F469176
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 612 | 312 | 580 | 249 |
Family's Representative Sequence
| Representative Sequence | 3300046460|Ga0495638_0000267|Ga0495638_0000267_27838_28698 |
| Length | 286 |
| Sequence | MRFHNGSIEVWNYGGTSDGIGRLHPVSLHRGRTLFQEHGMKQLVAFDLDGTLAESKQPLREPMGDALADLLGVAHVAVISGGDWPQFEKQVASRLPARADLTRLWLMPTTGTKLYRYDGAWSAVYAELFDDAQKQAIFAAFDESLKATGFVPEQTWGERIEDRGSQITFSALGQQAPLDAKEHWDPDFAKRKVIQVDLRKRLPGLSINMGGATSIDITREGVDKAYGLKKLRDASGIELDAMMFIGDAIFPGGNDYPAKELGLDTVRVRDPEETLSVIAAIVACQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 4 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 5 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 6 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 7 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 8 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 9 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 10 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 11 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 12 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 13 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 14 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 15 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 16 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 17 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 18 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 19 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 20 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 21 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 22 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 23 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 24 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 25 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 26 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 27 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 28 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 29 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 30 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 31 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 32 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 33 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 34 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 35 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 36 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 37 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 38 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 39 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 40 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 41 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 42 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 47 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 52 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 178 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 179 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 180 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 181 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 189 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 194 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 195 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 196 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 197 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 198 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 199 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 200 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 201 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 202 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 203 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 204 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 205 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 206 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 247 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 248 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 249 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 250 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 251 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 252 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 253 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 254 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 255 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 256 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 257 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 266 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 268 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 269 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 270 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 272 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 273 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 274 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 275 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 276 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 277 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 278 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 279 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 281 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 283 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 284 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 285 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 286 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 287 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 288 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 289 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 290 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 291 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 292 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 293 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 294 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 295 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 296 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 297 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 298 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 299 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 300 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 301 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 302 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 303 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 305 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 306 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 307 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 308 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 309 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 310 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 311 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 312 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.77 |
| Metatranscriptomes | 0 |
| Isolates | 5.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.82 |
| Bulb | 0 |
| Endosphere | 23.53 |
| Nodule | 0.16 |
| Rhizoplane | 2.45 |
| Rhizosphere | 60.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2866031 | 2162886007 | Bacteria | 47061 |
| 2 | SwRhRL2b_contig_860484 | 2162886007 | Bacteria | 1628 |
| 3 | JGI24736J21556_1008730 | 3300001904 | Bacteria | 1681 |
| 4 | JGI24741J21665_1007135 | 3300001915 | Bacteria | 2188 |
| 5 | JGI24740J21852_10042393 | 3300001979 | Bacteria | 1364 |
| 6 | JGI24739J22299_10000601 | 3300001989 | Bacteria | 12967 |
| 7 | JGI24739J22299_10002449 | 3300001989 | Bacteria | 7159 |
| 8 | JGI24739J22299_10004424 | 3300001989 | Bacteria | 5384 |
| 9 | JGI24737J22298_10000720 | 3300001990 | Bacteria | 11643 |
| 10 | JGI24737J22298_10071114 | 3300001990 | Bacteria | 1039 |
| 11 | JGI24735J21928_10001166 | 3300002067 | Bacteria | 9407 |
| 12 | JGI24735J21928_10008108 | 3300002067 | Bacteria | 3407 |
| 13 | JGI24735J21928_10027700 | 3300002067 | Bacteria | 1697 |
| 14 | JGI24735J21928_10034178 | 3300002067 | Bacteria | 1500 |
| 15 | JGI24738J21930_10000330 | 3300002075 | Bacteria | 13051 |
| 16 | JGI24738J21930_10000338 | 3300002075 | Bacteria | 12810 |
| 17 | JGI24738J21930_10000440 | 3300002075 | Bacteria | 11750 |
| 18 | JGI24738J21930_10010342 | 3300002075 | Bacteria | 2078 |
| 19 | JGI24744J21845_10004368 | 3300002077 | Bacteria | 2921 |
| 20 | JGI24751J29686_10001912 | 3300002459 | Bacteria | 4252 |
| 21 | JGI25157J39369_1018117 | 3300002741 | Bacteria | 851 |
| 22 | JGI25150J39212_1000020 | 3300002774 | Bacteria | 134928 |
| 23 | JGI25165J46597_1000073 | 3300003214 | Bacteria | 192140 |
| 24 | JGI25165J46597_1000188 | 3300003214 | Bacteria | 92329 |
| 25 | JGI25153J46596_10000017 | 3300003215 | Bacteria | 274325 |
| 26 | rootL2_10165951 | 3300003322 | Bacteria | 1372 |
| 27 | Ga0055542_1004389 | 3300003762 | Bacteria | 3446 |
| 28 | Ga0055536_1000713 | 3300003781 | Bacteria | 22261 |
| 29 | Ga0055536_1011158 | 3300003781 | Bacteria | 3484 |
| 30 | Ga0055530_10005655 | 3300003791 | Bacteria | 5854 |
| 31 | Ga0055530_10008737 | 3300003791 | Bacteria | 4006 |
| 32 | Ga0055530_10044614 | 3300003791 | Bacteria | 1062 |
| 33 | Ga0055531_10003646 | 3300003794 | Bacteria | 9711 |
| 34 | Ga0055531_10022471 | 3300003794 | Bacteria | 2402 |
| 35 | Ga0055531_10045466 | 3300003794 | Bacteria | 1218 |
| 36 | Ga0055531_10046828 | 3300003794 | Bacteria | 1184 |
| 37 | Ga0065165_1004847 | 3300005262 | Bacteria | 7999 |
| 38 | Ga0065704_10000192 | 3300005289 | Bacteria | 216848 |
| 39 | Ga0065704_10006257 | 3300005289 | Bacteria | 2774 |
| 40 | Ga0065704_10111589 | 3300005289 | Bacteria | 1950 |
| 41 | Ga0065707_10101327 | 3300005295 | Bacteria | 2872 |
| 42 | Ga0070658_10033853 | 3300005327 | Bacteria | 4111 |
| 43 | Ga0070658_10041598 | 3300005327 | Bacteria | 3708 |
| 44 | Ga0070658_10358454 | 3300005327 | Bacteria | 1249 |
| 45 | Ga0070658_10528373 | 3300005327 | Bacteria | 1020 |
| 46 | Ga0070676_10002175 | 3300005328 | Bacteria | 9989 |
| 47 | Ga0068869_100000848 | 3300005334 | Bacteria | 17540 |
| 48 | Ga0070666_10040596 | 3300005335 | Bacteria | 3106 |
| 49 | Ga0068868_100000154 | 3300005338 | Bacteria | 44616 |
| 50 | Ga0068868_100147581 | 3300005338 | Bacteria | 1935 |
| 51 | Ga0070660_100000544 | 3300005339 | Bacteria | 25288 |
| 52 | Ga0070660_100174061 | 3300005339 | Bacteria | 1740 |
| 53 | Ga0070660_100211179 | 3300005339 | Bacteria | 1576 |
| 54 | Ga0070660_100409501 | 3300005339 | Bacteria | 1122 |
| 55 | Ga0070660_100438185 | 3300005339 | Bacteria | 1083 |
| 56 | Ga0070661_100092363 | 3300005344 | Bacteria | 2242 |
| 57 | Ga0070668_100615823 | 3300005347 | Bacteria | 951 |
| 58 | Ga0070673_100000023 | 3300005364 | Bacteria | 91936 |
| 59 | Ga0070659_100059344 | 3300005366 | Bacteria | 3021 |
| 60 | Ga0070659_100059457 | 3300005366 | Bacteria | 3018 |
| 61 | Ga0070659_100066008 | 3300005366 | Bacteria | 2867 |
| 62 | Ga0070659_100075161 | 3300005366 | Bacteria | 2692 |
| 63 | Ga0070659_100663842 | 3300005366 | Bacteria | 899 |
| 64 | Ga0070667_100001100 | 3300005367 | Bacteria | 24778 |
| 65 | Ga0070663_100001998 | 3300005455 | Bacteria | 11388 |
| 66 | Ga0070678_100054021 | 3300005456 | Bacteria | 2924 |
| 67 | Ga0070662_100002062 | 3300005457 | Bacteria | 12318 |
| 68 | Ga0070662_100081846 | 3300005457 | Bacteria | 2406 |
| 69 | Ga0070662_100131072 | 3300005457 | Bacteria | 1933 |
| 70 | Ga0070681_10094688 | 3300005458 | Bacteria | 2935 |
| 71 | Ga0068867_100000007 | 3300005459 | Bacteria | 148726 |
| 72 | Ga0070684_100180891 | 3300005535 | Bacteria | 1917 |
| 73 | Ga0068853_100023296 | 3300005539 | Bacteria | 5181 |
| 74 | Ga0068853_100025947 | 3300005539 | Bacteria | 4918 |
| 75 | Ga0068853_100069304 | 3300005539 | Bacteria | 3068 |
| 76 | Ga0070672_100042427 | 3300005543 | Bacteria | 3503 |
| 77 | Ga0070693_100281806 | 3300005547 | Bacteria | 1113 |
| 78 | Ga0070665_100004652 | 3300005548 | Bacteria | 14330 |
| 79 | Ga0068855_100000029 | 3300005563 | Bacteria | 171278 |
| 80 | Ga0068855_100001148 | 3300005563 | Bacteria | 32786 |
| 81 | Ga0068855_100191725 | 3300005563 | Bacteria | 2305 |
| 82 | Ga0068855_100449801 | 3300005563 | Bacteria | 1406 |
| 83 | Ga0070664_100424026 | 3300005564 | Bacteria | 1219 |
| 84 | Ga0068857_100055573 | 3300005577 | Bacteria | 3513 |
| 85 | Ga0068854_100000027 | 3300005578 | Bacteria | 117836 |
| 86 | Ga0068854_100066764 | 3300005578 | Bacteria | 2619 |
| 87 | Ga0068854_100154085 | 3300005578 | Bacteria | 1774 |
| 88 | Ga0068854_100218332 | 3300005578 | Bacteria | 1507 |
| 89 | Ga0068856_100004098 | 3300005614 | Bacteria | 14566 |
| 90 | Ga0068852_100004278 | 3300005616 | Bacteria | 10072 |
| 91 | Ga0068852_100006260 | 3300005616 | Bacteria | 8587 |
| 92 | Ga0068852_100025178 | 3300005616 | Bacteria | 4818 |
| 93 | Ga0068852_100129866 | 3300005616 | Bacteria | 2319 |
| 94 | Ga0068852_100182937 | 3300005616 | Bacteria | 1972 |
| 95 | Ga0068864_100002125 | 3300005618 | Bacteria | 16383 |
| 96 | Ga0068866_10012667 | 3300005718 | Bacteria | 3680 |
| 97 | Ga0068858_100000228 | 3300005842 | Bacteria | 60736 |
| 98 | Ga0068858_100001700 | 3300005842 | Bacteria | 22479 |
| 99 | Ga0068860_100286162 | 3300005843 | Bacteria | 1612 |
| 100 | Ga0075365_10178714 | 3300006038 | Bacteria | 1483 |
| 101 | Ga0075368_10000055 | 3300006042 | Bacteria | 27866 |
| 102 | Ga0075368_10000168 | 3300006042 | Bacteria | 17741 |
| 103 | Ga0075368_10000967 | 3300006042 | Bacteria | 8953 |
| 104 | Ga0075368_10032193 | 3300006042 | Bacteria | 2035 |
| 105 | Ga0075363_100006130 | 3300006048 | Bacteria | 5429 |
| 106 | Ga0075363_100017846 | 3300006048 | Bacteria | 3527 |
| 107 | Ga0075363_100096373 | 3300006048 | Bacteria | 1633 |
| 108 | Ga0075364_10206394 | 3300006051 | Bacteria | 1332 |
| 109 | Ga0075362_10002811 | 3300006177 | Bacteria | 5939 |
| 110 | Ga0075362_10034881 | 3300006177 | Bacteria | 2195 |
| 111 | Ga0075367_10000109 | 3300006178 | Bacteria | 23429 |
| 112 | Ga0075367_10000289 | 3300006178 | Bacteria | 17620 |
| 113 | Ga0075367_10006417 | 3300006178 | Bacteria | 5939 |
| 114 | Ga0075367_10049680 | 3300006178 | Bacteria | 2473 |
| 115 | Ga0075369_10095090 | 3300006186 | Bacteria | 1332 |
| 116 | Ga0075369_10155901 | 3300006186 | Bacteria | 1045 |
| 117 | Ga0075366_10037690 | 3300006195 | Bacteria | 2855 |
| 118 | Ga0075366_10076800 | 3300006195 | Bacteria | 1993 |
| 119 | Ga0075366_10143533 | 3300006195 | Bacteria | 1444 |
| 120 | Ga0097621_100002061 | 3300006237 | Bacteria | 13748 |
| 121 | Ga0075370_10000257 | 3300006353 | Bacteria | 18995 |
| 122 | Ga0075370_10026515 | 3300006353 | Bacteria | 3211 |
| 123 | Ga0075370_10050753 | 3300006353 | Bacteria | 2353 |
| 124 | Ga0075370_10085395 | 3300006353 | Bacteria | 1817 |
| 125 | Ga0075370_10125899 | 3300006353 | Bacteria | 1493 |
| 126 | Ga0068871_100002074 | 3300006358 | Bacteria | 13555 |
| 127 | Ga0068865_100000010 | 3300006881 | Bacteria | 159548 |
| 128 | Ga0105240_10013748 | 3300009093 | Bacteria | 11095 |
| 129 | Ga0105240_10017476 | 3300009093 | Bacteria | 9666 |
| 130 | Ga0105240_10070818 | 3300009093 | Bacteria | 4313 |
| 131 | Ga0105240_10304868 | 3300009093 | Bacteria | 1821 |
| 132 | Ga0105245_10002089 | 3300009098 | Bacteria | 18117 |
| 133 | Ga0105245_10009485 | 3300009098 | Bacteria | 8488 |
| 134 | Ga0114129_10149346 | 3300009147 | Bacteria | 3198 |
| 135 | Ga0105243_10000950 | 3300009148 | Bacteria | 27049 |
| 136 | Ga0105243_10056170 | 3300009148 | Bacteria | 3129 |
| 137 | Ga0105243_10294328 | 3300009148 | Bacteria | 1468 |
| 138 | Ga0105243_10715950 | 3300009148 | Bacteria | 977 |
| 139 | Ga0105241_10045550 | 3300009174 | Bacteria | 3328 |
| 140 | Ga0105241_10415116 | 3300009174 | Bacteria | 1183 |
| 141 | Ga0105242_10000210 | 3300009176 | Bacteria | 45627 |
| 142 | Ga0105248_10010320 | 3300009177 | Bacteria | 10279 |
| 143 | Ga0105248_10017254 | 3300009177 | Bacteria | 7955 |
| 144 | Ga0105237_10010097 | 3300009545 | Bacteria | 10069 |
| 145 | Ga0105237_10051294 | 3300009545 | Bacteria | 4144 |
| 146 | Ga0105237_10458234 | 3300009545 | Bacteria | 1281 |
| 147 | Ga0105237_10585404 | 3300009545 | Bacteria | 1123 |
| 148 | Ga0105238_10027777 | 3300009551 | Bacteria | 5766 |
| 149 | Ga0105238_10226524 | 3300009551 | Bacteria | 1846 |
| 150 | Ga0105238_10473056 | 3300009551 | Bacteria | 1252 |
| 151 | Ga0105249_10017303 | 3300009553 | Bacteria | 6400 |
| 152 | Ga0105148_100253 | 3300009978 | Bacteria | 7295 |
| 153 | Ga0105239_10000025 | 3300010375 | Bacteria | 254049 |
| 154 | Ga0105239_10004123 | 3300010375 | Bacteria | 17464 |
| 155 | Ga0105239_10031481 | 3300010375 | Bacteria | 5833 |
| 156 | Ga0105239_10046782 | 3300010375 | Bacteria | 4741 |
| 157 | Ga0105246_10000472 | 3300011119 | Bacteria | 21681 |
| 158 | Ga0157373_10047916 | 3300013100 | Bacteria | 3047 |
| 159 | Ga0157373_10084627 | 3300013100 | Bacteria | 2235 |
| 160 | Ga0157373_10264350 | 3300013100 | Bacteria | 1218 |
| 161 | Ga0157371_10211638 | 3300013102 | Bacteria | 1391 |
| 162 | Ga0157370_10000203 | 3300013104 | Bacteria | 75249 |
| 163 | Ga0157370_10074058 | 3300013104 | Bacteria | 3212 |
| 164 | Ga0157369_10057364 | 3300013105 | Bacteria | 4202 |
| 165 | Ga0157369_10203149 | 3300013105 | Bacteria | 2079 |
| 166 | Ga0157369_10511326 | 3300013105 | Bacteria | 1242 |
| 167 | Ga0157374_10000830 | 3300013296 | Bacteria | 27049 |
| 168 | Ga0157374_10045139 | 3300013296 | Bacteria | 4078 |
| 169 | Ga0157374_10071508 | 3300013296 | Bacteria | 3271 |
| 170 | Ga0157374_10103118 | 3300013296 | Bacteria | 2737 |
| 171 | Ga0157378_10001477 | 3300013297 | Bacteria | 21228 |
| 172 | Ga0157378_10084028 | 3300013297 | Bacteria | 2882 |
| 173 | Ga0157378_10166335 | 3300013297 | Bacteria | 2066 |
| 174 | Ga0163162_10001078 | 3300013306 | Bacteria | 25383 |
| 175 | Ga0163162_10446220 | 3300013306 | Bacteria | 1426 |
| 176 | Ga0157372_10010036 | 3300013307 | Bacteria | 10070 |
| 177 | Ga0157372_10058023 | 3300013307 | Bacteria | 4327 |
| 178 | Ga0157372_10179976 | 3300013307 | Bacteria | 2447 |
| 179 | Ga0157372_10339814 | 3300013307 | Bacteria | 1749 |
| 180 | Ga0157375_10002120 | 3300013308 | Bacteria | 17145 |
| 181 | Ga0157376_10000047 | 3300014969 | Bacteria | 107974 |
| 182 | Ga0183363_1002 | 3300015690 | Bacteria | 425040 |
| 183 | Ga0163161_10013007 | 3300017792 | Bacteria | 5783 |
| 184 | Ga0207427_101974 | 3300025231 | Bacteria | 6255 |
| 185 | Ga0207425_1000022 | 3300025245 | Bacteria | 355305 |
| 186 | Ga0209646_1021491 | 3300025246 | Bacteria | 926 |
| 187 | Ga0209026_1002441 | 3300025250 | Bacteria | 6982 |
| 188 | Ga0209026_1004353 | 3300025250 | Bacteria | 4235 |
| 189 | Ga0209148_1000061 | 3300025254 | Bacteria | 349575 |
| 190 | Ga0209148_1001013 | 3300025254 | Bacteria | 17719 |
| 191 | Ga0209129_1000286 | 3300025258 | Bacteria | 48191 |
| 192 | Ga0209233_1000120 | 3300025261 | Bacteria | 233311 |
| 193 | Ga0209233_1000142 | 3300025261 | Bacteria | 192193 |
| 194 | Ga0209565_1007352 | 3300025263 | Bacteria | 2981 |
| 195 | Ga0209455_1000692 | 3300025272 | Bacteria | 19864 |
| 196 | Ga0209675_1000126 | 3300025291 | Bacteria | 104792 |
| 197 | Ga0209676_1000566 | 3300025292 | Bacteria | 55814 |
| 198 | Ga0209676_1008708 | 3300025292 | Bacteria | 4479 |
| 199 | Ga0209676_1009141 | 3300025292 | Bacteria | 4313 |
| 200 | Ga0209676_1026483 | 3300025292 | Bacteria | 1840 |
| 201 | Ga0209025_1001464 | 3300025294 | Bacteria | 30863 |
| 202 | Ga0209025_1019511 | 3300025294 | Bacteria | 3766 |
| 203 | Ga0209025_1075443 | 3300025294 | Bacteria | 1173 |
| 204 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 205 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 206 | Ga0209050_1000047 | 3300025298 | Bacteria | 380561 |
| 207 | Ga0209050_1000127 | 3300025298 | Bacteria | 187951 |
| 208 | Ga0209051_1000246 | 3300025303 | Bacteria | 91170 |
| 209 | Ga0209257_1000517 | 3300025304 | Bacteria | 67082 |
| 210 | Ga0209257_1002394 | 3300025304 | Bacteria | 18771 |
| 211 | Ga0209257_1002888 | 3300025304 | Bacteria | 15965 |
| 212 | Ga0209257_1010863 | 3300025304 | Bacteria | 4507 |
| 213 | Ga0209257_1030916 | 3300025304 | Bacteria | 1720 |
| 214 | Ga0207697_10086321 | 3300025315 | Bacteria | 1326 |
| 215 | Ga0207656_10059287 | 3300025321 | Bacteria | 1675 |
| 216 | Ga0207642_10007810 | 3300025899 | Bacteria | 3631 |
| 217 | Ga0207688_10080907 | 3300025901 | Bacteria | 1855 |
| 218 | Ga0207680_10022733 | 3300025903 | Bacteria | 3414 |
| 219 | Ga0207647_10000270 | 3300025904 | Bacteria | 42605 |
| 220 | Ga0207647_10016335 | 3300025904 | Bacteria | 5068 |
| 221 | Ga0207647_10017291 | 3300025904 | Bacteria | 4902 |
| 222 | Ga0207647_10051484 | 3300025904 | Bacteria | 2545 |
| 223 | Ga0207647_10054292 | 3300025904 | Bacteria | 2466 |
| 224 | Ga0207647_10065747 | 3300025904 | Bacteria | 2200 |
| 225 | Ga0207645_10029542 | 3300025907 | Bacteria | 3533 |
| 226 | Ga0207705_10000316 | 3300025909 | Bacteria | 44059 |
| 227 | Ga0207705_10000963 | 3300025909 | Bacteria | 23546 |
| 228 | Ga0207705_10009514 | 3300025909 | Bacteria | 7072 |
| 229 | Ga0207705_10369159 | 3300025909 | Bacteria | 1107 |
| 230 | Ga0207705_10525168 | 3300025909 | Bacteria | 920 |
| 231 | Ga0207654_10342347 | 3300025911 | Bacteria | 1027 |
| 232 | Ga0207695_10008358 | 3300025913 | Bacteria | 12966 |
| 233 | Ga0207695_10041776 | 3300025913 | Bacteria | 4905 |
| 234 | Ga0207695_10057479 | 3300025913 | Bacteria | 4040 |
| 235 | Ga0207671_10002163 | 3300025914 | Bacteria | 21356 |
| 236 | Ga0207671_10098859 | 3300025914 | Bacteria | 2208 |
| 237 | Ga0207671_10107147 | 3300025914 | Bacteria | 2122 |
| 238 | Ga0207657_10003918 | 3300025919 | Bacteria | 15794 |
| 239 | Ga0207657_10049263 | 3300025919 | Bacteria | 3673 |
| 240 | Ga0207657_10057737 | 3300025919 | Bacteria | 3343 |
| 241 | Ga0207649_10067641 | 3300025920 | Bacteria | 2269 |
| 242 | Ga0207681_10047485 | 3300025923 | Bacteria | 2893 |
| 243 | Ga0207694_10217153 | 3300025924 | Bacteria | 1559 |
| 244 | Ga0207650_10203060 | 3300025925 | Bacteria | 1589 |
| 245 | Ga0207687_10006744 | 3300025927 | Bacteria | 7566 |
| 246 | Ga0207687_10027727 | 3300025927 | Bacteria | 3802 |
| 247 | Ga0207644_10224943 | 3300025931 | Bacteria | 1489 |
| 248 | Ga0207690_10077238 | 3300025932 | Bacteria | 2314 |
| 249 | Ga0207690_10123350 | 3300025932 | Bacteria | 1885 |
| 250 | Ga0207690_10207593 | 3300025932 | Bacteria | 1491 |
| 251 | Ga0207690_10227985 | 3300025932 | Bacteria | 1429 |
| 252 | Ga0207690_10430273 | 3300025932 | Bacteria | 1057 |
| 253 | Ga0207706_10004159 | 3300025933 | Bacteria | 13640 |
| 254 | Ga0207706_10019782 | 3300025933 | Bacteria | 6053 |
| 255 | Ga0207706_10103379 | 3300025933 | Bacteria | 2506 |
| 256 | Ga0207709_10000050 | 3300025935 | Bacteria | 234391 |
| 257 | Ga0207704_10000020 | 3300025938 | Bacteria | 148847 |
| 258 | Ga0207711_10005221 | 3300025941 | Bacteria | 11005 |
| 259 | Ga0207711_10056418 | 3300025941 | Bacteria | 3376 |
| 260 | Ga0207689_10001541 | 3300025942 | Bacteria | 21894 |
| 261 | Ga0207661_10055536 | 3300025944 | Bacteria | 3177 |
| 262 | Ga0207667_10000035 | 3300025949 | Bacteria | 301056 |
| 263 | Ga0207667_10004932 | 3300025949 | Bacteria | 16295 |
| 264 | Ga0207667_10075657 | 3300025949 | Bacteria | 3495 |
| 265 | Ga0207667_10131103 | 3300025949 | Bacteria | 2582 |
| 266 | Ga0207667_10697721 | 3300025949 | Bacteria | 1018 |
| 267 | Ga0207651_10000005 | 3300025960 | Bacteria | 246132 |
| 268 | Ga0207712_10097162 | 3300025961 | Bacteria | 2182 |
| 269 | Ga0207668_10273471 | 3300025972 | Bacteria | 1382 |
| 270 | Ga0207640_10000145 | 3300025981 | Bacteria | 51603 |
| 271 | Ga0207640_10056590 | 3300025981 | Bacteria | 2575 |
| 272 | Ga0207640_10059222 | 3300025981 | Bacteria | 2527 |
| 273 | Ga0207640_10332653 | 3300025981 | Bacteria | 1214 |
| 274 | Ga0207658_10000571 | 3300025986 | Bacteria | 33340 |
| 275 | Ga0207677_10000373 | 3300026023 | Bacteria | 31103 |
| 276 | Ga0207703_10000976 | 3300026035 | Bacteria | 27501 |
| 277 | Ga0207703_10004598 | 3300026035 | Bacteria | 11293 |
| 278 | Ga0207639_10002511 | 3300026041 | Bacteria | 12308 |
| 279 | Ga0207639_10007809 | 3300026041 | Bacteria | 7304 |
| 280 | Ga0207639_10332655 | 3300026041 | Bacteria | 1352 |
| 281 | Ga0207678_10005889 | 3300026067 | Bacteria | 10929 |
| 282 | Ga0207678_10249930 | 3300026067 | Bacteria | 1518 |
| 283 | Ga0207678_10320657 | 3300026067 | Bacteria | 1333 |
| 284 | Ga0207702_10003711 | 3300026078 | Bacteria | 13808 |
| 285 | Ga0207702_10012620 | 3300026078 | Bacteria | 7034 |
| 286 | Ga0207702_10037699 | 3300026078 | Bacteria | 4047 |
| 287 | Ga0207702_10245821 | 3300026078 | Bacteria | 1678 |
| 288 | Ga0207648_10000017 | 3300026089 | Bacteria | 148699 |
| 289 | Ga0207676_10000190 | 3300026095 | Bacteria | 53850 |
| 290 | Ga0207676_10348384 | 3300026095 | Bacteria | 1369 |
| 291 | Ga0207674_10015748 | 3300026116 | Bacteria | 8294 |
| 292 | Ga0207674_10022819 | 3300026116 | Bacteria | 6715 |
| 293 | Ga0207674_10776312 | 3300026116 | Bacteria | 925 |
| 294 | Ga0207674_10892142 | 3300026116 | Bacteria | 857 |
| 295 | Ga0207683_10029414 | 3300026121 | Bacteria | 4757 |
| 296 | Ga0207698_10000712 | 3300026142 | Bacteria | 19239 |
| 297 | Ga0207698_10036634 | 3300026142 | Bacteria | 3603 |
| 298 | Ga0207698_10036776 | 3300026142 | Bacteria | 3598 |
| 299 | Ga0207698_10038607 | 3300026142 | Bacteria | 3530 |
| 300 | Ga0207698_10713009 | 3300026142 | Bacteria | 999 |
| 301 | Ga0209813_10000048 | 3300027866 | Bacteria | 48973 |
| 302 | Ga0209813_10000191 | 3300027866 | Bacteria | 19193 |
| 303 | Ga0209813_10000220 | 3300027866 | Bacteria | 17618 |
| 304 | Ga0268266_10889770 | 3300028379 | Bacteria | 861 |
| 305 | Ga0268264_10245060 | 3300028381 | Bacteria | 1662 |
| 306 | Ga0307517_10026027 | 3300028786 | Bacteria | 7113 |
| 307 | Ga0307513_10061622 | 3300031456 | Bacteria | 3971 |
| 308 | Ga0307513_10256515 | 3300031456 | Bacteria | 1541 |
| 309 | Ga0307508_10004238 | 3300031616 | Bacteria | 14080 |
| 310 | Ga0307510_10191540 | 3300033180 | Bacteria | 1592 |
| 311 | Ga0373946_0289600 | 3300035171 | Bacteria | 807 |
| 312 | Ga0395899_0002116 | 3300037312 | Bacteria | 16321 |
| 313 | Ga0395899_0317704 | 3300037312 | Bacteria | 1050 |
| 314 | Ga0395900_0260720 | 3300037418 | Bacteria | 1731 |
| 315 | Ga0395905_0497526 | 3300037471 | Bacteria | 1119 |
| 316 | Ga0436364_1389735 | 3300037853 | Bacteria | 3606 |
| 317 | Ga0395901_0245370 | 3300038443 | Bacteria | 1867 |
| 318 | Ga0436365_1211005 | 3300039437 | Bacteria | 1323 |
| 319 | Ga0436363_0389907 | 3300039450 | Bacteria | 1756 |
| 320 | Ga0451802_0044966 | 3300041460 | Bacteria | 2341 |
| 321 | Ga0451806_660356 | 3300041462 | Bacteria | 3795 |
| 322 | Ga0451804_0756293 | 3300041463 | Bacteria | 1937 |
| 323 | Ga0451807_2284404 | 3300041486 | Bacteria | 1071 |
| 324 | Ga0451853_1879690 | 3300041512 | Bacteria | 3625 |
| 325 | Ga0439448_0002573 | 3300042005 | Bacteria | 4944 |
| 326 | Ga0439448_0003494 | 3300042005 | Bacteria | 4352 |
| 327 | Ga0439448_0027604 | 3300042005 | Bacteria | 1790 |
| 328 | Ga0439448_0038338 | 3300042005 | Bacteria | 1542 |
| 329 | Ga0439455_0000252 | 3300042012 | Bacteria | 6482 |
| 330 | Ga0439455_0000304 | 3300042012 | Bacteria | 6168 |
| 331 | Ga0439455_0054729 | 3300042012 | Bacteria | 1048 |
| 332 | Ga0439458_0000255 | 3300042157 | Bacteria | 12956 |
| 333 | Ga0439458_0000305 | 3300042157 | Bacteria | 12201 |
| 334 | Ga0439458_0026115 | 3300042157 | Bacteria | 1372 |
| 335 | Ga0466972_0274254 | 3300044658 | Bacteria | 788 |
| 336 | Ga0466966_0019647 | 3300044684 | Bacteria | 4445 |
| 337 | Ga0466963_0008961 | 3300044694 | Bacteria | 6006 |
| 338 | Ga0466964_0012394 | 3300044706 | Bacteria | 3226 |
| 339 | Ga0466964_0018224 | 3300044706 | Bacteria | 2692 |
| 340 | Ga0466971_0000834 | 3300044719 | Bacteria | 12515 |
| 341 | Ga0466968_0054687 | 3300044735 | Bacteria | 1711 |
| 342 | Ga0466970_0012023 | 3300044765 | Bacteria | 4420 |
| 343 | Ga0466957_0274396 | 3300044842 | Bacteria | 1127 |
| 344 | Ga0466960_0014885 | 3300044901 | Bacteria | 3342 |
| 345 | Ga0495627_000582 | 3300046453 | Bacteria | 29200 |
| 346 | Ga0495629_0157525 | 3300046459 | Bacteria | 1578 |
| 347 | Ga0495638_0000267 | 3300046460 | Bacteria | 70470 |
| 348 | Ga0495638_0080909 | 3300046460 | Bacteria | 1973 |
| 349 | Ga0495638_0144399 | 3300046460 | Bacteria | 1386 |
| 350 | Ga0495638_0156654 | 3300046460 | Bacteria | 1317 |
| 351 | Ga0495650_0001090 | 3300046471 | Bacteria | 29761 |
| 352 | Ga0495650_0049328 | 3300046471 | Bacteria | 1749 |
| 353 | Ga0495605_0069453 | 3300046474 | Bacteria | 1668 |
| 354 | Ga0495584_0014651 | 3300046491 | Bacteria | 3995 |
| 355 | Ga0495596_0000196 | 3300046500 | Bacteria | 41923 |
| 356 | Ga0495596_0000537 | 3300046500 | Bacteria | 23841 |
| 357 | Ga0495607_0016964 | 3300046501 | Bacteria | 4688 |
| 358 | Ga0495607_0047613 | 3300046501 | Bacteria | 2511 |
| 359 | Ga0495583_0000030 | 3300046506 | Bacteria | 254970 |
| 360 | Ga0495583_0000252 | 3300046506 | Bacteria | 88617 |
| 361 | Ga0495606_0044223 | 3300046507 | Bacteria | 2964 |
| 362 | Ga0495606_0116794 | 3300046507 | Bacteria | 1602 |
| 363 | Ga0495610_0000081 | 3300046512 | Bacteria | 113513 |
| 364 | Ga0495610_0001175 | 3300046512 | Bacteria | 23733 |
| 365 | Ga0495610_0003890 | 3300046512 | Bacteria | 11329 |
| 366 | Ga0495610_0027251 | 3300046512 | Bacteria | 3039 |
| 367 | Ga0495610_0047804 | 3300046512 | Bacteria | 2103 |
| 368 | Ga0495620_0013539 | 3300046515 | Bacteria | 4173 |
| 369 | Ga0495632_0000007 | 3300046519 | Bacteria | 343246 |
| 370 | Ga0495632_0000306 | 3300046519 | Bacteria | 47401 |
| 371 | Ga0495632_0027007 | 3300046519 | Bacteria | 3013 |
| 372 | Ga0495637_0000569 | 3300046520 | Bacteria | 26380 |
| 373 | Ga0495637_0033327 | 3300046520 | Bacteria | 2263 |
| 374 | Ga0495637_0077167 | 3300046520 | Bacteria | 1334 |
| 375 | Ga0495643_0000042 | 3300046522 | Bacteria | 229665 |
| 376 | Ga0495643_0000304 | 3300046522 | Bacteria | 68483 |
| 377 | Ga0495643_0007419 | 3300046522 | Bacteria | 7074 |
| 378 | Ga0495643_0021213 | 3300046522 | Bacteria | 3731 |
| 379 | Ga0495648_0037584 | 3300046524 | Bacteria | 3109 |
| 380 | Ga0495663_0000005 | 3300046525 | Bacteria | 342265 |
| 381 | Ga0495663_0018295 | 3300046525 | Bacteria | 1995 |
| 382 | Ga0495654_0034814 | 3300046530 | Bacteria | 2539 |
| 383 | Ga0495654_0043751 | 3300046530 | Bacteria | 2218 |
| 384 | Ga0495609_0007089 | 3300046538 | Bacteria | 5641 |
| 385 | Ga0495622_0006810 | 3300046557 | Bacteria | 5304 |
| 386 | Ga0495633_0000491 | 3300046558 | Bacteria | 39973 |
| 387 | Ga0495633_0001879 | 3300046558 | Bacteria | 15338 |
| 388 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 389 | Ga0495611_0098653 | 3300046648 | Bacteria | 1355 |
| 390 | Ga0495611_0256250 | 3300046648 | Bacteria | 810 |
| 391 | Ga0495625_0000671 | 3300046660 | Bacteria | 48757 |
| 392 | Ga0495625_0002401 | 3300046660 | Bacteria | 20305 |
| 393 | Ga0495625_0035771 | 3300046660 | Bacteria | 3657 |
| 394 | Ga0495625_0050839 | 3300046660 | Bacteria | 2972 |
| 395 | Ga0495625_0057335 | 3300046660 | Bacteria | 2770 |
| 396 | Ga0495625_0063243 | 3300046660 | Bacteria | 2614 |
| 397 | Ga0495625_0085854 | 3300046660 | Bacteria | 2184 |
| 398 | Ga0495661_0033156 | 3300046665 | Bacteria | 3259 |
| 399 | Ga0495670_0013380 | 3300046691 | Bacteria | 4036 |
| 400 | Ga0495670_0028819 | 3300046691 | Bacteria | 2753 |
| 401 | Ga0495670_0243820 | 3300046691 | Bacteria | 957 |
| 402 | Ga0495671_0000011 | 3300046692 | Bacteria | 365582 |
| 403 | Ga0495671_0000126 | 3300046692 | Bacteria | 68483 |
| 404 | Ga0495671_0042256 | 3300046692 | Bacteria | 2292 |
| 405 | Ga0495671_0115065 | 3300046692 | Bacteria | 1313 |
| 406 | Ga0495671_0123561 | 3300046692 | Bacteria | 1262 |
| 407 | Ga0495676_0203871 | 3300047321 | Bacteria | 1373 |
| 408 | Ga0495677_0034004 | 3300047445 | Bacteria | 1859 |
| 409 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 410 | Ga0495681_0000517 | 3300047470 | Bacteria | 29470 |
| 411 | Ga0495681_0002422 | 3300047470 | Bacteria | 13333 |
| 412 | Ga0495681_0041330 | 3300047470 | Bacteria | 2239 |
| 413 | Ga0495686_0000063 | 3300047472 | Bacteria | 228575 |
| 414 | Ga0495686_0000082 | 3300047472 | Bacteria | 200115 |
| 415 | Ga0495686_0000401 | 3300047472 | Bacteria | 68555 |
| 416 | Ga0495686_0000661 | 3300047472 | Bacteria | 46810 |
| 417 | Ga0495686_0009632 | 3300047472 | Bacteria | 6938 |
| 418 | Ga0495686_0020603 | 3300047472 | Bacteria | 4395 |
| 419 | Ga0495686_0027175 | 3300047472 | Bacteria | 3738 |
| 420 | Ga0495686_0082333 | 3300047472 | Bacteria | 1964 |
| 421 | Ga0495686_0104101 | 3300047472 | Bacteria | 1709 |
| 422 | Ga0495615_0000020 | 3300048090 | Bacteria | 53202 |
| 423 | Ga0495626_0000298 | 3300048091 | Bacteria | 53039 |
| 424 | Ga0496102_0197094 | 3300048905 | Unclassified | 1898 |
| 425 | Ga0496102_0586199 | 3300048905 | Bacteria | 1038 |
| 426 | Ga0496103_0348167 | 3300048906 | Bacteria | 953 |
| 427 | Ga0496110_0050768 | 3300048913 | Bacteria | 3643 |
| 428 | Ga0496110_0609108 | 3300048913 | Bacteria | 990 |
| 429 | Ga0496111_0033642 | 3300048914 | Bacteria | 3657 |
| 430 | Ga0496111_0107898 | 3300048914 | Bacteria | 2050 |
| 431 | Ga0496111_0413687 | 3300048914 | Bacteria | 996 |
| 432 | Ga0496113_0092142 | 3300048916 | Bacteria | 2337 |
| 433 | Ga0496115_0000285 | 3300048918 | Bacteria | 43764 |
| 434 | Ga0496116_0000035 | 3300048919 | Bacteria | 402424 |
| 435 | Ga0496116_0047806 | 3300048919 | Bacteria | 2877 |
| 436 | Ga0496117_0011402 | 3300048920 | Bacteria | 7961 |
| 437 | Ga0496117_0043351 | 3300048920 | Bacteria | 3272 |
| 438 | Ga0496117_0047825 | 3300048920 | Bacteria | 3063 |
| 439 | Ga0496117_0057221 | 3300048920 | Bacteria | 2710 |
| 440 | Ga0496117_0119468 | 3300048920 | Bacteria | 1622 |
| 441 | Ga0496118_0015807 | 3300048921 | Bacteria | 6962 |
| 442 | Ga0496118_0030413 | 3300048921 | Bacteria | 4507 |
| 443 | Ga0496118_0035164 | 3300048921 | Bacteria | 4074 |
| 444 | Ga0496118_0036903 | 3300048921 | Bacteria | 3943 |
| 445 | Ga0496118_0139977 | 3300048921 | Bacteria | 1536 |
| 446 | Ga0496119_0033280 | 3300048922 | Bacteria | 3421 |
| 447 | Ga0496119_0052623 | 3300048922 | Bacteria | 2493 |
| 448 | Ga0496120_0102515 | 3300048923 | Bacteria | 1509 |
| 449 | Ga0496121_0000105 | 3300048924 | Bacteria | 191437 |
| 450 | Ga0496121_0000579 | 3300048924 | Bacteria | 68757 |
| 451 | Ga0496121_0000671 | 3300048924 | Bacteria | 63867 |
| 452 | Ga0496121_0002960 | 3300048924 | Bacteria | 24756 |
| 453 | Ga0496121_0002979 | 3300048924 | Bacteria | 24637 |
| 454 | Ga0496121_0003092 | 3300048924 | Bacteria | 24067 |
| 455 | Ga0496121_0003231 | 3300048924 | Bacteria | 23434 |
| 456 | Ga0496121_0030578 | 3300048924 | Bacteria | 4943 |
| 457 | Ga0496122_0005685 | 3300048925 | Bacteria | 14721 |
| 458 | Ga0496122_0018901 | 3300048925 | Bacteria | 6329 |
| 459 | Ga0496122_0026933 | 3300048925 | Bacteria | 4935 |
| 460 | Ga0496123_0000159 | 3300048926 | Bacteria | 136014 |
| 461 | Ga0496123_0002459 | 3300048926 | Bacteria | 22941 |
| 462 | Ga0496123_0003542 | 3300048926 | Bacteria | 17370 |
| 463 | Ga0496123_0003707 | 3300048926 | Bacteria | 16803 |
| 464 | Ga0496124_0002365 | 3300048927 | Bacteria | 24886 |
| 465 | Ga0496124_0005911 | 3300048927 | Bacteria | 13541 |
| 466 | Ga0496124_0015727 | 3300048927 | Bacteria | 7234 |
| 467 | Ga0496124_0030523 | 3300048927 | Bacteria | 4783 |
| 468 | Ga0496124_0038486 | 3300048927 | Bacteria | 4153 |
| 469 | Ga0496124_0046585 | 3300048927 | Bacteria | 3712 |
| 470 | Ga0496124_0067837 | 3300048927 | Bacteria | 2966 |
| 471 | Ga0496124_0090965 | 3300048927 | Bacteria | 2487 |
| 472 | Ga0496124_0155365 | 3300048927 | Bacteria | 1790 |
| 473 | Ga0496124_0235082 | 3300048927 | Bacteria | 1367 |
| 474 | Ga0496124_0262178 | 3300048927 | Bacteria | 1271 |
| 475 | Ga0496125_0012910 | 3300048928 | Bacteria | 8247 |
| 476 | Ga0496125_0031437 | 3300048928 | Bacteria | 4731 |
| 477 | Ga0496125_0040553 | 3300048928 | Bacteria | 3992 |
| 478 | Ga0496125_0121127 | 3300048928 | Bacteria | 1866 |
| 479 | Ga0496125_0215487 | 3300048928 | Bacteria | 1242 |
| 480 | Ga0496126_0000077 | 3300048929 | Bacteria | 231592 |
| 481 | Ga0496126_0001878 | 3300048929 | Bacteria | 30558 |
| 482 | Ga0496126_0014533 | 3300048929 | Bacteria | 7953 |
| 483 | Ga0496126_0058122 | 3300048929 | Bacteria | 3487 |
| 484 | Ga0496126_0112148 | 3300048929 | Bacteria | 2375 |
| 485 | Ga0496126_0196016 | 3300048929 | Bacteria | 1708 |
| 486 | Ga0496126_0320266 | 3300048929 | Bacteria | 1275 |
| 487 | Ga0495682_0125592 | 3300049460 | Bacteria | 918 |
| 488 | Ga0501033_0000215 | 3300049570 | Bacteria | 55477 |
| 489 | Ga0501036_0095571 | 3300049572 | Bacteria | 2512 |
| 490 | Ga0501037_0145969 | 3300049573 | Bacteria | 1692 |
| 491 | Ga0501038_0106928 | 3300049574 | Bacteria | 2321 |
| 492 | Ga0501043_0072900 | 3300049579 | Bacteria | 2697 |
| 493 | Ga0501047_0001117 | 3300049581 | Bacteria | 26643 |
| 494 | Ga0501047_0009954 | 3300049581 | Bacteria | 8991 |
| 495 | Ga0501073_0212203 | 3300049589 | Bacteria | 1338 |
| 496 | Ga0501211_001344 | 3300049658 | Bacteria | 2623 |
| 497 | Ga0501223_000064 | 3300049663 | Bacteria | 34167 |
| 498 | Ga0501235_001360 | 3300049669 | Bacteria | 5179 |
| 499 | Ga0501225_0000063 | 3300049705 | Bacteria | 34813 |
| 500 | Ga0501245_005207 | 3300049708 | Bacteria | 1799 |
| 501 | Ga0501044_0000160 | 3300049823 | Bacteria | 83543 |
| 502 | Ga0501044_0079519 | 3300049823 | Bacteria | 3322 |
| 503 | Ga0501044_0256729 | 3300049823 | Bacteria | 1687 |
| 504 | nmdc:mga03683_10661_c1 | 3300050489 | Bacteria | 3302 |
| 505 | nmdc:mga03683_16551_c1 | 3300050489 | Bacteria | 2772 |
| 506 | nmdc:mga03683_927_c1 | 3300050489 | Bacteria | 8482 |
| 507 | nmdc:mga03n38_30348_c1 | 3300050490 | Bacteria | 2272 |
| 508 | nmdc:mga03n38_82620_c1 | 3300050490 | Bacteria | 1513 |
| 509 | nmdc:mga00v17_11965_c1 | 3300050491 | Bacteria | 4776 |
| 510 | nmdc:mga00v17_1563_c1 | 3300050491 | Bacteria | 11955 |
| 511 | nmdc:mga00v17_3583_c1 | 3300050491 | Bacteria | 8021 |
| 512 | nmdc:mga0yw44_158276_c1 | 3300050492 | Bacteria | 1482 |
| 513 | nmdc:mga0yw44_330966_c1 | 3300050492 | Bacteria | 1024 |
| 514 | nmdc:mga0k408_149619_c1 | 3300050493 | Bacteria | 1390 |
| 515 | nmdc:mga0k408_3784_c1 | 3300050493 | Bacteria | 8022 |
| 516 | nmdc:mga0k408_39900_c2 | 3300050493 | Bacteria | 2077 |
| 517 | nmdc:mga06z11_117_c1 | 3300050494 | Bacteria | 32760 |
| 518 | nmdc:mga06z11_295_c1 | 3300050494 | Bacteria | 19152 |
| 519 | nmdc:mga04h51_162_c1 | 3300050495 | Bacteria | 19154 |
| 520 | nmdc:mga04h51_178_c1 | 3300050495 | Bacteria | 17872 |
| 521 | nmdc:mga04h51_29230_c1 | 3300050495 | Bacteria | 1725 |
| 522 | nmdc:mga04h51_656_c1 | 3300050495 | Bacteria | 8066 |
| 523 | nmdc:mga07m45_21157_c1 | 3300050496 | Bacteria | 3539 |
| 524 | nmdc:mga07m45_22_c1 | 3300050496 | Bacteria | 117399 |
| 525 | nmdc:mga07m45_40998_c1 | 3300050496 | Bacteria | 2592 |
| 526 | nmdc:mga07m45_70616_c1 | 3300050496 | Bacteria | 1383 |
| 527 | nmdc:mga07m45_9859_c1 | 3300050496 | Bacteria | 4968 |
| 528 | nmdc:mga05p37_127775_c1 | 3300050507 | Bacteria | 3120 |
| 529 | nmdc:mga0sz30_144328_c1 | 3300050516 | Bacteria | 1052 |
| 530 | nmdc:mga0sz30_48389_c1 | 3300050516 | Bacteria | 1799 |
| 531 | nmdc:mga0sz30_714_c2 | 3300050516 | Bacteria | 2578 |
| 532 | Ga0495619_0384861 | 3300053085 | Bacteria | 969 |
| 533 | Ga0500643_000385 | 3300053087 | Bacteria | 34308 |
| 534 | Ga0500643_002094 | 3300053087 | Bacteria | 10622 |
| 535 | Ga0500647_0066437 | 3300053091 | Bacteria | 1734 |
| 536 | Ga0500651_0345311 | 3300053093 | Bacteria | 845 |
| 537 | Ga0500641_0061888 | 3300053096 | Bacteria | 1560 |
| 538 | Ga0500555_000163 | 3300053103 | Bacteria | 31013 |
| 539 | Ga0500592_001641 | 3300053116 | Bacteria | 3633 |
| 540 | Ga0500594_0009144 | 3300053118 | Bacteria | 2276 |
| 541 | Ga0500597_019103 | 3300053120 | Bacteria | 2670 |
| 542 | Ga0500607_000065 | 3300053121 | Bacteria | 74437 |
| 543 | Ga0500607_000386 | 3300053121 | Bacteria | 42198 |
| 544 | Ga0500614_016829 | 3300053123 | Bacteria | 1646 |
| 545 | Ga0500618_013410 | 3300053125 | Bacteria | 2117 |
| 546 | Ga0500618_031599 | 3300053125 | Bacteria | 1241 |
| 547 | Ga0500642_0000574 | 3300053130 | Bacteria | 11074 |
| 548 | Ga0500655_000165 | 3300053133 | Bacteria | 16205 |
| 549 | Ga0500658_0007915 | 3300053134 | Bacteria | 3927 |
| 550 | Ga0500559_0000668 | 3300053136 | Bacteria | 22938 |
| 551 | Ga0500559_0012091 | 3300053136 | Bacteria | 3676 |
| 552 | Ga0500559_0013370 | 3300053136 | Bacteria | 3477 |
| 553 | Ga0500559_0059748 | 3300053136 | Bacteria | 1698 |
| 554 | Ga0500568_0026023 | 3300053139 | Bacteria | 2460 |
| 555 | Ga0500577_0012472 | 3300053142 | Bacteria | 2571 |
| 556 | Ga0500577_0120786 | 3300053142 | Bacteria | 1090 |
| 557 | Ga0500577_0132164 | 3300053142 | Bacteria | 1047 |
| 558 | Ga0500590_000953 | 3300053148 | Bacteria | 11128 |
| 559 | Ga0500616_0010849 | 3300053153 | Bacteria | 5431 |
| 560 | Ga0500616_0035196 | 3300053153 | Bacteria | 2724 |
| 561 | Ga0500616_0041068 | 3300053153 | Bacteria | 2484 |
| 562 | Ga0500616_0129036 | 3300053153 | Bacteria | 1197 |
| 563 | Ga0500616_0152766 | 3300053153 | Eukaryota | 1067 |
| 564 | Ga0500622_0002328 | 3300053156 | Bacteria | 13870 |
| 565 | Ga0500622_0034813 | 3300053156 | Bacteria | 2637 |
| 566 | Ga0500622_0132477 | 3300053156 | Bacteria | 1197 |
| 567 | Ga0500624_000012 | 3300053157 | Bacteria | 165895 |
| 568 | Ga0500624_000020 | 3300053157 | Bacteria | 118392 |
| 569 | Ga0500624_000061 | 3300053157 | Bacteria | 66422 |
| 570 | Ga0500627_0000013 | 3300053158 | Bacteria | 136204 |
| 571 | Ga0500639_096613 | 3300053163 | Bacteria | 1462 |
| 572 | Ga0500636_0001685 | 3300053177 | Bacteria | 12100 |
| 573 | Ga0500636_0041154 | 3300053177 | Bacteria | 2733 |
| 574 | Ga0500637_0000022 | 3300053178 | Bacteria | 61494 |
| 575 | Ga0500637_0006428 | 3300053178 | Bacteria | 5788 |
| 576 | Ga0500570_053881 | 3300053724 | Bacteria | 2000 |
| 577 | Ga0500645_020731 | 3300053730 | Bacteria | 2034 |
| 578 | Ga0500645_037940 | 3300053730 | Bacteria | 1430 |
| 579 | Ga0500661_004899 | 3300055283 | Bacteria | 2504 |
| 580 | Ga0466962_0011448 | 3300061719 | Bacteria | 4270 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048906 | Ga0496103_0348167 | Ga0496103_0348167_13_654 | 213 |
| 2 | 3300002075 | JGI24738J21930_10000330 | JGI24738J21930_1000033014 | 214 |
| 3 | 3300003794 | Ga0055531_10046828 | Ga0055531_100468281 | 215 |
| 4 | 3300053085 | Ga0495619_0384861 | Ga0495619_0384861_127_876 | 231 |
| 5 | 3300025263 | Ga0209565_1007352 | Ga0209565_10073523 | 233 |
| 6 | 3300025291 | Ga0209675_1000126 | Ga0209675_100012685 | 233 |
| 7 | 3300025292 | Ga0209676_1000566 | Ga0209676_100056634 | 233 |
| 8 | 3300025294 | Ga0209025_1019511 | Ga0209025_10195113 | 233 |
| 9 | 3300025298 | Ga0209050_1000047 | Ga0209050_100004710 | 233 |
| 10 | 3300048929 | Ga0496126_0196016 | Ga0496126_0196016_541_1314 | 233 |
| 11 | 3300048929 | Ga0496126_0320266 | Ga0496126_0320266_307_1053 | 233 |
| 12 | 3300003781 | Ga0055536_1000713 | Ga0055536_10007135 | 234 |
| 13 | 3300049570 | Ga0501033_0000215 | Ga0501033_0000215_8537_9283 | 237 |
| 14 | 3300049572 | Ga0501036_0095571 | Ga0501036_0095571_289_1035 | 237 |
| 15 | 3300049573 | Ga0501037_0145969 | Ga0501037_0145969_678_1424 | 237 |
| 16 | 3300049574 | Ga0501038_0106928 | Ga0501038_0106928_634_1380 | 237 |
| 17 | 3300049581 | Ga0501047_0009954 | Ga0501047_0009954_3583_4329 | 237 |
| 18 | 3300049823 | Ga0501044_0000160 | Ga0501044_0000160_34405_35151 | 237 |
| 19 | 3300031456 | Ga0307513_10061622 | Ga0307513_100616222 | 238 |
| 20 | 3300009147 | Ga0114129_10149346 | Ga0114129_101493462 | 242 |
| 21 | 3300050507 | nmdc:mga05p37_127775_c1 | nmdc:mga05p37_127775_c1_2235_2981 | 242 |
| 22 | iso_pu_bacteria | 2582581305 | 2585262113 | 243 |
| 23 | iso_pu_bacteria | 2582581305 | 2585262301 | 243 |
| 24 | iso_pu_bacteria | 2643221541 | 2643731408 | 243 |
| 25 | iso_pu_bacteria | 2643221606 | 2644042264 | 243 |
| 26 | iso_pu_bacteria | 2643221671 | 2644394094 | 243 |
| 27 | iso_pu_bacteria | 2946787523 | 2946789654 | 243 |
| 28 | iso_pu_bacteria | 2512564014 | 2512645509 | 244 |
| 29 | iso_pu_bacteria | 2643221560 | 2643822632 | 244 |
| 30 | iso_pu_bacteria | 2643221560 | 2643822876 | 244 |
| 31 | iso_pu_bacteria | 2830075706 | 2830076898 | 244 |
| 32 | iso_pu_bacteria | 2852653556 | 2852656830 | 244 |
| 33 | iso_pu_bacteria | 2852680915 | 2852683925 | 244 |
| 34 | iso_pu_bacteria | 2909042592 | 2909047266 | 244 |
| 35 | iso_pu_bacteria | 2928027323 | 2928030365 | 244 |
| 36 | iso_pu_bacteria | 2984555340 | 2984555766 | 244 |
| 37 | iso_pu_bacteria | 2984564862 | 2984566124 | 244 |
| 38 | iso_pu_bacteria | 2990265787 | 2990268660 | 244 |
| 39 | iso_pu_bacteria | 2993356040 | 2993357136 | 244 |
| 40 | iso_pu_bacteria | 2993693658 | 2993694634 | 244 |
| 41 | iso_pu_bacteria | 8057101203 | 8057101691 | 244 |
| 42 | iso_pu_bacteria | 2510917021 | 2511128233 | 245 |
| 43 | iso_pu_bacteria | 2599185354 | 2600200538 | 245 |
| 44 | iso_pu_bacteria | 2808606401 | 2809064602 | 245 |
| 45 | iso_pu_bacteria | 2808606404 | 2809080487 | 245 |
| 46 | iso_pu_bacteria | 2808606405 | 2809084851 | 245 |
| 47 | iso_pu_bacteria | 2852680915 | 2852683846 | 245 |
| 48 | 3300048924 | Ga0496121_0000105 | Ga0496121_0000105_133409_134149 | 246 |
| 49 | iso_pu_bacteria | 2643221563 | 2643833855 | 246 |
| 50 | iso_pu_bacteria | 2643221608 | 2644054781 | 246 |
| 51 | iso_pu_bacteria | 2818991438 | 2819552183 | 246 |
| 52 | iso_pu_bacteria | 2852653556 | 2852653561 | 246 |
| 53 | iso_pu_bacteria | 2928968154 | 2928971819 | 246 |
| 54 | iso_pu_bacteria | 8054302542 | 8054303857 | 246 |
| 55 | 3300003781 | Ga0055536_1011158 | Ga0055536_10111582 | 247 |
| 56 | 3300003791 | Ga0055530_10008737 | Ga0055530_100087374 | 247 |
| 57 | 3300003794 | Ga0055531_10022471 | Ga0055531_100224711 | 247 |
| 58 | 3300013105 | Ga0157369_10203149 | Ga0157369_102031493 | 247 |
| 59 | 3300025245 | Ga0207425_1000022 | Ga0207425_1000022187 | 247 |
| 60 | 3300025258 | Ga0209129_1000286 | Ga0209129_100028612 | 247 |
| 61 | 3300025292 | Ga0209676_1008708 | Ga0209676_10087084 | 247 |
| 62 | 3300025292 | Ga0209676_1009141 | Ga0209676_10091414 | 247 |
| 63 | 3300025294 | Ga0209025_1001464 | Ga0209025_10014648 | 247 |
| 64 | 3300025297 | Ga0209758_1000004 | Ga0209758_1000004814 | 247 |
| 65 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000012818 | 247 |
| 66 | 3300025303 | Ga0209051_1000246 | Ga0209051_100024618 | 247 |
| 67 | 3300025304 | Ga0209257_1010863 | Ga0209257_10108634 | 247 |
| 68 | 3300025304 | Ga0209257_1030916 | Ga0209257_10309162 | 247 |
| 69 | 3300025904 | Ga0207647_10054292 | Ga0207647_100542922 | 247 |
| 70 | 3300046459 | Ga0495629_0157525 | Ga0495629_0157525_87_830 | 247 |
| 71 | 3300046501 | Ga0495607_0047613 | Ga0495607_0047613_1054_1797 | 247 |
| 72 | 3300046506 | Ga0495583_0000252 | Ga0495583_0000252_35905_36648 | 247 |
| 73 | 3300046520 | Ga0495637_0033327 | Ga0495637_0033327_1381_2124 | 247 |
| 74 | 3300046520 | Ga0495637_0077167 | Ga0495637_0077167_507_1250 | 247 |
| 75 | 3300046522 | Ga0495643_0021213 | Ga0495643_0021213_598_1341 | 247 |
| 76 | 3300046525 | Ga0495663_0018295 | Ga0495663_0018295_1155_1898 | 247 |
| 77 | 3300046660 | Ga0495625_0000671 | Ga0495625_0000671_28637_29380 | 247 |
| 78 | 3300046660 | Ga0495625_0035771 | Ga0495625_0035771_959_1702 | 247 |
| 79 | 3300046660 | Ga0495625_0050839 | Ga0495625_0050839_768_1511 | 247 |
| 80 | 3300046691 | Ga0495670_0028819 | Ga0495670_0028819_484_1227 | 247 |
| 81 | 3300046692 | Ga0495671_0000011 | Ga0495671_0000011_51939_52682 | 247 |
| 82 | 3300047321 | Ga0495676_0203871 | Ga0495676_0203871_358_1101 | 247 |
| 83 | 3300047469 | Ga0495673_0000013 | Ga0495673_0000013_320003_320746 | 247 |
| 84 | 3300047472 | Ga0495686_0027175 | Ga0495686_0027175_174_917 | 247 |
| 85 | 3300048905 | Ga0496102_0197094 | Ga0496102_0197094_243_986 | 247 |
| 86 | 3300053091 | Ga0500647_0066437 | Ga0500647_0066437_184_927 | 247 |
| 87 | 3300053123 | Ga0500614_016829 | Ga0500614_016829_814_1557 | 247 |
| 88 | 3300053125 | Ga0500618_013410 | Ga0500618_013410_340_1083 | 247 |
| 89 | 3300053133 | Ga0500655_000165 | Ga0500655_000165_4924_5667 | 247 |
| 90 | 3300053148 | Ga0500590_000953 | Ga0500590_000953_7196_7939 | 247 |
| 91 | 3300053156 | Ga0500622_0034813 | Ga0500622_0034813_76_819 | 247 |
| 92 | 3300053163 | Ga0500639_096613 | Ga0500639_096613_675_1418 | 247 |
| 93 | 3300053177 | Ga0500636_0041154 | Ga0500636_0041154_1412_2155 | 247 |
| 94 | 3300053724 | Ga0500570_053881 | Ga0500570_053881_542_1285 | 247 |
| 95 | 2162886007 | SwRhRL2b_contig_860484 | SwRhRL2b_0540.00007830 | 248 |
| 96 | 3300002075 | JGI24738J21930_10000338 | JGI24738J21930_1000033810 | 248 |
| 97 | 3300002459 | JGI24751J29686_10001912 | JGI24751J29686_100019123 | 248 |
| 98 | 3300003214 | JGI25165J46597_1000073 | JGI25165J46597_1000073117 | 248 |
| 99 | 3300003794 | Ga0055531_10003646 | Ga0055531_100036465 | 248 |
| 100 | 3300005289 | Ga0065704_10006257 | Ga0065704_100062572 | 248 |
| 101 | 3300005327 | Ga0070658_10033853 | Ga0070658_100338534 | 248 |
| 102 | 3300005535 | Ga0070684_100180891 | Ga0070684_1001808911 | 248 |
| 103 | 3300005563 | Ga0068855_100449801 | Ga0068855_1004498012 | 248 |
| 104 | 3300005578 | Ga0068854_100066764 | Ga0068854_1000667642 | 248 |
| 105 | 3300005618 | Ga0068864_100002125 | Ga0068864_10000212519 | 248 |
| 106 | 3300005842 | Ga0068858_100000228 | Ga0068858_10000022823 | 248 |
| 107 | 3300005842 | Ga0068858_100001700 | Ga0068858_1000017002 | 248 |
| 108 | 3300006038 | Ga0075365_10178714 | Ga0075365_101787142 | 248 |
| 109 | 3300006042 | Ga0075368_10000055 | Ga0075368_100000556 | 248 |
| 110 | 3300006042 | Ga0075368_10000967 | Ga0075368_1000096712 | 248 |
| 111 | 3300006042 | Ga0075368_10032193 | Ga0075368_100321933 | 248 |
| 112 | 3300006048 | Ga0075363_100017846 | Ga0075363_1000178463 | 248 |
| 113 | 3300006048 | Ga0075363_100096373 | Ga0075363_1000963732 | 248 |
| 114 | 3300006051 | Ga0075364_10206394 | Ga0075364_102063941 | 248 |
| 115 | 3300006177 | Ga0075362_10002811 | Ga0075362_100028113 | 248 |
| 116 | 3300006177 | Ga0075362_10034881 | Ga0075362_100348815 | 248 |
| 117 | 3300006178 | Ga0075367_10000109 | Ga0075367_1000010911 | 248 |
| 118 | 3300006178 | Ga0075367_10006417 | Ga0075367_100064173 | 248 |
| 119 | 3300006178 | Ga0075367_10049680 | Ga0075367_100496804 | 248 |
| 120 | 3300006186 | Ga0075369_10095090 | Ga0075369_100950901 | 248 |
| 121 | 3300006186 | Ga0075369_10155901 | Ga0075369_101559011 | 248 |
| 122 | 3300006195 | Ga0075366_10037690 | Ga0075366_100376902 | 248 |
| 123 | 3300006195 | Ga0075366_10076800 | Ga0075366_100768001 | 248 |
| 124 | 3300006353 | Ga0075370_10000257 | Ga0075370_1000025714 | 248 |
| 125 | 3300006353 | Ga0075370_10050753 | Ga0075370_100507531 | 248 |
| 126 | 3300006353 | Ga0075370_10085395 | Ga0075370_100853951 | 248 |
| 127 | 3300006353 | Ga0075370_10125899 | Ga0075370_101258992 | 248 |
| 128 | 3300009098 | Ga0105245_10009485 | Ga0105245_100094856 | 248 |
| 129 | 3300009148 | Ga0105243_10056170 | Ga0105243_100561702 | 248 |
| 130 | 3300009148 | Ga0105243_10715950 | Ga0105243_107159501 | 248 |
| 131 | 3300009177 | Ga0105248_10010320 | Ga0105248_100103207 | 248 |
| 132 | 3300009177 | Ga0105248_10017254 | Ga0105248_100172544 | 248 |
| 133 | 3300009545 | Ga0105237_10010097 | Ga0105237_100100972 | 248 |
| 134 | 3300009978 | Ga0105148_100253 | Ga0105148_1002535 | 248 |
| 135 | 3300010375 | Ga0105239_10031481 | Ga0105239_100314814 | 248 |
| 136 | 3300013296 | Ga0157374_10103118 | Ga0157374_101031181 | 248 |
| 137 | 3300013297 | Ga0157378_10166335 | Ga0157378_101663352 | 248 |
| 138 | 3300013306 | Ga0163162_10001078 | Ga0163162_1000107821 | 248 |
| 139 | 3300013306 | Ga0163162_10446220 | Ga0163162_104462202 | 248 |
| 140 | 3300015690 | Ga0183363_1002 | Ga0183363_1002112 | 248 |
| 141 | 3300017792 | Ga0163161_10013007 | Ga0163161_100130071 | 248 |
| 142 | 3300025246 | Ga0209646_1021491 | Ga0209646_10214911 | 248 |
| 143 | 3300025261 | Ga0209233_1000142 | Ga0209233_100014264 | 248 |
| 144 | 3300025292 | Ga0209676_1026483 | Ga0209676_10264831 | 248 |
| 145 | 3300025304 | Ga0209257_1000517 | Ga0209257_10005173 | 248 |
| 146 | 3300025304 | Ga0209257_1002888 | Ga0209257_100288817 | 248 |
| 147 | 3300025315 | Ga0207697_10086321 | Ga0207697_100863212 | 248 |
| 148 | 3300025909 | Ga0207705_10369159 | Ga0207705_103691592 | 248 |
| 149 | 3300025913 | Ga0207695_10057479 | Ga0207695_100574792 | 248 |
| 150 | 3300025914 | Ga0207671_10002163 | Ga0207671_1000216313 | 248 |
| 151 | 3300025923 | Ga0207681_10047485 | Ga0207681_100474853 | 248 |
| 152 | 3300025925 | Ga0207650_10203060 | Ga0207650_102030602 | 248 |
| 153 | 3300025927 | Ga0207687_10006744 | Ga0207687_100067443 | 248 |
| 154 | 3300025932 | Ga0207690_10207593 | Ga0207690_102075932 | 248 |
| 155 | 3300025933 | Ga0207706_10019782 | Ga0207706_100197824 | 248 |
| 156 | 3300025941 | Ga0207711_10005221 | Ga0207711_100052214 | 248 |
| 157 | 3300025941 | Ga0207711_10056418 | Ga0207711_100564182 | 248 |
| 158 | 3300025949 | Ga0207667_10075657 | Ga0207667_100756572 | 248 |
| 159 | 3300025949 | Ga0207667_10697721 | Ga0207667_106977211 | 248 |
| 160 | 3300025981 | Ga0207640_10059222 | Ga0207640_100592222 | 248 |
| 161 | 3300026035 | Ga0207703_10000976 | Ga0207703_1000097623 | 248 |
| 162 | 3300026035 | Ga0207703_10004598 | Ga0207703_1000459812 | 248 |
| 163 | 3300026078 | Ga0207702_10003711 | Ga0207702_1000371115 | 248 |
| 164 | 3300026095 | Ga0207676_10000190 | Ga0207676_1000019014 | 248 |
| 165 | 3300026095 | Ga0207676_10348384 | Ga0207676_103483842 | 248 |
| 166 | 3300027866 | Ga0209813_10000048 | Ga0209813_1000004838 | 248 |
| 167 | 3300027866 | Ga0209813_10000220 | Ga0209813_1000022016 | 248 |
| 168 | 3300028379 | Ga0268266_10889770 | Ga0268266_108897701 | 248 |
| 169 | 3300031456 | Ga0307513_10256515 | Ga0307513_102565151 | 248 |
| 170 | 3300031616 | Ga0307508_10004238 | Ga0307508_100042386 | 248 |
| 171 | 3300033180 | Ga0307510_10191540 | Ga0307510_101915401 | 248 |
| 172 | 3300035171 | Ga0373946_0289600 | Ga0373946_0289600_22_768 | 248 |
| 173 | 3300037853 | Ga0436364_1389735 | Ga0436364_1389735_2339_3085 | 248 |
| 174 | 3300039437 | Ga0436365_1211005 | Ga0436365_1211005_106_855 | 248 |
| 175 | 3300041460 | Ga0451802_0044966 | Ga0451802_0044966_215_961 | 248 |
| 176 | 3300041463 | Ga0451804_0756293 | Ga0451804_0756293_378_1124 | 248 |
| 177 | 3300041486 | Ga0451807_2284404 | Ga0451807_2284404_55_801 | 248 |
| 178 | 3300041512 | Ga0451853_1879690 | Ga0451853_1879690_756_1502 | 248 |
| 179 | 3300044735 | Ga0466968_0054687 | Ga0466968_0054687_31_786 | 248 |
| 180 | 3300046460 | Ga0495638_0080909 | Ga0495638_0080909_1186_1932 | 248 |
| 181 | 3300046460 | Ga0495638_0144399 | Ga0495638_0144399_211_957 | 248 |
| 182 | 3300046491 | Ga0495584_0014651 | Ga0495584_0014651_1166_1912 | 248 |
| 183 | 3300046507 | Ga0495606_0044223 | Ga0495606_0044223_1824_2570 | 248 |
| 184 | 3300046512 | Ga0495610_0047804 | Ga0495610_0047804_95_841 | 248 |
| 185 | 3300046519 | Ga0495632_0000007 | Ga0495632_0000007_328182_328928 | 248 |
| 186 | 3300046520 | Ga0495637_0000569 | Ga0495637_0000569_24154_24900 | 248 |
| 187 | 3300046522 | Ga0495643_0000304 | Ga0495643_0000304_53695_54441 | 248 |
| 188 | 3300046524 | Ga0495648_0037584 | Ga0495648_0037584_1969_2715 | 248 |
| 189 | 3300046525 | Ga0495663_0000005 | Ga0495663_0000005_327201_327947 | 248 |
| 190 | 3300046530 | Ga0495654_0043751 | Ga0495654_0043751_273_1019 | 248 |
| 191 | 3300046557 | Ga0495622_0006810 | Ga0495622_0006810_672_1418 | 248 |
| 192 | 3300046558 | Ga0495633_0000491 | Ga0495633_0000491_32184_32930 | 248 |
| 193 | 3300046558 | Ga0495633_0001879 | Ga0495633_0001879_3935_4681 | 248 |
| 194 | 3300046616 | Ga0495668_0000001 | Ga0495668_0000001_949100_949846 | 248 |
| 195 | 3300046648 | Ga0495611_0256250 | Ga0495611_0256250_33_779 | 248 |
| 196 | 3300046660 | Ga0495625_0057335 | Ga0495625_0057335_994_1740 | 248 |
| 197 | 3300046660 | Ga0495625_0063243 | Ga0495625_0063243_1834_2580 | 248 |
| 198 | 3300046691 | Ga0495670_0243820 | Ga0495670_0243820_38_784 | 248 |
| 199 | 3300046692 | Ga0495671_0000126 | Ga0495671_0000126_14043_14789 | 248 |
| 200 | 3300047445 | Ga0495677_0034004 | Ga0495677_0034004_1039_1785 | 248 |
| 201 | 3300047470 | Ga0495681_0002422 | Ga0495681_0002422_5145_5891 | 248 |
| 202 | 3300047472 | Ga0495686_0000063 | Ga0495686_0000063_161648_162394 | 248 |
| 203 | 3300047472 | Ga0495686_0000661 | Ga0495686_0000661_3803_4549 | 248 |
| 204 | 3300047472 | Ga0495686_0009632 | Ga0495686_0009632_1133_1879 | 248 |
| 205 | 3300047472 | Ga0495686_0020603 | Ga0495686_0020603_2403_3149 | 248 |
| 206 | 3300047472 | Ga0495686_0082333 | Ga0495686_0082333_526_1272 | 248 |
| 207 | 3300047472 | Ga0495686_0104101 | Ga0495686_0104101_360_1106 | 248 |
| 208 | 3300048916 | Ga0496113_0092142 | Ga0496113_0092142_1251_1997 | 248 |
| 209 | 3300048920 | Ga0496117_0043351 | Ga0496117_0043351_1456_2205 | 248 |
| 210 | 3300048920 | Ga0496117_0057221 | Ga0496117_0057221_225_971 | 248 |
| 211 | 3300048921 | Ga0496118_0015807 | Ga0496118_0015807_2322_3071 | 248 |
| 212 | 3300048923 | Ga0496120_0102515 | Ga0496120_0102515_46_792 | 248 |
| 213 | 3300048924 | Ga0496121_0003092 | Ga0496121_0003092_2577_3326 | 248 |
| 214 | 3300048927 | Ga0496124_0030523 | Ga0496124_0030523_72_818 | 248 |
| 215 | 3300048927 | Ga0496124_0235082 | Ga0496124_0235082_210_956 | 248 |
| 216 | 3300048927 | Ga0496124_0262178 | Ga0496124_0262178_364_1110 | 248 |
| 217 | 3300048928 | Ga0496125_0040553 | Ga0496125_0040553_2897_3643 | 248 |
| 218 | 3300049658 | Ga0501211_001344 | Ga0501211_001344_219_965 | 248 |
| 219 | 3300049663 | Ga0501223_000064 | Ga0501223_000064_11798_12544 | 248 |
| 220 | 3300049669 | Ga0501235_001360 | Ga0501235_001360_3143_3889 | 248 |
| 221 | 3300049705 | Ga0501225_0000063 | Ga0501225_0000063_28805_29551 | 248 |
| 222 | 3300049708 | Ga0501245_005207 | Ga0501245_005207_91_837 | 248 |
| 223 | 3300049823 | Ga0501044_0256729 | Ga0501044_0256729_883_1629 | 248 |
| 224 | 3300050489 | nmdc:mga03683_10661_c1 | nmdc:mga03683_10661_c1_243_989 | 248 |
| 225 | 3300050489 | nmdc:mga03683_16551_c1 | nmdc:mga03683_16551_c1_401_1147 | 248 |
| 226 | 3300050489 | nmdc:mga03683_927_c1 | nmdc:mga03683_927_c1_735_1481 | 248 |
| 227 | 3300050490 | nmdc:mga03n38_30348_c1 | nmdc:mga03n38_30348_c1_353_1099 | 248 |
| 228 | 3300050490 | nmdc:mga03n38_82620_c1 | nmdc:mga03n38_82620_c1_264_1010 | 248 |
| 229 | 3300050491 | nmdc:mga00v17_11965_c1 | nmdc:mga00v17_11965_c1_278_1024 | 248 |
| 230 | 3300050491 | nmdc:mga00v17_1563_c1 | nmdc:mga00v17_1563_c1_5920_6666 | 248 |
| 231 | 3300050491 | nmdc:mga00v17_3583_c1 | nmdc:mga00v17_3583_c1_735_1481 | 248 |
| 232 | 3300050492 | nmdc:mga0yw44_158276_c1 | nmdc:mga0yw44_158276_c1_27_773 | 248 |
| 233 | 3300050492 | nmdc:mga0yw44_330966_c1 | nmdc:mga0yw44_330966_c1_252_998 | 248 |
| 234 | 3300050493 | nmdc:mga0k408_3784_c1 | nmdc:mga0k408_3784_c1_6559_7305 | 248 |
| 235 | 3300050493 | nmdc:mga0k408_39900_c2 | nmdc:mga0k408_39900_c2_41_787 | 248 |
| 236 | 3300050494 | nmdc:mga06z11_117_c1 | nmdc:mga06z11_117_c1_735_1481 | 248 |
| 237 | 3300050494 | nmdc:mga06z11_295_c1 | nmdc:mga06z11_295_c1_443_1189 | 248 |
| 238 | 3300050495 | nmdc:mga04h51_162_c1 | nmdc:mga04h51_162_c1_445_1191 | 248 |
| 239 | 3300050495 | nmdc:mga04h51_178_c1 | nmdc:mga04h51_178_c1_7201_7947 | 248 |
| 240 | 3300050495 | nmdc:mga04h51_29230_c1 | nmdc:mga04h51_29230_c1_640_1386 | 248 |
| 241 | 3300050495 | nmdc:mga04h51_656_c1 | nmdc:mga04h51_656_c1_735_1481 | 248 |
| 242 | 3300050496 | nmdc:mga07m45_21157_c1 | nmdc:mga07m45_21157_c1_2462_3208 | 248 |
| 243 | 3300050496 | nmdc:mga07m45_22_c1 | nmdc:mga07m45_22_c1_735_1481 | 248 |
| 244 | 3300050496 | nmdc:mga07m45_70616_c1 | nmdc:mga07m45_70616_c1_360_1106 | 248 |
| 245 | 3300050496 | nmdc:mga07m45_9859_c1 | nmdc:mga07m45_9859_c1_3859_4605 | 248 |
| 246 | 3300050516 | nmdc:mga0sz30_144328_c1 | nmdc:mga0sz30_144328_c1_280_1026 | 248 |
| 247 | 3300050516 | nmdc:mga0sz30_48389_c1 | nmdc:mga0sz30_48389_c1_27_773 | 248 |
| 248 | 3300050516 | nmdc:mga0sz30_714_c2 | nmdc:mga0sz30_714_c2_1593_2339 | 248 |
| 249 | 3300053087 | Ga0500643_000385 | Ga0500643_000385_18592_19338 | 248 |
| 250 | 3300053087 | Ga0500643_002094 | Ga0500643_002094_6423_7169 | 248 |
| 251 | 3300053093 | Ga0500651_0345311 | Ga0500651_0345311_62_808 | 248 |
| 252 | 3300053096 | Ga0500641_0061888 | Ga0500641_0061888_119_865 | 248 |
| 253 | 3300053116 | Ga0500592_001641 | Ga0500592_001641_1530_2276 | 248 |
| 254 | 3300053118 | Ga0500594_0009144 | Ga0500594_0009144_1182_1928 | 248 |
| 255 | 3300053120 | Ga0500597_019103 | Ga0500597_019103_1435_2181 | 248 |
| 256 | 3300053121 | Ga0500607_000065 | Ga0500607_000065_52291_53037 | 248 |
| 257 | 3300053121 | Ga0500607_000386 | Ga0500607_000386_40348_41094 | 248 |
| 258 | 3300053125 | Ga0500618_031599 | Ga0500618_031599_325_1071 | 248 |
| 259 | 3300053130 | Ga0500642_0000574 | Ga0500642_0000574_9448_10194 | 248 |
| 260 | 3300053136 | Ga0500559_0000668 | Ga0500559_0000668_6355_7101 | 248 |
| 261 | 3300053136 | Ga0500559_0012091 | Ga0500559_0012091_588_1334 | 248 |
| 262 | 3300053136 | Ga0500559_0013370 | Ga0500559_0013370_2230_2976 | 248 |
| 263 | 3300053139 | Ga0500568_0026023 | Ga0500568_0026023_927_1673 | 248 |
| 264 | 3300053142 | Ga0500577_0012472 | Ga0500577_0012472_138_884 | 248 |
| 265 | 3300053142 | Ga0500577_0120786 | Ga0500577_0120786_14_760 | 248 |
| 266 | 3300053142 | Ga0500577_0132164 | Ga0500577_0132164_99_845 | 248 |
| 267 | 3300053153 | Ga0500616_0010849 | Ga0500616_0010849_2961_3707 | 248 |
| 268 | 3300053153 | Ga0500616_0041068 | Ga0500616_0041068_668_1414 | 248 |
| 269 | 3300053153 | Ga0500616_0129036 | Ga0500616_0129036_406_1152 | 248 |
| 270 | 3300053153 | Ga0500616_0152766 | Ga0500616_0152766_145_891 | 248 |
| 271 | 3300053156 | Ga0500622_0002328 | Ga0500622_0002328_11631_12377 | 248 |
| 272 | 3300053157 | Ga0500624_000012 | Ga0500624_000012_52867_53613 | 248 |
| 273 | 3300053157 | Ga0500624_000020 | Ga0500624_000020_36101_36847 | 248 |
| 274 | 3300053158 | Ga0500627_0000013 | Ga0500627_0000013_86957_87703 | 248 |
| 275 | 3300053178 | Ga0500637_0000022 | Ga0500637_0000022_36076_36822 | 248 |
| 276 | 3300053178 | Ga0500637_0006428 | Ga0500637_0006428_606_1352 | 248 |
| 277 | 3300053730 | Ga0500645_020731 | Ga0500645_020731_771_1517 | 248 |
| 278 | 3300053730 | Ga0500645_037940 | Ga0500645_037940_471_1217 | 248 |
| 279 | 3300055283 | Ga0500661_004899 | Ga0500661_004899_411_1157 | 248 |
| 280 | 3300001904 | JGI24736J21556_1008730 | JGI24736J21556_10087302 | 249 |
| 281 | 3300001915 | JGI24741J21665_1007135 | JGI24741J21665_10071353 | 249 |
| 282 | 3300001979 | JGI24740J21852_10042393 | JGI24740J21852_100423932 | 249 |
| 283 | 3300001989 | JGI24739J22299_10000601 | JGI24739J22299_1000060110 | 249 |
| 284 | 3300001989 | JGI24739J22299_10002449 | JGI24739J22299_100024495 | 249 |
| 285 | 3300001989 | JGI24739J22299_10004424 | JGI24739J22299_100044244 | 249 |
| 286 | 3300001990 | JGI24737J22298_10000720 | JGI24737J22298_100007205 | 249 |
| 287 | 3300001990 | JGI24737J22298_10071114 | JGI24737J22298_100711142 | 249 |
| 288 | 3300002067 | JGI24735J21928_10001166 | JGI24735J21928_100011665 | 249 |
| 289 | 3300002067 | JGI24735J21928_10008108 | JGI24735J21928_100081083 | 249 |
| 290 | 3300002067 | JGI24735J21928_10027700 | JGI24735J21928_100277002 | 249 |
| 291 | 3300002067 | JGI24735J21928_10034178 | JGI24735J21928_100341782 | 249 |
| 292 | 3300002075 | JGI24738J21930_10000440 | JGI24738J21930_100004405 | 249 |
| 293 | 3300002075 | JGI24738J21930_10010342 | JGI24738J21930_100103421 | 249 |
| 294 | 3300002077 | JGI24744J21845_10004368 | JGI24744J21845_100043683 | 249 |
| 295 | 3300002741 | JGI25157J39369_1018117 | JGI25157J39369_10181171 | 249 |
| 296 | 3300003214 | JGI25165J46597_1000188 | JGI25165J46597_100018840 | 249 |
| 297 | 3300003322 | rootL2_10165951 | rootL2_101659512 | 249 |
| 298 | 3300003762 | Ga0055542_1004389 | Ga0055542_10043893 | 249 |
| 299 | 3300005295 | Ga0065707_10101327 | Ga0065707_101013273 | 249 |
| 300 | 3300005327 | Ga0070658_10041598 | Ga0070658_100415983 | 249 |
| 301 | 3300005327 | Ga0070658_10358454 | Ga0070658_103584542 | 249 |
| 302 | 3300005327 | Ga0070658_10528373 | Ga0070658_105283731 | 249 |
| 303 | 3300005328 | Ga0070676_10002175 | Ga0070676_100021756 | 249 |
| 304 | 3300005334 | Ga0068869_100000848 | Ga0068869_1000008486 | 249 |
| 305 | 3300005335 | Ga0070666_10040596 | Ga0070666_100405962 | 249 |
| 306 | 3300005338 | Ga0068868_100000154 | Ga0068868_10000015423 | 249 |
| 307 | 3300005338 | Ga0068868_100147581 | Ga0068868_1001475812 | 249 |
| 308 | 3300005339 | Ga0070660_100000544 | Ga0070660_1000005443 | 249 |
| 309 | 3300005339 | Ga0070660_100174061 | Ga0070660_1001740611 | 249 |
| 310 | 3300005339 | Ga0070660_100211179 | Ga0070660_1002111791 | 249 |
| 311 | 3300005339 | Ga0070660_100409501 | Ga0070660_1004095011 | 249 |
| 312 | 3300005339 | Ga0070660_100438185 | Ga0070660_1004381852 | 249 |
| 313 | 3300005344 | Ga0070661_100092363 | Ga0070661_1000923632 | 249 |
| 314 | 3300005347 | Ga0070668_100615823 | Ga0070668_1006158231 | 249 |
| 315 | 3300005364 | Ga0070673_100000023 | Ga0070673_10000002385 | 249 |
| 316 | 3300005366 | Ga0070659_100059344 | Ga0070659_1000593444 | 249 |
| 317 | 3300005366 | Ga0070659_100059457 | Ga0070659_1000594571 | 249 |
| 318 | 3300005366 | Ga0070659_100066008 | Ga0070659_1000660082 | 249 |
| 319 | 3300005366 | Ga0070659_100075161 | Ga0070659_1000751612 | 249 |
| 320 | 3300005366 | Ga0070659_100663842 | Ga0070659_1006638421 | 249 |
| 321 | 3300005455 | Ga0070663_100001998 | Ga0070663_1000019987 | 249 |
| 322 | 3300005456 | Ga0070678_100054021 | Ga0070678_1000540213 | 249 |
| 323 | 3300005457 | Ga0070662_100002062 | Ga0070662_1000020629 | 249 |
| 324 | 3300005457 | Ga0070662_100081846 | Ga0070662_1000818462 | 249 |
| 325 | 3300005457 | Ga0070662_100131072 | Ga0070662_1001310722 | 249 |
| 326 | 3300005458 | Ga0070681_10094688 | Ga0070681_100946881 | 249 |
| 327 | 3300005459 | Ga0068867_100000007 | Ga0068867_10000000721 | 249 |
| 328 | 3300005539 | Ga0068853_100023296 | Ga0068853_1000232964 | 249 |
| 329 | 3300005539 | Ga0068853_100025947 | Ga0068853_1000259472 | 249 |
| 330 | 3300005539 | Ga0068853_100069304 | Ga0068853_1000693041 | 249 |
| 331 | 3300005543 | Ga0070672_100042427 | Ga0070672_1000424273 | 249 |
| 332 | 3300005547 | Ga0070693_100281806 | Ga0070693_1002818062 | 249 |
| 333 | 3300005563 | Ga0068855_100000029 | Ga0068855_10000002940 | 249 |
| 334 | 3300005563 | Ga0068855_100001148 | Ga0068855_10000114815 | 249 |
| 335 | 3300005563 | Ga0068855_100191725 | Ga0068855_1001917253 | 249 |
| 336 | 3300005564 | Ga0070664_100424026 | Ga0070664_1004240262 | 249 |
| 337 | 3300005577 | Ga0068857_100055573 | Ga0068857_1000555732 | 249 |
| 338 | 3300005578 | Ga0068854_100000027 | Ga0068854_1000000276 | 249 |
| 339 | 3300005578 | Ga0068854_100154085 | Ga0068854_1001540852 | 249 |
| 340 | 3300005614 | Ga0068856_100004098 | Ga0068856_1000040986 | 249 |
| 341 | 3300005616 | Ga0068852_100004278 | Ga0068852_1000042784 | 249 |
| 342 | 3300005616 | Ga0068852_100006260 | Ga0068852_1000062605 | 249 |
| 343 | 3300005616 | Ga0068852_100129866 | Ga0068852_1001298662 | 249 |
| 344 | 3300005616 | Ga0068852_100182937 | Ga0068852_1001829372 | 249 |
| 345 | 3300005718 | Ga0068866_10012667 | Ga0068866_100126674 | 249 |
| 346 | 3300006042 | Ga0075368_10000168 | Ga0075368_1000016816 | 249 |
| 347 | 3300006048 | Ga0075363_100006130 | Ga0075363_1000061302 | 249 |
| 348 | 3300006178 | Ga0075367_10000289 | Ga0075367_1000028916 | 249 |
| 349 | 3300006195 | Ga0075366_10143533 | Ga0075366_101435332 | 249 |
| 350 | 3300006237 | Ga0097621_100002061 | Ga0097621_1000020615 | 249 |
| 351 | 3300006353 | Ga0075370_10026515 | Ga0075370_100265151 | 249 |
| 352 | 3300006358 | Ga0068871_100002074 | Ga0068871_1000020745 | 249 |
| 353 | 3300006881 | Ga0068865_100000010 | Ga0068865_100000010159 | 249 |
| 354 | 3300009093 | Ga0105240_10017476 | Ga0105240_100174764 | 249 |
| 355 | 3300009093 | Ga0105240_10070818 | Ga0105240_100708182 | 249 |
| 356 | 3300009093 | Ga0105240_10304868 | Ga0105240_103048681 | 249 |
| 357 | 3300009098 | Ga0105245_10002089 | Ga0105245_100020893 | 249 |
| 358 | 3300009148 | Ga0105243_10000950 | Ga0105243_1000095021 | 249 |
| 359 | 3300009148 | Ga0105243_10294328 | Ga0105243_102943282 | 249 |
| 360 | 3300009174 | Ga0105241_10045550 | Ga0105241_100455502 | 249 |
| 361 | 3300009174 | Ga0105241_10415116 | Ga0105241_104151162 | 249 |
| 362 | 3300009176 | Ga0105242_10000210 | Ga0105242_1000021021 | 249 |
| 363 | 3300009545 | Ga0105237_10051294 | Ga0105237_100512944 | 249 |
| 364 | 3300009545 | Ga0105237_10458234 | Ga0105237_104582342 | 249 |
| 365 | 3300009551 | Ga0105238_10027777 | Ga0105238_100277773 | 249 |
| 366 | 3300009551 | Ga0105238_10226524 | Ga0105238_102265243 | 249 |
| 367 | 3300009551 | Ga0105238_10473056 | Ga0105238_104730562 | 249 |
| 368 | 3300009553 | Ga0105249_10017303 | Ga0105249_100173032 | 249 |
| 369 | 3300010375 | Ga0105239_10004123 | Ga0105239_100041238 | 249 |
| 370 | 3300010375 | Ga0105239_10046782 | Ga0105239_100467825 | 249 |
| 371 | 3300011119 | Ga0105246_10000472 | Ga0105246_1000047217 | 249 |
| 372 | 3300013100 | Ga0157373_10047916 | Ga0157373_100479164 | 249 |
| 373 | 3300013100 | Ga0157373_10084627 | Ga0157373_100846272 | 249 |
| 374 | 3300013100 | Ga0157373_10264350 | Ga0157373_102643502 | 249 |
| 375 | 3300013102 | Ga0157371_10211638 | Ga0157371_102116382 | 249 |
| 376 | 3300013104 | Ga0157370_10000203 | Ga0157370_1000020360 | 249 |
| 377 | 3300013104 | Ga0157370_10074058 | Ga0157370_100740583 | 249 |
| 378 | 3300013105 | Ga0157369_10057364 | Ga0157369_100573643 | 249 |
| 379 | 3300013105 | Ga0157369_10511326 | Ga0157369_105113262 | 249 |
| 380 | 3300013296 | Ga0157374_10000830 | Ga0157374_1000083021 | 249 |
| 381 | 3300013296 | Ga0157374_10045139 | Ga0157374_100451394 | 249 |
| 382 | 3300013297 | Ga0157378_10001477 | Ga0157378_1000147714 | 249 |
| 383 | 3300013297 | Ga0157378_10084028 | Ga0157378_100840283 | 249 |
| 384 | 3300013307 | Ga0157372_10010036 | Ga0157372_100100366 | 249 |
| 385 | 3300013307 | Ga0157372_10058023 | Ga0157372_100580235 | 249 |
| 386 | 3300013307 | Ga0157372_10179976 | Ga0157372_101799762 | 249 |
| 387 | 3300013307 | Ga0157372_10339814 | Ga0157372_103398142 | 249 |
| 388 | 3300013308 | Ga0157375_10002120 | Ga0157375_1000212010 | 249 |
| 389 | 3300014969 | Ga0157376_10000047 | Ga0157376_1000004721 | 249 |
| 390 | 3300025231 | Ga0207427_101974 | Ga0207427_1019745 | 249 |
| 391 | 3300025250 | Ga0209026_1002441 | Ga0209026_10024415 | 249 |
| 392 | 3300025254 | Ga0209148_1000061 | Ga0209148_1000061278 | 249 |
| 393 | 3300025254 | Ga0209148_1001013 | Ga0209148_10010135 | 249 |
| 394 | 3300025261 | Ga0209233_1000120 | Ga0209233_1000120181 | 249 |
| 395 | 3300025272 | Ga0209455_1000692 | Ga0209455_100069213 | 249 |
| 396 | 3300025321 | Ga0207656_10059287 | Ga0207656_100592872 | 249 |
| 397 | 3300025899 | Ga0207642_10007810 | Ga0207642_100078104 | 249 |
| 398 | 3300025901 | Ga0207688_10080907 | Ga0207688_100809073 | 249 |
| 399 | 3300025903 | Ga0207680_10022733 | Ga0207680_100227333 | 249 |
| 400 | 3300025904 | Ga0207647_10000270 | Ga0207647_1000027010 | 249 |
| 401 | 3300025904 | Ga0207647_10016335 | Ga0207647_100163352 | 249 |
| 402 | 3300025904 | Ga0207647_10017291 | Ga0207647_100172913 | 249 |
| 403 | 3300025904 | Ga0207647_10051484 | Ga0207647_100514843 | 249 |
| 404 | 3300025904 | Ga0207647_10065747 | Ga0207647_100657472 | 249 |
| 405 | 3300025907 | Ga0207645_10029542 | Ga0207645_100295423 | 249 |
| 406 | 3300025909 | Ga0207705_10000316 | Ga0207705_100003169 | 249 |
| 407 | 3300025909 | Ga0207705_10000963 | Ga0207705_1000096311 | 249 |
| 408 | 3300025909 | Ga0207705_10009514 | Ga0207705_100095144 | 249 |
| 409 | 3300025909 | Ga0207705_10525168 | Ga0207705_105251681 | 249 |
| 410 | 3300025911 | Ga0207654_10342347 | Ga0207654_103423472 | 249 |
| 411 | 3300025913 | Ga0207695_10008358 | Ga0207695_100083584 | 249 |
| 412 | 3300025913 | Ga0207695_10041776 | Ga0207695_100417764 | 249 |
| 413 | 3300025914 | Ga0207671_10107147 | Ga0207671_101071472 | 249 |
| 414 | 3300025919 | Ga0207657_10003918 | Ga0207657_100039185 | 249 |
| 415 | 3300025919 | Ga0207657_10049263 | Ga0207657_100492633 | 249 |
| 416 | 3300025919 | Ga0207657_10057737 | Ga0207657_100577373 | 249 |
| 417 | 3300025920 | Ga0207649_10067641 | Ga0207649_100676413 | 249 |
| 418 | 3300025924 | Ga0207694_10217153 | Ga0207694_102171532 | 249 |
| 419 | 3300025927 | Ga0207687_10027727 | Ga0207687_100277273 | 249 |
| 420 | 3300025931 | Ga0207644_10224943 | Ga0207644_102249432 | 249 |
| 421 | 3300025932 | Ga0207690_10077238 | Ga0207690_100772382 | 249 |
| 422 | 3300025932 | Ga0207690_10123350 | Ga0207690_101233502 | 249 |
| 423 | 3300025932 | Ga0207690_10227985 | Ga0207690_102279852 | 249 |
| 424 | 3300025932 | Ga0207690_10430273 | Ga0207690_104302732 | 249 |
| 425 | 3300025933 | Ga0207706_10004159 | Ga0207706_100041596 | 249 |
| 426 | 3300025933 | Ga0207706_10103379 | Ga0207706_101033792 | 249 |
| 427 | 3300025935 | Ga0207709_10000050 | Ga0207709_10000050230 | 249 |
| 428 | 3300025938 | Ga0207704_10000020 | Ga0207704_10000020140 | 249 |
| 429 | 3300025942 | Ga0207689_10001541 | Ga0207689_100015417 | 249 |
| 430 | 3300025949 | Ga0207667_10000035 | Ga0207667_10000035183 | 249 |
| 431 | 3300025949 | Ga0207667_10004932 | Ga0207667_100049327 | 249 |
| 432 | 3300025949 | Ga0207667_10131103 | Ga0207667_101311033 | 249 |
| 433 | 3300025960 | Ga0207651_10000005 | Ga0207651_1000000521 | 249 |
| 434 | 3300025961 | Ga0207712_10097162 | Ga0207712_100971623 | 249 |
| 435 | 3300025981 | Ga0207640_10000145 | Ga0207640_1000014536 | 249 |
| 436 | 3300025981 | Ga0207640_10056590 | Ga0207640_100565902 | 249 |
| 437 | 3300025981 | Ga0207640_10332653 | Ga0207640_103326532 | 249 |
| 438 | 3300026023 | Ga0207677_10000373 | Ga0207677_100003737 | 249 |
| 439 | 3300026041 | Ga0207639_10002511 | Ga0207639_100025116 | 249 |
| 440 | 3300026041 | Ga0207639_10007809 | Ga0207639_100078095 | 249 |
| 441 | 3300026041 | Ga0207639_10332655 | Ga0207639_103326552 | 249 |
| 442 | 3300026067 | Ga0207678_10005889 | Ga0207678_100058897 | 249 |
| 443 | 3300026067 | Ga0207678_10249930 | Ga0207678_102499302 | 249 |
| 444 | 3300026067 | Ga0207678_10320657 | Ga0207678_103206572 | 249 |
| 445 | 3300026078 | Ga0207702_10012620 | Ga0207702_100126203 | 249 |
| 446 | 3300026078 | Ga0207702_10037699 | Ga0207702_100376993 | 249 |
| 447 | 3300026078 | Ga0207702_10245821 | Ga0207702_102458212 | 249 |
| 448 | 3300026089 | Ga0207648_10000017 | Ga0207648_10000017140 | 249 |
| 449 | 3300026116 | Ga0207674_10015748 | Ga0207674_100157485 | 249 |
| 450 | 3300026116 | Ga0207674_10022819 | Ga0207674_100228193 | 249 |
| 451 | 3300026116 | Ga0207674_10776312 | Ga0207674_107763121 | 249 |
| 452 | 3300026121 | Ga0207683_10029414 | Ga0207683_100294142 | 249 |
| 453 | 3300026142 | Ga0207698_10000712 | Ga0207698_100007125 | 249 |
| 454 | 3300026142 | Ga0207698_10036634 | Ga0207698_100366343 | 249 |
| 455 | 3300026142 | Ga0207698_10038607 | Ga0207698_100386075 | 249 |
| 456 | 3300026142 | Ga0207698_10713009 | Ga0207698_107130092 | 249 |
| 457 | 3300027866 | Ga0209813_10000191 | Ga0209813_100001912 | 249 |
| 458 | 3300028786 | Ga0307517_10026027 | Ga0307517_100260276 | 249 |
| 459 | 3300037312 | Ga0395899_0002116 | Ga0395899_0002116_9319_10068 | 249 |
| 460 | 3300037312 | Ga0395899_0317704 | Ga0395899_0317704_126_875 | 249 |
| 461 | 3300037418 | Ga0395900_0260720 | Ga0395900_0260720_142_891 | 249 |
| 462 | 3300037471 | Ga0395905_0497526 | Ga0395905_0497526_40_789 | 249 |
| 463 | 3300038443 | Ga0395901_0245370 | Ga0395901_0245370_120_869 | 249 |
| 464 | 3300039450 | Ga0436363_0389907 | Ga0436363_0389907_798_1550 | 249 |
| 465 | 3300041462 | Ga0451806_660356 | Ga0451806_660356_2859_3608 | 249 |
| 466 | 3300042005 | Ga0439448_0002573 | Ga0439448_0002573_431_1180 | 249 |
| 467 | 3300042005 | Ga0439448_0003494 | Ga0439448_0003494_1417_2166 | 249 |
| 468 | 3300042005 | Ga0439448_0027604 | Ga0439448_0027604_544_1293 | 249 |
| 469 | 3300042005 | Ga0439448_0038338 | Ga0439448_0038338_561_1310 | 249 |
| 470 | 3300042012 | Ga0439455_0000252 | Ga0439455_0000252_2338_3087 | 249 |
| 471 | 3300042012 | Ga0439455_0000304 | Ga0439455_0000304_1673_2422 | 249 |
| 472 | 3300042012 | Ga0439455_0054729 | Ga0439455_0054729_259_1008 | 249 |
| 473 | 3300042157 | Ga0439458_0000255 | Ga0439458_0000255_6705_7454 | 249 |
| 474 | 3300042157 | Ga0439458_0000305 | Ga0439458_0000305_8211_8960 | 249 |
| 475 | 3300042157 | Ga0439458_0026115 | Ga0439458_0026115_198_947 | 249 |
| 476 | 3300044658 | Ga0466972_0274254 | Ga0466972_0274254_26_775 | 249 |
| 477 | 3300044684 | Ga0466966_0019647 | Ga0466966_0019647_382_1131 | 249 |
| 478 | 3300044694 | Ga0466963_0008961 | Ga0466963_0008961_1585_2334 | 249 |
| 479 | 3300044706 | Ga0466964_0012394 | Ga0466964_0012394_375_1124 | 249 |
| 480 | 3300044706 | Ga0466964_0018224 | Ga0466964_0018224_1439_2188 | 249 |
| 481 | 3300044719 | Ga0466971_0000834 | Ga0466971_0000834_5714_6463 | 249 |
| 482 | 3300044765 | Ga0466970_0012023 | Ga0466970_0012023_295_1044 | 249 |
| 483 | 3300044842 | Ga0466957_0274396 | Ga0466957_0274396_38_787 | 249 |
| 484 | 3300044901 | Ga0466960_0014885 | Ga0466960_0014885_340_1089 | 249 |
| 485 | 3300046453 | Ga0495627_000582 | Ga0495627_000582_13070_13819 | 249 |
| 486 | 3300046460 | Ga0495638_0156654 | Ga0495638_0156654_140_889 | 249 |
| 487 | 3300046471 | Ga0495650_0001090 | Ga0495650_0001090_14270_15019 | 249 |
| 488 | 3300046471 | Ga0495650_0049328 | Ga0495650_0049328_68_817 | 249 |
| 489 | 3300046474 | Ga0495605_0069453 | Ga0495605_0069453_25_774 | 249 |
| 490 | 3300046500 | Ga0495596_0000196 | Ga0495596_0000196_16142_16891 | 249 |
| 491 | 3300046506 | Ga0495583_0000030 | Ga0495583_0000030_42578_43327 | 249 |
| 492 | 3300046512 | Ga0495610_0000081 | Ga0495610_0000081_111556_112305 | 249 |
| 493 | 3300046512 | Ga0495610_0001175 | Ga0495610_0001175_5300_6049 | 249 |
| 494 | 3300046515 | Ga0495620_0013539 | Ga0495620_0013539_31_780 | 249 |
| 495 | 3300046519 | Ga0495632_0000306 | Ga0495632_0000306_28935_29684 | 249 |
| 496 | 3300046519 | Ga0495632_0027007 | Ga0495632_0027007_180_929 | 249 |
| 497 | 3300046522 | Ga0495643_0000042 | Ga0495643_0000042_165471_166220 | 249 |
| 498 | 3300046522 | Ga0495643_0007419 | Ga0495643_0007419_227_976 | 249 |
| 499 | 3300046530 | Ga0495654_0034814 | Ga0495654_0034814_767_1516 | 249 |
| 500 | 3300046538 | Ga0495609_0007089 | Ga0495609_0007089_295_1044 | 249 |
| 501 | 3300046648 | Ga0495611_0098653 | Ga0495611_0098653_543_1292 | 249 |
| 502 | 3300046660 | Ga0495625_0002401 | Ga0495625_0002401_8241_8990 | 249 |
| 503 | 3300046660 | Ga0495625_0085854 | Ga0495625_0085854_1103_1852 | 249 |
| 504 | 3300046665 | Ga0495661_0033156 | Ga0495661_0033156_2407_3156 | 249 |
| 505 | 3300046691 | Ga0495670_0013380 | Ga0495670_0013380_2544_3293 | 249 |
| 506 | 3300046692 | Ga0495671_0042256 | Ga0495671_0042256_1471_2220 | 249 |
| 507 | 3300046692 | Ga0495671_0115065 | Ga0495671_0115065_483_1232 | 249 |
| 508 | 3300046692 | Ga0495671_0123561 | Ga0495671_0123561_46_795 | 249 |
| 509 | 3300047470 | Ga0495681_0000517 | Ga0495681_0000517_14663_15412 | 249 |
| 510 | 3300047472 | Ga0495686_0000401 | Ga0495686_0000401_1148_1897 | 249 |
| 511 | 3300048914 | Ga0496111_0033642 | Ga0496111_0033642_205_954 | 249 |
| 512 | 3300048918 | Ga0496115_0000285 | Ga0496115_0000285_1427_2185 | 249 |
| 513 | 3300048920 | Ga0496117_0011402 | Ga0496117_0011402_6626_7375 | 249 |
| 514 | 3300048921 | Ga0496118_0030413 | Ga0496118_0030413_2680_3429 | 249 |
| 515 | 3300048922 | Ga0496119_0033280 | Ga0496119_0033280_2313_3062 | 249 |
| 516 | 3300048924 | Ga0496121_0003231 | Ga0496121_0003231_1807_2556 | 249 |
| 517 | 3300048925 | Ga0496122_0005685 | Ga0496122_0005685_12061_12810 | 249 |
| 518 | 3300048926 | Ga0496123_0002459 | Ga0496123_0002459_8051_8800 | 249 |
| 519 | 3300048926 | Ga0496123_0003542 | Ga0496123_0003542_3445_4194 | 249 |
| 520 | 3300048927 | Ga0496124_0015727 | Ga0496124_0015727_5372_6121 | 249 |
| 521 | 3300048927 | Ga0496124_0046585 | Ga0496124_0046585_2899_3648 | 249 |
| 522 | 3300048928 | Ga0496125_0012910 | Ga0496125_0012910_2354_3103 | 249 |
| 523 | 3300048929 | Ga0496126_0112148 | Ga0496126_0112148_1547_2296 | 249 |
| 524 | 3300049460 | Ga0495682_0125592 | Ga0495682_0125592_51_800 | 249 |
| 525 | 3300049581 | Ga0501047_0001117 | Ga0501047_0001117_9128_9877 | 249 |
| 526 | 3300049589 | Ga0501073_0212203 | Ga0501073_0212203_493_1242 | 249 |
| 527 | 3300050493 | nmdc:mga0k408_149619_c1 | nmdc:mga0k408_149619_c1_570_1319 | 249 |
| 528 | 3300050496 | nmdc:mga07m45_40998_c1 | nmdc:mga07m45_40998_c1_614_1363 | 249 |
| 529 | 3300053103 | Ga0500555_000163 | Ga0500555_000163_1485_2234 | 249 |
| 530 | 3300053136 | Ga0500559_0059748 | Ga0500559_0059748_69_818 | 249 |
| 531 | 3300053153 | Ga0500616_0035196 | Ga0500616_0035196_547_1296 | 249 |
| 532 | 3300053156 | Ga0500622_0132477 | Ga0500622_0132477_127_876 | 249 |
| 533 | 3300053157 | Ga0500624_000061 | Ga0500624_000061_4256_5005 | 249 |
| 534 | 3300053177 | Ga0500636_0001685 | Ga0500636_0001685_4195_4944 | 249 |
| 535 | 3300061719 | Ga0466962_0011448 | Ga0466962_0011448_472_1221 | 249 |
| 536 | 3300002774 | JGI25150J39212_1000020 | JGI25150J39212_100002077 | 250 |
| 537 | 3300003215 | JGI25153J46596_10000017 | JGI25153J46596_10000017139 | 250 |
| 538 | 3300003791 | Ga0055530_10005655 | Ga0055530_100056558 | 250 |
| 539 | 3300003791 | Ga0055530_10044614 | Ga0055530_100446141 | 250 |
| 540 | 3300003794 | Ga0055531_10045466 | Ga0055531_100454662 | 250 |
| 541 | 3300005262 | Ga0065165_1004847 | Ga0065165_10048478 | 250 |
| 542 | 3300005289 | Ga0065704_10111589 | Ga0065704_101115892 | 250 |
| 543 | 3300005548 | Ga0070665_100004652 | Ga0070665_1000046524 | 250 |
| 544 | 3300005578 | Ga0068854_100218332 | Ga0068854_1002183322 | 250 |
| 545 | 3300005616 | Ga0068852_100025178 | Ga0068852_1000251782 | 250 |
| 546 | 3300013296 | Ga0157374_10071508 | Ga0157374_100715082 | 250 |
| 547 | 3300025250 | Ga0209026_1004353 | Ga0209026_10043533 | 250 |
| 548 | 3300025298 | Ga0209050_1000127 | Ga0209050_100012744 | 250 |
| 549 | 3300025914 | Ga0207671_10098859 | Ga0207671_100988592 | 250 |
| 550 | 3300025944 | Ga0207661_10055536 | Ga0207661_100555363 | 250 |
| 551 | 3300025972 | Ga0207668_10273471 | Ga0207668_102734711 | 250 |
| 552 | 3300026116 | Ga0207674_10892142 | Ga0207674_108921421 | 250 |
| 553 | 3300026142 | Ga0207698_10036776 | Ga0207698_100367762 | 250 |
| 554 | 3300046500 | Ga0495596_0000537 | Ga0495596_0000537_19408_20160 | 250 |
| 555 | 3300046507 | Ga0495606_0116794 | Ga0495606_0116794_85_837 | 250 |
| 556 | 3300046512 | Ga0495610_0003890 | Ga0495610_0003890_996_1748 | 250 |
| 557 | 3300047470 | Ga0495681_0041330 | Ga0495681_0041330_41_799 | 250 |
| 558 | 3300048090 | Ga0495615_0000020 | Ga0495615_0000020_43506_44258 | 250 |
| 559 | 3300048091 | Ga0495626_0000298 | Ga0495626_0000298_4989_5741 | 250 |
| 560 | 3300048905 | Ga0496102_0586199 | Ga0496102_0586199_154_915 | 250 |
| 561 | 3300048919 | Ga0496116_0000035 | Ga0496116_0000035_352308_353060 | 250 |
| 562 | 3300048920 | Ga0496117_0047825 | Ga0496117_0047825_849_1601 | 250 |
| 563 | 3300048920 | Ga0496117_0119468 | Ga0496117_0119468_216_974 | 250 |
| 564 | 3300048921 | Ga0496118_0036903 | Ga0496118_0036903_1262_2014 | 250 |
| 565 | 3300048921 | Ga0496118_0139977 | Ga0496118_0139977_383_1141 | 250 |
| 566 | 3300048922 | Ga0496119_0052623 | Ga0496119_0052623_169_921 | 250 |
| 567 | 3300048924 | Ga0496121_0002960 | Ga0496121_0002960_23079_23837 | 250 |
| 568 | 3300048924 | Ga0496121_0002979 | Ga0496121_0002979_404_1162 | 250 |
| 569 | 3300048925 | Ga0496122_0026933 | Ga0496122_0026933_2176_2928 | 250 |
| 570 | 3300048926 | Ga0496123_0000159 | Ga0496123_0000159_82911_83663 | 250 |
| 571 | 3300048926 | Ga0496123_0003707 | Ga0496123_0003707_838_1590 | 250 |
| 572 | 3300048927 | Ga0496124_0002365 | Ga0496124_0002365_14060_14812 | 250 |
| 573 | 3300048927 | Ga0496124_0067837 | Ga0496124_0067837_1865_2617 | 250 |
| 574 | 3300048927 | Ga0496124_0155365 | Ga0496124_0155365_135_887 | 250 |
| 575 | 3300048928 | Ga0496125_0121127 | Ga0496125_0121127_621_1373 | 250 |
| 576 | 3300048929 | Ga0496126_0000077 | Ga0496126_0000077_134828_135580 | 250 |
| 577 | 3300048929 | Ga0496126_0014533 | Ga0496126_0014533_212_970 | 250 |
| 578 | 3300049579 | Ga0501043_0072900 | Ga0501043_0072900_371_1159 | 250 |
| 579 | 3300049823 | Ga0501044_0079519 | Ga0501044_0079519_1840_2628 | 250 |
| 580 | 3300009093 | Ga0105240_10013748 | Ga0105240_1001374812 | 251 |
| 581 | 3300010375 | Ga0105239_10000025 | Ga0105239_1000002555 | 251 |
| 582 | 3300047472 | Ga0495686_0000082 | Ga0495686_0000082_35659_36432 | 251 |
| 583 | 3300048921 | Ga0496118_0035164 | Ga0496118_0035164_81_839 | 251 |
| 584 | 3300048924 | Ga0496121_0000671 | Ga0496121_0000671_57179_57937 | 251 |
| 585 | 3300048929 | Ga0496126_0001878 | Ga0496126_0001878_5948_6706 | 251 |
| 586 | 3300046512 | Ga0495610_0027251 | Ga0495610_0027251_1382_2152 | 252 |
| 587 | 3300048913 | Ga0496110_0609108 | Ga0496110_0609108_191_973 | 252 |
| 588 | 3300048914 | Ga0496111_0413687 | Ga0496111_0413687_36_818 | 252 |
| 589 | 3300048919 | Ga0496116_0047806 | Ga0496116_0047806_280_1062 | 252 |
| 590 | 3300048924 | Ga0496121_0030578 | Ga0496121_0030578_1720_2502 | 252 |
| 591 | 3300048927 | Ga0496124_0090965 | Ga0496124_0090965_695_1477 | 252 |
| 592 | 3300048928 | Ga0496125_0215487 | Ga0496125_0215487_124_906 | 252 |
| 593 | 3300009545 | Ga0105237_10585404 | Ga0105237_105854041 | 255 |
| 594 | 3300005367 | Ga0070667_100001100 | Ga0070667_10000110018 | 258 |
| 595 | 3300005843 | Ga0068860_100286162 | Ga0068860_1002861622 | 258 |
| 596 | 3300025986 | Ga0207658_10000571 | Ga0207658_100005716 | 258 |
| 597 | 3300028381 | Ga0268264_10245060 | Ga0268264_102450602 | 258 |
| 598 | 3300046501 | Ga0495607_0016964 | Ga0495607_0016964_1660_2463 | 260 |
| 599 | 3300025294 | Ga0209025_1075443 | Ga0209025_10754432 | 261 |
| 600 | 3300025304 | Ga0209257_1002394 | Ga0209257_10023945 | 261 |
| 601 | 3300048913 | Ga0496110_0050768 | Ga0496110_0050768_1506_2318 | 262 |
| 602 | 3300048914 | Ga0496111_0107898 | Ga0496111_0107898_272_1084 | 262 |
| 603 | 3300048925 | Ga0496122_0018901 | Ga0496122_0018901_4555_5367 | 262 |
| 604 | 3300048927 | Ga0496124_0038486 | Ga0496124_0038486_3330_4142 | 262 |
| 605 | 3300048928 | Ga0496125_0031437 | Ga0496125_0031437_805_1617 | 262 |
| 606 | 3300048929 | Ga0496126_0058122 | Ga0496126_0058122_2107_2919 | 262 |
| 607 | 3300053134 | Ga0500658_0007915 | Ga0500658_0007915_505_1299 | 262 |
| 608 | 3300005289 | Ga0065704_10000192 | Ga0065704_1000019273 | 265 |
| 609 | 3300048924 | Ga0496121_0000579 | Ga0496121_0000579_15013_15882 | 270 |
| 610 | 3300048927 | Ga0496124_0005911 | Ga0496124_0005911_146_1015 | 270 |
| 611 | 3300046460 | Ga0495638_0000267 | Ga0495638_0000267_27838_28698 | 272 |
| 612 | 2162886007 | SwRhRL2b_contig_2866031 | SwRhRL2b_0418.00003710 | 291 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4bnd-assembly2.cif.gz_B | structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases | 0.9199 | 42 | 287 |
| 4bnd-assembly2.cif.gz_A | structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases | 0.9193 | 42 | 287 |
| 4bnd-assembly2.cif.gz_A | structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases | 0.8953 | 42 | 287 |
| 4bnd-assembly2.cif.gz_B | structure of an atypical alpha-phosphoglucomutase similar to eukaryotic phosphomannomutases | 0.8925 | 42 | 287 |
| 2no5-assembly1.cif.gz_B | crystal structure analysis of a dehalogenase with intermediate complex | 0.7985 | 228 | 271 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4bndA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9734 | 42 | 287 | 3.40.50.1000 |
| 4bndA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.949 | 42 | 287 | 3.40.50.1000 |
| 4bndB02 | Alpha Beta;2-Layer Sandwich;Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2;Eukaryotic phosphomannomutase, cap domain | 0.928 | 132 | 223 | 3.30.1240.20 |
| 4bndB02 | Alpha Beta;2-Layer Sandwich;Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2;Eukaryotic phosphomannomutase, cap domain | 0.8822 | 132 | 223 | 3.30.1240.20 |
| 6cfsA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8564 | 43 | 284 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5N6KS71-F1-model_v4 | Phosphomannomutase (EC 5.4.2.8) | 0.9972 | 42 | 290 |
GO:0004615
GO:0005829 GO:0006013 GO:0006487 GO:0009298 GO:0046872 |
| AF-A0A2A2K688-F1-model_v4 | phosphomannomutase (EC 5.4.2.8) | 0.9951 | 66 | 288 |
GO:0004615
GO:0005737 GO:0009298 GO:0046872 |
| AF-D4D4Z5-F1-model_v4 | phosphomannomutase (EC 5.4.2.8) | 0.9892 | 42 | 288 |
GO:0004615
GO:0005737 GO:0009298 GO:0046872 |
| AF-A0A520IRZ7-F1-model_v4 | HAD family hydrolase | 0.9889 | 42 | 127 |
|
| AF-A0A1J9RXN2-F1-model_v4 | Phosphomannomutase (EC 5.4.2.8) | 0.9828 | 42 | 290 |
GO:0004615
GO:0005829 GO:0006013 GO:0006487 GO:0009298 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar