ga0500614_016829 3300053123 Bacteria 1646
545 Ga0500618_013410 3300053125 Bacteria 2117
546 Ga0500618_031599 3300053125 Bacteria 1241
547 Ga0500642_0000574 3300053130 Bacteria 11074
548 Ga0500655_000165 3300053133 Bacteria 16205
549 Ga0500658_0007915 3300053134 Bacteria 3927
550 Ga0500559_0000668 3300053136 Bacteria 22938
551 Ga0500559_0012091 3300053136 Bacteria 3676
552 Ga0500559_0013370 3300053136 Bacteria 3477
553 Ga0500559_0059748 3300053136 Bacteria 1698
554 Ga0500568_0026023 3300053139 Bacteria 2460
555 Ga0500577_0012472 3300053142 Bacteria 2571
556 Ga0500577_0120786 3300053142 Bacteria 1090
557 Ga0500577_0132164 3300053142 Bacteria 1047
558 Ga0500590_000953 3300053148 Bacteria 11128
559 Ga0500616_0010849 3300053153 Bacteria 5431
560 Ga0500616_0035196 3300053153 Bacteria 2724
561 Ga0500616_0041068 3300053153 Bacteria 2484
562 Ga0500616_0129036 3300053153 Bacteria 1197
563 Ga0500616_0152766 3300053153 Eukaryota 1067
564 Ga0500622_0002328 3300053156 Bacteria 13870
565 Ga0500622_0034813 3300053156 Bacteria 2637
566 Ga0500622_0132477 3300053156 Bacteria 1197
567 Ga0500624_000012 3300053157 Bacteria 165895
568 Ga0500624_000020 3300053157 Bacteria 118392
569 Ga0500624_000061 3300053157 Bacteria 66422
570 Ga0500627_0000013 3300053158 Bacteria 136204
571 Ga0500639_096613 3300053163 Bacteria 1462
572 Ga0500636_0001685 3300053177 Bacteria 12100
573 Ga0500636_0041154 3300053177 Bacteria 2733
574 Ga0500637_0000022 3300053178 Bacteria 61494
575 Ga0500637_0006428 3300053178 Bacteria 5788
576 Ga0500570_053881 3300053724 Bacteria 2000
577 Ga0500645_020731 3300053730 Bacteria 2034
578 Ga0500645_037940 3300053730 Bacteria 1430
579 Ga0500661_004899 3300055283 Bacteria 2504
580 Ga0466962_0011448 3300061719 Bacteria 4270

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048906 Ga0496103_0348167 Ga0496103_0348167_13_654 213
2 3300002075 JGI24738J21930_10000330 JGI24738J21930_1000033014 214
3 3300003794 Ga0055531_10046828 Ga0055531_100468281 215
4 3300053085 Ga0495619_0384861 Ga0495619_0384861_127_876 231
5 3300025263 Ga0209565_1007352 Ga0209565_10073523 233
6 3300025291 Ga0209675_1000126 Ga0209675_100012685 233
7 3300025292 Ga0209676_1000566 Ga0209676_100056634 233
8 3300025294 Ga0209025_1019511 Ga0209025_10195113 233
9 3300025298 Ga0209050_1000047 Ga0209050_100004710 233
10 3300048929 Ga0496126_0196016 Ga0496126_0196016_541_1314 233
11 3300048929 Ga0496126_0320266 Ga0496126_0320266_307_1053 233
12 3300003781 Ga0055536_1000713 Ga0055536_10007135 234
13 3300049570 Ga0501033_0000215 Ga0501033_0000215_8537_9283 237
14 3300049572 Ga0501036_0095571 Ga0501036_0095571_289_1035 237
15 3300049573 Ga0501037_0145969 Ga0501037_0145969_678_1424 237
16 3300049574 Ga0501038_0106928 Ga0501038_0106928_634_1380 237
17 3300049581 Ga0501047_0009954 Ga0501047_0009954_3583_4329 237
18 3300049823 Ga0501044_0000160 Ga0501044_0000160_34405_35151 237
19 3300031456 Ga0307513_10061622 Ga0307513_100616222 238
20 3300009147 Ga0114129_10149346 Ga0114129_101493462 242
21 3300050507 nmdc:mga05p37_127775_c1 nmdc:mga05p37_127775_c1_2235_2981 242
22 iso_pu_bacteria 2582581305 2585262113 243
23 iso_pu_bacteria 2582581305 2585262301 243
24 iso_pu_bacteria 2643221541 2643731408 243
25 iso_pu_bacteria 2643221606 2644042264 243
26 iso_pu_bacteria 2643221671 2644394094 243
27 iso_pu_bacteria 2946787523 2946789654 243
28 iso_pu_bacteria 2512564014 2512645509 244
29 iso_pu_bacteria 2643221560 2643822632 244
30 iso_pu_bacteria 2643221560 2643822876 244
31 iso_pu_bacteria 2830075706 2830076898 244
32 iso_pu_bacteria 2852653556 2852656830 244
33 iso_pu_bacteria 2852680915 2852683925 244
34 iso_pu_bacteria 2909042592 2909047266 244
35 iso_pu_bacteria 2928027323 2928030365 244
36 iso_pu_bacteria 2984555340 2984555766 244
37 iso_pu_bacteria 2984564862 2984566124 244
38 iso_pu_bacteria 2990265787 2990268660 244
39 iso_pu_bacteria 2993356040 2993357136 244
40 iso_pu_bacteria 2993693658 2993694634 244
41 iso_pu_bacteria 8057101203 8057101691 244
42 iso_pu_bacteria 2510917021 2511128233 245
43 iso_pu_bacteria 2599185354 2600200538 245
44 iso_pu_bacteria 2808606401 2809064602 245
45 iso_pu_bacteria 2808606404 2809080487 245
46 iso_pu_bacteria 2808606405 2809084851 245
47 iso_pu_bacteria 2852680915 2852683846 245
48 3300048924 Ga0496121_0000105 Ga0496121_0000105_133409_134149 246
49 iso_pu_bacteria 2643221563 2643833855 246
50 iso_pu_bacteria 2643221608 2644054781 246
51 iso_pu_bacteria 2818991438 2819552183 246
52 iso_pu_bacteria 2852653556 2852653561 246
53 iso_pu_bacteria 2928968154 2928971819 246
54 iso_pu_bacteria 8054302542 8054303857 246
55 3300003781 Ga0055536_1011158 Ga0055536_10111582 247
56 3300003791 Ga0055530_10008737 Ga0055530_100087374 247
57 3300003794 Ga0055531_10022471 Ga0055531_100224711 247
58 3300013105 Ga0157369_10203149 Ga0157369_102031493 247
59 3300025245 Ga0207425_1000022 Ga0207425_1000022187 247
60 3300025258 Ga0209129_1000286 Ga0209129_100028612 247
61 3300025292 Ga0209676_1008708 Ga0209676_10087084 247
62 3300025292 Ga0209676_1009141 Ga0209676_10091414 247
63 3300025294 Ga0209025_1001464 Ga0209025_10014648 247
64 3300025297 Ga0209758_1000004 Ga0209758_1000004814 247
65 3300025298 Ga0209050_1000001 Ga0209050_10000012818 247
66 3300025303 Ga0209051_1000246 Ga0209051_100024618 247
67 3300025304 Ga0209257_1010863 Ga0209257_10108634 247
68 3300025304 Ga0209257_1030916 Ga0209257_10309162 247
69 3300025904 Ga0207647_10054292 Ga0207647_100542922 247
70 3300046459 Ga0495629_0157525 Ga0495629_0157525_87_830 247
71 3300046501 Ga0495607_0047613 Ga0495607_0047613_1054_1797 247
72 3300046506 Ga0495583_0000252 Ga0495583_0000252_35905_36648 247
73 3300046520 Ga0495637_0033327 Ga0495637_0033327_1381_2124 247
74 3300046520 Ga0495637_0077167 Ga0495637_0077167_507_1250 247
75 3300046522 Ga0495643_0021213 Ga0495643_0021213_598_1341 247
76 3300046525 Ga0495663_0018295 Ga0495663_0018295_1155_1898 247
77 3300046660 Ga0495625_0000671 Ga0495625_0000671_28637_29380 247
78 3300046660 Ga0495625_0035771 Ga0495625_0035771_959_1702 247
79 3300046660 Ga0495625_0050839 Ga0495625_0050839_768_1511 247
80 3300046691 Ga0495670_0028819 Ga0495670_0028819_484_1227 247
81 3300046692 Ga0495671_0000011 Ga0495671_0000011_51939_52682 247
82 3300047321 Ga0495676_0203871 Ga0495676_0203871_358_1101 247
83 3300047469 Ga0495673_0000013 Ga0495673_0000013_320003_320746 247
84 3300047472 Ga0495686_0027175 Ga0495686_0027175_174_917 247
85 3300048905 Ga0496102_0197094 Ga0496102_0197094_243_986 247
86 3300053091 Ga0500647_0066437 Ga0500647_0066437_184_927 247
87 3300053123 Ga0500614_016829 Ga0500614_016829_814_1557 247
88 3300053125 Ga0500618_013410 Ga0500618_013410_340_1083 247
89 3300053133 Ga0500655_000165 Ga0500655_000165_4924_5667 247
90 3300053148 Ga0500590_000953 Ga0500590_000953_7196_7939 247
91 3300053156 Ga0500622_0034813 Ga0500622_0034813_76_819 247
92 3300053163 Ga0500639_096613 Ga0500639_096613_675_1418 247
93 3300053177 Ga0500636_0041154 Ga0500636_0041154_1412_2155 247
94 3300053724 Ga0500570_053881 Ga0500570_053881_542_1285 247
95 2162886007 SwRhRL2b_contig_860484 SwRhRL2b_0540.00007830 248
96 3300002075 JGI24738J21930_10000338 JGI24738J21930_1000033810 248
97 3300002459 JGI24751J29686_10001912 JGI24751J29686_100019123 248
98 3300003214 JGI25165J46597_1000073 JGI25165J46597_1000073117 248
99 3300003794 Ga0055531_10003646 Ga0055531_100036465 248
100 3300005289 Ga0065704_10006257 Ga0065704_100062572 248
101 3300005327 Ga0070658_10033853 Ga0070658_100338534 248
102 3300005535 Ga0070684_100180891 Ga0070684_1001808911 248
103 3300005563 Ga0068855_100449801 Ga0068855_1004498012 248
104 3300005578 Ga0068854_100066764 Ga0068854_1000667642 248
105 3300005618 Ga0068864_100002125 Ga0068864_10000212519 248
106 3300005842 Ga0068858_100000228 Ga0068858_10000022823 248
107 3300005842 Ga0068858_100001700 Ga0068858_1000017002 248
108 3300006038 Ga0075365_10178714 Ga0075365_101787142 248
109 3300006042 Ga0075368_10000055 Ga0075368_100000556 248
110 3300006042 Ga0075368_10000967 Ga0075368_1000096712 248
111 3300006042 Ga0075368_10032193 Ga0075368_100321933 248
112 3300006048 Ga0075363_100017846 Ga0075363_1000178463 248
113 3300006048 Ga0075363_100096373 Ga0075363_1000963732 248
114 3300006051 Ga0075364_10206394 Ga0075364_102063941 248
115 3300006177 Ga0075362_10002811 Ga0075362_100028113 248
116 3300006177 Ga0075362_10034881 Ga0075362_100348815 248
117 3300006178 Ga0075367_10000109 Ga0075367_1000010911 248
118 3300006178 Ga0075367_10006417 Ga0075367_100064173 248
119 3300006178 Ga0075367_10049680 Ga0075367_100496804 248
120 3300006186 Ga0075369_10095090 Ga0075369_100950901 248
121 3300006186 Ga0075369_10155901 Ga0075369_101559011 248
122 3300006195 Ga0075366_10037690 Ga0075366_100376902 248
123 3300006195 Ga0075366_10076800 Ga0075366_100768001 248
124 3300006353 Ga0075370_10000257 Ga0075370_1000025714 248
125 3300006353 Ga0075370_10050753 Ga0075370_100507531 248
126 3300006353 Ga0075370_10085395 Ga0075370_100853951 248
127 3300006353 Ga0075370_10125899 Ga0075370_101258992 248
128 3300009098 Ga0105245_10009485 Ga0105245_100094856 248
129 3300009148 Ga0105243_10056170 Ga0105243_100561702 248
130 3300009148 Ga0105243_10715950 Ga0105243_107159501 248
131 3300009177 Ga0105248_10010320 Ga0105248_100103207 248
132 3300009177 Ga0105248_10017254 Ga0105248_100172544 248
133 3300009545 Ga0105237_10010097 Ga0105237_100100972 248
134 3300009978 Ga0105148_100253 Ga0105148_1002535 248
135 3300010375 Ga0105239_10031481 Ga0105239_100314814 248
136 3300013296 Ga0157374_10103118 Ga0157374_101031181 248
137 3300013297 Ga0157378_10166335 Ga0157378_101663352 248
138 3300013306 Ga0163162_10001078 Ga0163162_1000107821 248
139 3300013306 Ga0163162_10446220 Ga0163162_104462202 248
140 3300015690 Ga0183363_1002 Ga0183363_1002112 248
141 3300017792 Ga0163161_10013007 Ga0163161_100130071 248
142 3300025246 Ga0209646_1021491 Ga0209646_10214911 248
143 3300025261 Ga0209233_1000142 Ga0209233_100014264 248
144 3300025292 Ga0209676_1026483 Ga0209676_10264831 248
145 3300025304 Ga0209257_1000517 Ga0209257_10005173 248
146 3300025304 Ga0209257_1002888 Ga0209257_100288817 248
147 3300025315 Ga0207697_10086321 Ga0207697_100863212 248
148 3300025909 Ga0207705_10369159 Ga0207705_103691592 248
149 3300025913 Ga0207695_10057479 Ga0207695_100574792 248
150 3300025914 Ga0207671_10002163 Ga0207671_1000216313 248
151 3300025923 Ga0207681_10047485 Ga0207681_100474853 248
152 3300025925 Ga0207650_10203060 Ga0207650_102030602 248
153 3300025927 Ga0207687_10006744 Ga0207687_100067443 248
154 3300025932 Ga0207690_10207593 Ga0207690_102075932 248
155 3300025933 Ga0207706_10019782 Ga0207706_100197824 248
156 3300025941 Ga0207711_10005221 Ga0207711_100052214 248
157 3300025941 Ga0207711_10056418 Ga0207711_100564182 248
158 3300025949 Ga0207667_10075657 Ga0207667_100756572 248
159 3300025949 Ga0207667_10697721 Ga0207667_106977211 248
160 3300025981 Ga0207640_10059222 Ga0207640_100592222 248
161 3300026035 Ga0207703_10000976 Ga0207703_1000097623 248
162 3300026035 Ga0207703_10004598 Ga0207703_1000459812 248
163 3300026078 Ga0207702_10003711 Ga0207702_1000371115 248
164 3300026095 Ga0207676_10000190 Ga0207676_1000019014 248
165 3300026095 Ga0207676_10348384 Ga0207676_103483842 248
166 3300027866 Ga0209813_10000048 Ga0209813_1000004838 248
167 3300027866 Ga0209813_10000220 Ga0209813_1000022016 248
168 3300028379 Ga0268266_10889770 Ga0268266_108897701 248
169 3300031456 Ga0307513_10256515 Ga0307513_102565151 248
170 3300031616 Ga0307508_10004238 Ga0307508_100042386 248
171 3300033180 Ga0307510_10191540 Ga0307510_101915401 248
172 3300035171 Ga0373946_0289600 Ga0373946_0289600_22_768 248
173 3300037853 Ga0436364_1389735 Ga0436364_1389735_2339_3085 248
174 3300039437 Ga0436365_1211005 Ga0436365_1211005_106_855 248
175 3300041460 Ga0451802_0044966 Ga0451802_0044966_215_961 248
176 3300041463 Ga0451804_0756293 Ga0451804_0756293_378_1124 248
177 3300041486 Ga0451807_2284404 Ga0451807_2284404_55_801 248
178 3300041512 Ga0451853_1879690 Ga0451853_1879690_756_1502 248
179 3300044735 Ga0466968_0054687 Ga0466968_0054687_31_786 248
180 3300046460 Ga0495638_0080909 Ga0495638_0080909_1186_1932 248
181 3300046460 Ga0495638_0144399 Ga0495638_0144399_211_957 248
182 3300046491 Ga0495584_0014651 Ga0495584_0014651_1166_1912 248
183 3300046507 Ga0495606_0044223 Ga0495606_0044223_1824_2570 248
184 3300046512 Ga0495610_0047804 Ga0495610_0047804_95_841 248
185 3300046519 Ga0495632_0000007 Ga0495632_0000007_328182_328928 248
186 3300046520 Ga0495637_0000569 Ga0495637_0000569_24154_24900 248
187 3300046522 Ga0495643_0000304 Ga0495643_0000304_53695_54441 248
188 3300046524 Ga0495648_0037584 Ga0495648_0037584_1969_2715 248
189 3300046525 Ga0495663_0000005 Ga0495663_0000005_327201_327947 248
190 3300046530 Ga0495654_0043751 Ga0495654_0043751_273_1019 248
191 3300046557 Ga0495622_0006810 Ga0495622_0006810_672_1418 248
192 3300046558 Ga0495633_0000491 Ga0495633_0000491_32184_32930 248
193 3300046558 Ga0495633_0001879 Ga0495633_0001879_3935_4681 248
194 3300046616 Ga0495668_0000001 Ga0495668_0000001_949100_949846 248
195 3300046648 Ga0495611_0256250 Ga0495611_0256250_33_779 248
196 3300046660 Ga0495625_0057335 Ga0495625_0057335_994_1740 248
197 3300046660 Ga0495625_0063243 Ga0495625_0063243_1834_2580 248
198 3300046691 Ga0495670_0243820 Ga0495670_0243820_38_784 248
199 3300046692 Ga0495671_0000126 Ga0495671_0000126_14043_14789 248
200 3300047445 Ga0495677_0034004 Ga0495677_0034004_1039_1785 248
201 3300047470 Ga0495681_0002422 Ga0495681_0002422_5145_5891 248
202 3300047472 Ga0495686_0000063 Ga0495686_0000063_161648_162394 248
203 3300047472 Ga0495686_0000661 Ga0495686_0000661_3803_4549 248
204 3300047472 Ga0495686_0009632 Ga0495686_0009632_1133_1879 248
205 3300047472 Ga0495686_0020603 Ga0495686_0020603_2403_3149 248
206 3300047472 Ga0495686_0082333 Ga0495686_0082333_526_1272 248
207 3300047472 Ga0495686_0104101 Ga0495686_0104101_360_1106 248
208 3300048916 Ga0496113_0092142 Ga0496113_0092142_1251_1997 248
209 3300048920 Ga0496117_0043351 Ga0496117_0043351_1456_2205 248
210 3300048920 Ga0496117_0057221 Ga0496117_0057221_225_971 248
211 3300048921 Ga0496118_0015807 Ga0496118_0015807_2322_3071 248
212 3300048923 Ga0496120_0102515 Ga0496120_0102515_46_792 248
213 3300048924 Ga0496121_0003092 Ga0496121_0003092_2577_3326 248
214 3300048927 Ga0496124_0030523 Ga0496124_0030523_72_818 248
215 3300048927 Ga0496124_0235082 Ga0496124_0235082_210_956 248
216 3300048927 Ga0496124_0262178 Ga0496124_0262178_364_1110 248
217 3300048928 Ga0496125_0040553 Ga0496125_0040553_2897_3643 248
218 3300049658 Ga0501211_001344 Ga0501211_001344_219_965 248
219 3300049663 Ga0501223_000064 Ga0501223_000064_11798_12544 248
220 3300049669 Ga0501235_001360 Ga0501235_001360_3143_3889 248
221 3300049705 Ga0501225_0000063 Ga0501225_0000063_28805_29551 248
222 3300049708 Ga0501245_005207 Ga0501245_005207_91_837 248
223 3300049823 Ga0501044_0256729 Ga0501044_0256729_883_1629 248
224 3300050489 nmdc:mga03683_10661_c1 nmdc:mga03683_10661_c1_243_989 248
225 3300050489 nmdc:mga03683_16551_c1 nmdc:mga03683_16551_c1_401_1147 248
226 3300050489 nmdc:mga03683_927_c1 nmdc:mga03683_927_c1_735_1481 248
227 3300050490 nmdc:mga03n38_30348_c1 nmdc:mga03n38_30348_c1_353_1099 248
228 3300050490 nmdc:mga03n38_82620_c1 nmdc:mga03n38_82620_c1_264_1010 248
229 3300050491 nmdc:mga00v17_11965_c1 nmdc:mga00v17_11965_c1_278_1024 248
230 3300050491 nmdc:mga00v17_1563_c1 nmdc:mga00v17_1563_c1_5920_6666 248
231 3300050491 nmdc:mga00v17_3583_c1 nmdc:mga00v17_3583_c1_735_1481 248
232 3300050492 nmdc:mga0yw44_158276_c1 nmdc:mga0yw44_158276_c1_27_773 248
233 3300050492 nmdc:mga0yw44_330966_c1 nmdc:mga0yw44_330966_c1_252_998 248
234 3300050493 nmdc:mga0k408_3784_c1 nmdc:mga0k408_3784_c1_6559_7305 248
235 3300050493 nmdc:mga0k408_39900_c2 nmdc:mga0k408_39900_c2_41_787 248
236 3300050494 nmdc:mga06z11_117_c1 nmdc:mga06z11_117_c1_735_1481 248
237 3300050494 nmdc:mga06z11_295_c1 nmdc:mga06z11_295_c1_443_1189 248
238 3300050495 nmdc:mga04h51_162_c1 nmdc:mga04h51_162_c1_445_1191 248
239 3300050495 nmdc:mga04h51_178_c1 nmdc:mga04h51_178_c1_7201_7947 248
240 3300050495 nmdc:mga04h51_29230_c1 nmdc:mga04h51_29230_c1_640_1386 248
241 3300050495 nmdc:mga04h51_656_c1 nmdc:mga04h51_656_c1_735_1481 248
242 3300050496 nmdc:mga07m45_21157_c1 nmdc:mga07m45_21157_c1_2462_3208 248
243 3300050496 nmdc:mga07m45_22_c1 nmdc:mga07m45_22_c1_735_1481 248
244 3300050496 nmdc:mga07m45_70616_c1 nmdc:mga07m45_70616_c1_360_1106 248
245 3300050496 nmdc:mga07m45_9859_c1 nmdc:mga07m45_9859_c1_3859_4605 248
246 3300050516 nmdc:mga0sz30_144328_c1 nmdc:mga0sz30_144328_c1_280_1026 248
247 3300050516 nmdc:mga0sz30_48389_c1 nmdc:mga0sz30_48389_c1_27_773 248
248 3300050516 nmdc:mga0sz30_714_c2 nmdc:mga0sz30_714_c2_1593_2339 248
249 3300053087 Ga0500643_000385 Ga0500643_000385_18592_19338 248
250 3300053087 Ga0500643_002094 Ga0500643_002094_6423_7169 248
251 3300053093 Ga0500651_0345311 Ga0500651_0345311_62_808 248
252 3300053096 Ga0500641_0061888 Ga0500641_0061888_119_865 248
253 3300053116 Ga0500592_001641 Ga0500592_001641_1530_2276 248
254 3300053118 Ga0500594_0009144 Ga0500594_0009144_1182_1928 248
255 3300053120 Ga0500597_019103 Ga0500597_019103_1435_2181 248
256 3300053121 Ga0500607_000065 Ga0500607_000065_52291_53037 248
257 3300053121 Ga0500607_000386 Ga0500607_000386_40348_41094 248
258 3300053125 Ga0500618_031599 Ga0500618_031599_325_1071 248
259 3300053130 Ga0500642_0000574 Ga0500642_0000574_9448_10194 248
260 3300053136 Ga0500559_0000668 Ga0500559_0000668_6355_7101 248
261 3300053136 Ga0500559_0012091 Ga0500559_0012091_588_1334 248
262 3300053136 Ga0500559_0013370 Ga0500559_0013370_2230_2976 248
263 3300053139 Ga0500568_0026023 Ga0500568_0026023_927_1673 248
264 3300053142 Ga0500577_0012472 Ga0500577_0012472_138_884 248
265 3300053142 Ga0500577_0120786 Ga0500577_0120786_14_760 248
266 3300053142 Ga0500577_0132164 Ga0500577_0132164_99_845 248
267 3300053153 Ga0500616_0010849 Ga0500616_0010849_2961_3707 248
268 3300053153 Ga0500616_0041068 Ga0500616_0041068_668_1414 248
269 3300053153 Ga0500616_0129036 Ga0500616_0129036_406_1152 248
270 3300053153 Ga0500616_0152766 Ga0500616_0152766_145_891 248
271 3300053156 Ga0500622_0002328 Ga0500622_0002328_11631_12377 248
272 3300053157 Ga0500624_000012 Ga0500624_000012_52867_53613 248
273 3300053157 Ga0500624_000020 Ga0500624_000020_36101_36847 248
274 3300053158 Ga0500627_0000013 Ga0500627_0000013_86957_87703 248
275 3300053178 Ga0500637_0000022 Ga0500637_0000022_36076_36822 248
276 3300053178 Ga0500637_0006428 Ga0500637_0006428_606_1352 248
277 3300053730 Ga0500645_020731 Ga0500645_020731_771_1517 248
278 3300053730 Ga0500645_037940 Ga0500645_037940_471_1217 248
279 3300055283 Ga0500661_004899 Ga0500661_004899_411_1157 248
280 3300001904 JGI24736J21556_1008730 JGI24736J21556_10087302 249
281 3300001915 JGI24741J21665_1007135 JGI24741J21665_10071353 249
282 3300001979 JGI24740J21852_10042393 JGI24740J21852_100423932 249
283 3300001989 JGI24739J22299_10000601 JGI24739J22299_1000060110 249
284 3300001989 JGI24739J22299_10002449 JGI24739J22299_100024495 249
285 3300001989 JGI24739J22299_10004424 JGI24739J22299_100044244 249
286 3300001990 JGI24737J22298_10000720 JGI24737J22298_100007205 249
287 3300001990 JGI24737J22298_10071114 JGI24737J22298_100711142 249
288 3300002067 JGI24735J21928_10001166 JGI24735J21928_100011665 249
289 3300002067 JGI24735J21928_10008108 JGI24735J21928_100081083 249
290 3300002067 JGI24735J21928_10027700 JGI24735J21928_100277002 249
291 3300002067 JGI24735J21928_10034178 JGI24735J21928_100341782 249
292 3300002075 JGI24738J21930_10000440 JGI24738J21930_100004405 249
293 3300002075 JGI24738J21930_10010342 JGI24738J21930_100103421 249
294 3300002077 JGI24744J21845_10004368 JGI24744J21845_100043683 249
295 3300002741 JGI25157J39369_1018117 JGI25157J39369_10181171 249
296 3300003214 JGI25165J46597_1000188 JGI25165J46597_100018840 249
297 3300003322 rootL2_10165951 rootL2_101659512 249
298 3300003762 Ga0055542_1004389 Ga0055542_10043893 249
299 3300005295 Ga0065707_10101327 Ga0065707_101013273 249
300 3300005327 Ga0070658_10041598 Ga0070658_100415983 249
301 3300005327 Ga0070658_10358454 Ga0070658_103584542 249
302 3300005327 Ga0070658_10528373 Ga0070658_105283731 249
303 3300005328 Ga0070676_10002175 Ga0070676_100021756 249
304 3300005334 Ga0068869_100000848 Ga0068869_1000008486 249
305 3300005335 Ga0070666_10040596 Ga0070666_100405962 249
306 3300005338 Ga0068868_100000154 Ga0068868_10000015423 249
307 3300005338 Ga0068868_100147581 Ga0068868_1001475812 249
308 3300005339 Ga0070660_100000544 Ga0070660_1000005443 249
309 3300005339 Ga0070660_100174061 Ga0070660_1001740611 249
310 3300005339 Ga0070660_100211179 Ga0070660_1002111791 249
311 3300005339 Ga0070660_100409501 Ga0070660_1004095011 249
312 3300005339 Ga0070660_100438185 Ga0070660_1004381852 249
313 3300005344 Ga0070661_100092363 Ga0070661_1000923632 249
314 3300005347 Ga0070668_100615823 Ga0070668_1006158231 249
315 3300005364 Ga0070673_100000023 Ga0070673_10000002385 249
316 3300005366 Ga0070659_100059344 Ga0070659_1000593444 249
317 3300005366 Ga0070659_100059457 Ga0070659_1000594571 249
318 3300005366 Ga0070659_100066008 Ga0070659_1000660082 249
319 3300005366 Ga0070659_100075161 Ga0070659_1000751612 249
320 3300005366 Ga0070659_100663842 Ga0070659_1006638421 249
321 3300005455 Ga0070663_100001998 Ga0070663_1000019987 249
322 3300005456 Ga0070678_100054021 Ga0070678_1000540213 249
323 3300005457 Ga0070662_100002062 Ga0070662_1000020629 249
324 3300005457 Ga0070662_100081846 Ga0070662_1000818462 249
325 3300005457 Ga0070662_100131072 Ga0070662_1001310722 249
326 3300005458 Ga0070681_10094688 Ga0070681_100946881 249
327 3300005459 Ga0068867_100000007 Ga0068867_10000000721 249
328 3300005539 Ga0068853_100023296 Ga0068853_1000232964 249
329 3300005539 Ga0068853_100025947 Ga0068853_1000259472 249
330 3300005539 Ga0068853_100069304 Ga0068853_1000693041 249
331 3300005543 Ga0070672_100042427 Ga0070672_1000424273 249
332 3300005547 Ga0070693_100281806 Ga0070693_1002818062 249
333 3300005563 Ga0068855_100000029 Ga0068855_10000002940 249
334 3300005563 Ga0068855_100001148 Ga0068855_10000114815 249
335 3300005563 Ga0068855_100191725 Ga0068855_1001917253 249
336 3300005564 Ga0070664_100424026 Ga0070664_1004240262 249
337 3300005577 Ga0068857_100055573 Ga0068857_1000555732 249
338 3300005578 Ga0068854_100000027 Ga0068854_1000000276 249
339 3300005578 Ga0068854_100154085 Ga0068854_1001540852 249
340 3300005614 Ga0068856_100004098 Ga0068856_1000040986 249
341 3300005616 Ga0068852_100004278 Ga0068852_1000042784 249
342 3300005616 Ga0068852_100006260 Ga0068852_1000062605 249
343 3300005616 Ga0068852_100129866 Ga0068852_1001298662 249
344 3300005616 Ga0068852_100182937 Ga0068852_1001829372 249
345 3300005718 Ga0068866_10012667 Ga0068866_100126674 249
346 3300006042 Ga0075368_10000168 Ga0075368_1000016816 249
347 3300006048 Ga0075363_100006130 Ga0075363_1000061302 249
348 3300006178 Ga0075367_10000289 Ga0075367_1000028916 249
349 3300006195 Ga0075366_10143533 Ga0075366_101435332 249
350 3300006237 Ga0097621_100002061 Ga0097621_1000020615 249
351 3300006353 Ga0075370_10026515 Ga0075370_100265151 249
352 3300006358 Ga0068871_100002074 Ga0068871_1000020745 249
353 3300006881 Ga0068865_100000010 Ga0068865_100000010159 249
354 3300009093 Ga0105240_10017476 Ga0105240_100174764 249
355 3300009093 Ga0105240_10070818 Ga0105240_100708182 249
356 3300009093 Ga0105240_10304868 Ga0105240_103048681 249
357 3300009098 Ga0105245_10002089 Ga0105245_100020893 249
358 3300009148 Ga0105243_10000950 Ga0105243_1000095021 249
359 3300009148 Ga0105243_10294328 Ga0105243_102943282 249
360 3300009174 Ga0105241_10045550 Ga0105241_100455502 249
361 3300009174 Ga0105241_10415116 Ga0105241_104151162 249
362 3300009176 Ga0105242_10000210 Ga0105242_1000021021 249
363 3300009545 Ga0105237_10051294 Ga0105237_100512944 249
364 3300009545 Ga0105237_10458234 Ga0105237_104582342 249
365 3300009551 Ga0105238_10027777 Ga0105238_100277773 249
366 3300009551 Ga0105238_10226524 Ga0105238_102265243 249
367 3300009551 Ga0105238_10473056 Ga0105238_104730562 249
368 3300009553 Ga0105249_10017303 Ga0105249_100173032 249
369 3300010375 Ga0105239_10004123 Ga0105239_100041238 249
370 3300010375 Ga0105239_10046782 Ga0105239_100467825 249
371 3300011119 Ga0105246_10000472 Ga0105246_1000047217 249
372 3300013100 Ga0157373_10047916 Ga0157373_100479164 249
373 3300013100 Ga0157373_10084627 Ga0157373_100846272 249
374 3300013100 Ga0157373_10264350 Ga0157373_102643502 249
375 3300013102 Ga0157371_10211638 Ga0157371_102116382 249
376 3300013104 Ga0157370_10000203 Ga0157370_1000020360 249
377 3300013104 Ga0157370_10074058 Ga0157370_100740583 249
378 3300013105 Ga0157369_10057364 Ga0157369_100573643 249
379 3300013105 Ga0157369_10511326 Ga0157369_105113262 249
380 3300013296 Ga0157374_10000830 Ga0157374_1000083021 249
381 3300013296 Ga0157374_10045139 Ga0157374_100451394 249
382 3300013297 Ga0157378_10001477 Ga0157378_1000147714 249
383 3300013297 Ga0157378_10084028 Ga0157378_100840283 249
384 3300013307 Ga0157372_10010036 Ga0157372_100100366 249
385 3300013307 Ga0157372_10058023 Ga0157372_100580235 249
386 3300013307 Ga0157372_10179976 Ga0157372_101799762 249
387 3300013307 Ga0157372_10339814 Ga0157372_103398142 249
388 3300013308 Ga0157375_10002120 Ga0157375_1000212010 249
389 3300014969 Ga0157376_10000047 Ga0157376_1000004721 249
390 3300025231 Ga0207427_101974 Ga0207427_1019745 249
391 3300025250 Ga0209026_1002441 Ga0209026_10024415 249
392 3300025254 Ga0209148_1000061 Ga0209148_1000061278 249
393 3300025254 Ga0209148_1001013 Ga0209148_10010135 249
394 3300025261 Ga0209233_1000120 Ga0209233_1000120181 249
395 3300025272 Ga0209455_1000692 Ga0209455_100069213 249
396 3300025321 Ga0207656_10059287 Ga0207656_100592872 249
397 3300025899 Ga0207642_10007810 Ga0207642_100078104 249
398 3300025901 Ga0207688_10080907 Ga0207688_100809073 249
399 3300025903 Ga0207680_10022733 Ga0207680_100227333 249
400 3300025904 Ga0207647_10000270 Ga0207647_1000027010 249
401 3300025904 Ga0207647_10016335 Ga0207647_100163352 249
402 3300025904 Ga0207647_10017291 Ga0207647_100172913 249
403 3300025904 Ga0207647_10051484 Ga0207647_100514843 249
404 3300025904 Ga0207647_10065747 Ga0207647_100657472 249
405 3300025907 Ga0207645_10029542 Ga0207645_100295423 249
406 3300025909 Ga0207705_10000316 Ga0207705_100003169 249
407 3300025909 Ga0207705_10000963 Ga0207705_1000096311 249
408 3300025909 Ga0207705_10009514 Ga0207705_100095144 249
409 3300025909 Ga0207705_10525168 Ga0207705_105251681 249
410 3300025911 Ga0207654_10342347 Ga0207654_103423472 249
411 3300025913 Ga0207695_10008358 Ga0207695_100083584 249
412 3300025913 Ga0207695_10041776 Ga0207695_100417764 249
413 3300025914 Ga0207671_10107147 Ga0207671_101071472 249
414 3300025919 Ga0207657_10003918 Ga0207657_100039185 249
415 3300025919 Ga0207657_10049263 Ga0207657_100492633 249
416 3300025919 Ga0207657_10057737 Ga0207657_100577373 249
417 3300025920 Ga0207649_10067641 Ga0207649_100676413 249
418 3300025924 Ga0207694_10217153 Ga0207694_102171532 249
419 3300025927 Ga0207687_10027727 Ga0207687_100277273 249
420 3300025931 Ga0207644_10224943 Ga0207644_102249432 249
421 3300025932 Ga0207690_10077238 Ga0207690_100772382 249
422 3300025932 Ga0207690_10123350 Ga0207690_101233502 249
423 3300025932 Ga0207690_10227985 Ga0207690_102279852 249
424 3300025932 Ga0207690_10430273 Ga0207690_104302732 249
425 3300025933 Ga0207706_10004159 Ga0207706_100041596 249
426 3300025933 Ga0207706_10103379 Ga0207706_101033792 249
427 3300025935 Ga0207709_10000050 Ga0207709_10000050230 249
428 3300025938 Ga0207704_10000020 Ga0207704_10000020140 249
429 3300025942 Ga0207689_10001541 Ga0207689_100015417 249
430 3300025949 Ga0207667_10000035 Ga0207667_10000035183 249
431 3300025949 Ga0207667_10004932 Ga0207667_100049327 249
432 3300025949 Ga0207667_10131103 Ga0207667_101311033 249
433 3300025960 Ga0207651_10000005 Ga0207651_1000000521 249
434 3300025961 Ga0207712_10097162 Ga0207712_100971623 249
435 3300025981 Ga0207640_10000145 Ga0207640_1000014536 249
436 3300025981 Ga0207640_10056590 Ga0207640_100565902 249
437 3300025981 Ga0207640_10332653 Ga0207640_103326532 249
438 3300026023 Ga0207677_10000373 Ga0207677_100003737 249
439 3300026041 Ga0207639_10002511 Ga0207639_100025116 249
440 3300026041 Ga0207639_10007809 Ga0207639_100078095 249
441 3300026041 Ga0207639_10332655 Ga0207639_103326552 249
442 3300026067 Ga0207678_10005889 Ga0207678_100058897 249
443 3300026067 Ga0207678_10249930 Ga0207678_102499302 249
444 3300026067 Ga0207678_10320657 Ga0207678_103206572 249
445 3300026078 Ga0207702_10012620 Ga0207702_100126203 249
446 3300026078 Ga0207702_10037699 Ga0207702_100376993 249
447 3300026078 Ga0207702_10245821 Ga0207702_102458212 249
448 3300026089 Ga0207648_10000017 Ga0207648_10000017140 249
449 3300026116 Ga0207674_10015748 Ga0207674_100157485 249
450 3300026116 Ga0207674_10022819 Ga0207674_100228193 249
451 3300026116 Ga0207674_10776312 Ga0207674_107763121 249
452 3300026121 Ga0207683_10029414 Ga0207683_100294142 249
453 3300026142 Ga0207698_10000712 Ga0207698_100007125 249
454 3300026142 Ga0207698_10036634 Ga0207698_100366343 249
455 3300026142 Ga0207698_10038607 Ga0207698_100386075 249
456 3300026142 Ga0207698_10713009 Ga0207698_107130092 249
457 3300027866 Ga0209813_10000191 Ga0209813_100001912 249
458 3300028786 Ga0307517_10026027 Ga0307517_100260276 249
459 3300037312 Ga0395899_0002116 Ga0395899_0002116_9319_10068 249
460 3300037312 Ga0395899_0317704 Ga0395899_0317704_126_875 249
461 3300037418 Ga0395900_0260720 Ga0395900_0260720_142_891 249
462 3300037471 Ga0395905_0497526 Ga0395905_0497526_40_789 249
463 3300038443 Ga0395901_0245370 Ga0395901_0245370_120_869 249
464 3300039450 Ga0436363_0389907 Ga0436363_0389907_798_1550 249
465 3300041462 Ga0451806_660356 Ga0451806_660356_2859_3608 249
466 3300042005 Ga0439448_0002573 Ga0439448_0002573_431_1180 249
467 3300042005 Ga0439448_0003494 Ga0439448_0003494_1417_2166 249
468 3300042005 Ga0439448_0027604 Ga0439448_0027604_544_1293 249
469 3300042005 Ga0439448_0038338 Ga0439448_0038338_561_1310 249
470 3300042012 Ga0439455_0000252 Ga0439455_0000252_2338_3087 249
471 3300042012 Ga0439455_0000304 Ga0439455_0000304_1673_2422 249
472 3300042012 Ga0439455_0054729 Ga0439455_0054729_259_1008 249
473 3300042157 Ga0439458_0000255 Ga0439458_0000255_6705_7454 249
474 3300042157 Ga0439458_0000305 Ga0439458_0000305_8211_8960 249
475 3300042157 Ga0439458_0026115 Ga0439458_0026115_198_947 249
476 3300044658 Ga0466972_0274254 Ga0466972_0274254_26_775 249
477 3300044684 Ga0466966_0019647 Ga0466966_0019647_382_1131 249
478 3300044694 Ga0466963_0008961 Ga0466963_0008961_1585_2334 249
479 3300044706 Ga0466964_0012394 Ga0466964_0012394_375_1124 249
480 3300044706 Ga0466964_0018224 Ga0466964_0018224_1439_2188 249
481 3300044719 Ga0466971_0000834 Ga0466971_0000834_5714_6463 249
482 3300044765 Ga0466970_0012023 Ga0466970_0012023_295_1044 249
483 3300044842 Ga0466957_0274396 Ga0466957_0274396_38_787 249
484 3300044901 Ga0466960_0014885 Ga0466960_0014885_340_1089 249
485 3300046453 Ga0495627_000582 Ga0495627_000582_13070_13819 249
486 3300046460 Ga0495638_0156654 Ga0495638_0156654_140_889 249
487 3300046471 Ga0495650_0001090 Ga0495650_0001090_14270_15019 249
488 3300046471 Ga0495650_0049328 Ga0495650_0049328_68_817 249
489 3300046474 Ga0495605_0069453 Ga0495605_0069453_25_774 249
490 3300046500 Ga0495596_0000196 Ga0495596_0000196_16142_16891 249
491 3300046506 Ga0495583_0000030 Ga0495583_0000030_42578_43327 249
492 3300046512 Ga0495610_0000081 Ga0495610_0000081_111556_112305 249
493 3300046512 Ga0495610_0001175 Ga0495610_0001175_5300_6049 249
494 3300046515 Ga0495620_0013539 Ga0495620_0013539_31_780 249
495 3300046519 Ga0495632_0000306 Ga0495632_0000306_28935_29684 249
496 3300046519 Ga0495632_0027007 Ga0495632_0027007_180_929 249
497 3300046522 Ga0495643_0000042 Ga0495643_0000042_165471_166220 249
498 3300046522 Ga0495643_0007419 Ga0495643_0007419_227_976 249
499 3300046530 Ga0495654_0034814 Ga0495654_0034814_767_1516 249
500 3300046538 Ga0495609_0007089 Ga0495609_0007089_295_1044 249
501 3300046648 Ga0495611_0098653 Ga0495611_0098653_543_1292 249
502 3300046660 Ga0495625_0002401 Ga0495625_0002401_8241_8990 249
503 3300046660 Ga0495625_0085854 Ga0495625_0085854_1103_1852 249
504 3300046665 Ga0495661_0033156 Ga0495661_0033156_2407_3156 249
505 3300046691 Ga0495670_0013380 Ga0495670_0013380_2544_3293 249
506 3300046692 Ga0495671_0042256 Ga0495671_0042256_1471_2220 249
507 3300046692 Ga0495671_0115065 Ga0495671_0115065_483_1232 249
508 3300046692 Ga0495671_0123561 Ga0495671_0123561_46_795 249
509 3300047470 Ga0495681_0000517 Ga0495681_0000517_14663_15412 249
510 3300047472 Ga0495686_0000401 Ga0495686_0000401_1148_1897 249
511 3300048914 Ga0496111_0033642 Ga0496111_0033642_205_954 249
512 3300048918 Ga0496115_0000285 Ga0496115_0000285_1427_2185 249
513 3300048920 Ga0496117_0011402 Ga0496117_0011402_6626_7375 249
514 3300048921 Ga0496118_0030413 Ga0496118_0030413_2680_3429 249
515 3300048922 Ga0496119_0033280 Ga0496119_0033280_2313_3062 249
516 3300048924 Ga0496121_0003231 Ga0496121_0003231_1807_2556 249
517 3300048925 Ga0496122_0005685 Ga0496122_0005685_12061_12810 249
518 3300048926 Ga0496123_0002459 Ga0496123_0002459_8051_8800 249
519 3300048926 Ga0496123_0003542 Ga0496123_0003542_3445_4194 249
520 3300048927 Ga0496124_0015727 Ga0496124_0015727_5372_6121 249
521 3300048927 Ga0496124_0046585 Ga0496124_0046585_2899_3648 249
522 3300048928 Ga0496125_0012910 Ga0496125_0012910_2354_3103 249
523 3300048929 Ga0496126_0112148 Ga0496126_0112148_1547_2296 249
524 3300049460 Ga0495682_0125592 Ga0495682_0125592_51_800 249
525 3300049581 Ga0501047_0001117 Ga0501047_0001117_9128_9877 249
526 3300049589 Ga0501073_0212203 Ga0501073_0212203_493_1242 249
527 3300050493 nmdc:mga0k408_149619_c1 nmdc:mga0k408_149619_c1_570_1319 249
528 3300050496 nmdc:mga07m45_40998_c1 nmdc:mga07m45_40998_c1_614_1363 249
529 3300053103 Ga0500555_000163 Ga0500555_000163_1485_2234 249
530 3300053136 Ga0500559_0059748 Ga0500559_0059748_69_818 249
531 3300053153 Ga0500616_0035196 Ga0500616_0035196_547_1296 249
532 3300053156 Ga0500622_0132477 Ga0500622_0132477_127_876 249
533 3300053157 Ga0500624_000061 Ga0500624_000061_4256_5005 249
534 3300053177 Ga0500636_0001685 Ga0500636_0001685_4195_4944 249
535 3300061719 Ga0466962_0011448 Ga0466962_0011448_472_1221 249
536 3300002774 JGI25150J39212_1000020 JGI25150J39212_100002077 250
537 3300003215 JGI25153J46596_10000017 JGI25153J46596_10000017139 250
538 3300003791 Ga0055530_10005655 Ga0055530_100056558 250
539 3300003791 Ga0055530_10044614 Ga0055530_100446141 250
540 3300003794 Ga0055531_10045466 Ga0055531_100454662 250
541 3300005262 Ga0065165_1004847 Ga0065165_10048478 250
542 3300005289 Ga0065704_10111589 Ga0065704_101115892 250
543 3300005548 Ga0070665_100004652 Ga0070665_1000046524 250
544 3300005578 Ga0068854_100218332 Ga0068854_1002183322 250
545 3300005616 Ga0068852_100025178 Ga0068852_1000251782 250
546 3300013296 Ga0157374_10071508 Ga0157374_100715082 250
547 3300025250 Ga0209026_1004353 Ga0209026_10043533 250
548 3300025298 Ga0209050_1000127 Ga0209050_100012744 250
549 3300025914 Ga0207671_10098859 Ga0207671_100988592 250
550 3300025944 Ga0207661_10055536 Ga0207661_100555363 250
551 3300025972 Ga0207668_10273471 Ga0207668_102734711 250
552 3300026116 Ga0207674_10892142 Ga0207674_108921421 250
553 3300026142 Ga0207698_10036776 Ga0207698_100367762 250
554 3300046500 Ga0495596_0000537 Ga0495596_0000537_19408_20160 250
555 3300046507 Ga0495606_0116794 Ga0495606_0116794_85_837 250
556 3300046512 Ga0495610_0003890 Ga0495610_0003890_996_1748 250
557 3300047470 Ga0495681_0041330 Ga0495681_0041330_41_799 250
558 3300048090 Ga0495615_0000020 Ga0495615_0000020_43506_44258 250
559 3300048091 Ga0495626_0000298 Ga0495626_0000298_4989_5741 250
560 3300048905 Ga0496102_0586199 Ga0496102_0586199_154_915 250
561 3300048919 Ga0496116_0000035 Ga0496116_0000035_352308_353060 250
562 3300048920 Ga0496117_0047825 Ga0496117_0047825_849_1601 250
563 3300048920 Ga0496117_0119468 Ga0496117_0119468_216_974 250
564 3300048921 Ga0496118_0036903 Ga0496118_0036903_1262_2014 250
565 3300048921 Ga0496118_0139977 Ga0496118_0139977_383_1141 250
566 3300048922 Ga0496119_0052623 Ga0496119_0052623_169_921 250
567 3300048924 Ga0496121_0002960 Ga0496121_0002960_23079_23837 250
568 3300048924 Ga0496121_0002979 Ga0496121_0002979_404_1162 250
569 3300048925 Ga0496122_0026933 Ga0496122_0026933_2176_2928 250
570 3300048926 Ga0496123_0000159 Ga0496123_0000159_82911_83663 250
571 3300048926 Ga0496123_0003707 Ga0496123_0003707_838_1590 250
572 3300048927 Ga0496124_0002365 Ga0496124_0002365_14060_14812 250
573 3300048927 Ga0496124_0067837 Ga0496124_0067837_1865_2617 250
574 3300048927 Ga0496124_0155365 Ga0496124_0155365_135_887 250
575 3300048928 Ga0496125_0121127 Ga0496125_0121127_621_1373 250
576 3300048929 Ga0496126_0000077 Ga0496126_0000077_134828_135580 250
577 3300048929 Ga0496126_0014533 Ga0496126_0014533_212_970 250
578 3300049579 Ga0501043_0072900 Ga0501043_0072900_371_1159 250
579 3300049823 Ga0501044_0079519 Ga0501044_0079519_1840_2628 250
580 3300009093 Ga0105240_10013748 Ga0105240_1001374812 251
581 3300010375 Ga0105239_10000025 Ga0105239_1000002555 251
582 3300047472 Ga0495686_0000082 Ga0495686_0000082_35659_36432 251
583 3300048921 Ga0496118_0035164 Ga0496118_0035164_81_839 251
584 3300048924 Ga0496121_0000671 Ga0496121_0000671_57179_57937 251
585 3300048929 Ga0496126_0001878 Ga0496126_0001878_5948_6706 251
586 3300046512 Ga0495610_0027251 Ga0495610_0027251_1382_2152 252
587 3300048913 Ga0496110_0609108 Ga0496110_0609108_191_973 252
588 3300048914 Ga0496111_0413687 Ga0496111_0413687_36_818 252
589 3300048919 Ga0496116_0047806 Ga0496116_0047806_280_1062 252
590 3300048924 Ga0496121_0030578 Ga0496121_0030578_1720_2502 252
591 3300048927 Ga0496124_0090965 Ga0496124_0090965_695_1477 252
592 3300048928 Ga0496125_0215487 Ga0496125_0215487_124_906 252
593 3300009545 Ga0105237_10585404 Ga0105237_105854041 255
594 3300005367 Ga0070667_100001100 Ga0070667_10000110018 258
595 3300005843 Ga0068860_100286162 Ga0068860_1002861622 258
596 3300025986 Ga0207658_10000571 Ga0207658_100005716 258
597 3300028381 Ga0268264_10245060 Ga0268264_102450602 258
598 3300046501 Ga0495607_0016964 Ga0495607_0016964_1660_2463 260
599 3300025294 Ga0209025_1075443 Ga0209025_10754432 261
600 3300025304 Ga0209257_1002394 Ga0209257_10023945 261
601 3300048913 Ga0496110_0050768 Ga0496110_0050768_1506_2318 262
602 3300048914 Ga0496111_0107898 Ga0496111_0107898_272_1084 262
603 3300048925 Ga0496122_0018901 Ga0496122_0018901_4555_5367 262
604 3300048927 Ga0496124_0038486 Ga0496124_0038486_3330_4142 262
605 3300048928 Ga0496125_0031437 Ga0496125_0031437_805_1617 262
606 3300048929 Ga0496126_0058122 Ga0496126_0058122_2107_2919 262
607 3300053134 Ga0500658_0007915 Ga0500658_0007915_505_1299 262
608 3300005289 Ga0065704_10000192 Ga0065704_1000019273 265
609 3300048924 Ga0496121_0000579 Ga0496121_0000579_15013_15882 270
610 3300048927 Ga0496124_0005911 Ga0496124_0005911_146_1015 270
611 3300046460 Ga0495638_0000267 Ga0495638_0000267_27838_28698 272
612 2162886007 SwRhRL2b_contig_2866031 SwRhRL2b_0418.00003710 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

178

257

0.86

PF03332

PMM

Eukaryotic phosphomannomutase

63

284

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bnd-assembly2.cif.gz_B structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases 0.9199 42 287
4bnd-assembly2.cif.gz_A structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases 0.9193 42 287
4bnd-assembly2.cif.gz_A structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases 0.8953 42 287
4bnd-assembly2.cif.gz_B structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases 0.8925 42 287
2no5-assembly1.cif.gz_B crystal structure analysis of a dehalogenase with intermediate complex 0.7985 228 271
ID Description Score Start End Superfamily
4bndA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9734 42 287 3.40.50.1000
4bndA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.949 42 287 3.40.50.1000
4bndB02 Alpha Beta;2-Layer Sandwich;Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2;Eukaryotic phosphomannomutase, cap domain 0.928 132 223 3.30.1240.20
4bndB02 Alpha Beta;2-Layer Sandwich;Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2;Eukaryotic phosphomannomutase, cap domain 0.8822 132 223 3.30.1240.20
6cfsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8564 43 284 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A5N6KS71-F1-model_v4 Phosphomannomutase (EC 5.4.2.8) 0.9972 42 290 GO:0004615
GO:0005829
GO:0006013
GO:0006487
GO:0009298
GO:0046872
AF-A0A2A2K688-F1-model_v4 phosphomannomutase (EC 5.4.2.8) 0.9951 66 288 GO:0004615
GO:0005737
GO:0009298
GO:0046872
AF-D4D4Z5-F1-model_v4 phosphomannomutase (EC 5.4.2.8) 0.9892 42 288 GO:0004615
GO:0005737
GO:0009298
GO:0046872
AF-A0A520IRZ7-F1-model_v4 HAD family hydrolase 0.9889 42 127
AF-A0A1J9RXN2-F1-model_v4 Phosphomannomutase (EC 5.4.2.8) 0.9828 42 290 GO:0004615
GO:0005829
GO:0006013
GO:0006487
GO:0009298
GO:0046872

Feature Viewer

pLDDT pTM Quality
85.55 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map