F469105
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 611 | 288 | 611 | 209 |
Family's Representative Sequence
| Representative Sequence | 3300053078|Ga0495612_0000027|Ga0495612_0000027_24839_25573 |
| Length | 244 |
| Sequence | MSAPDGGAPPGSTTTMAPRRHETSPRGPRRGAYRGGRPRRARAPIGAGERRELVRNALIESRLTPNAISLTGLMLNMVAAVLVWEQLFFLGGIAFVVGSIMDTLDGRYSRMSGKGTPFGAFLDSTLDRIEEGIVLTAVAGYFALQGDRIAAAAVXXXVLASLMVSYTRARAEALGVECKVGIATRPVRVVILSIGLIFAQGASLGDFQLLAPAVYVLAALSLITVAQRVAHVRRALSAPPLPSV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 141 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 142 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 143 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 147 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 148 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 154 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 155 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 156 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 162 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 163 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 165 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 168 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 169 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 170 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 171 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 172 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 173 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 176 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 179 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 180 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 181 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 182 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 183 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 184 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 185 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 186 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 187 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 188 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 189 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 190 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 191 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 227 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 228 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 229 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 230 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 231 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 232 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 235 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 236 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 237 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 238 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 239 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 240 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 241 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 242 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 243 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 267 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 268 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 281 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 282 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 283 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 284 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 285 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 288 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.29 |
| Nodule | 0 |
| Rhizoplane | 9.17 |
| Rhizosphere | 86.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10018784 | 3300002077 | Bacteria | 1369 |
| 2 | JGI25406J46586_10006137 | 3300003203 | Bacteria | 5550 |
| 3 | JGI25407J50210_10000018 | 3300003373 | Bacteria | 17776 |
| 4 | Ga0070658_10195059 | 3300005327 | Bacteria | 1708 |
| 5 | Ga0070658_10220464 | 3300005327 | Bacteria | 1604 |
| 6 | Ga0070676_10058367 | 3300005328 | Bacteria | 2287 |
| 7 | Ga0070676_10163690 | 3300005328 | Bacteria | 1434 |
| 8 | Ga0070676_10196589 | 3300005328 | Bacteria | 1320 |
| 9 | Ga0070683_100049926 | 3300005329 | Bacteria | 3871 |
| 10 | Ga0070683_100259281 | 3300005329 | Bacteria | 1653 |
| 11 | Ga0070683_100344845 | 3300005329 | Bacteria | 1418 |
| 12 | Ga0070682_100027093 | 3300005337 | Bacteria | 3436 |
| 13 | Ga0070682_100186069 | 3300005337 | Bacteria | 1454 |
| 14 | Ga0070682_100615751 | 3300005337 | Bacteria | 859 |
| 15 | Ga0068868_100353240 | 3300005338 | Bacteria | 1259 |
| 16 | Ga0070660_100016882 | 3300005339 | Bacteria | 5310 |
| 17 | Ga0070660_100190193 | 3300005339 | Bacteria | 1662 |
| 18 | Ga0070660_100224350 | 3300005339 | Bacteria | 1528 |
| 19 | Ga0070660_100297552 | 3300005339 | Bacteria | 1322 |
| 20 | Ga0070660_100340631 | 3300005339 | Bacteria | 1234 |
| 21 | Ga0070689_100247617 | 3300005340 | Bacteria | 1470 |
| 22 | Ga0070691_10023847 | 3300005341 | Bacteria | 2842 |
| 23 | Ga0070691_10024194 | 3300005341 | Bacteria | 2823 |
| 24 | Ga0070661_100066766 | 3300005344 | Bacteria | 2643 |
| 25 | Ga0070661_100472762 | 3300005344 | Bacteria | 1000 |
| 26 | Ga0070692_10020142 | 3300005345 | Bacteria | 3230 |
| 27 | Ga0070692_10317217 | 3300005345 | Bacteria | 957 |
| 28 | Ga0070692_10449222 | 3300005345 | Bacteria | 825 |
| 29 | Ga0070668_100013689 | 3300005347 | Bacteria | 6057 |
| 30 | Ga0070668_100074027 | 3300005347 | Bacteria | 2656 |
| 31 | Ga0070675_100092248 | 3300005354 | Bacteria | 2539 |
| 32 | Ga0070675_100265192 | 3300005354 | Bacteria | 1506 |
| 33 | Ga0070671_100116007 | 3300005355 | Bacteria | 2251 |
| 34 | Ga0070673_100032861 | 3300005364 | Bacteria | 3912 |
| 35 | Ga0070688_100000506 | 3300005365 | Bacteria | 19723 |
| 36 | Ga0070688_100048863 | 3300005365 | Bacteria | 2630 |
| 37 | Ga0070659_100140687 | 3300005366 | Bacteria | 1965 |
| 38 | Ga0070659_100499268 | 3300005366 | Bacteria | 1037 |
| 39 | Ga0070659_100655101 | 3300005366 | Bacteria | 905 |
| 40 | Ga0070714_100063622 | 3300005435 | Bacteria | 3173 |
| 41 | Ga0070714_100194002 | 3300005435 | Bacteria | 1855 |
| 42 | Ga0070714_100491131 | 3300005435 | Bacteria | 1170 |
| 43 | Ga0070701_10198296 | 3300005438 | Bacteria | 1185 |
| 44 | Ga0070711_100000637 | 3300005439 | Bacteria | 18301 |
| 45 | Ga0070711_100338266 | 3300005439 | Bacteria | 1207 |
| 46 | Ga0070711_100361037 | 3300005439 | Bacteria | 1170 |
| 47 | Ga0070711_100430001 | 3300005439 | Bacteria | 1077 |
| 48 | Ga0070705_100246791 | 3300005440 | Bacteria | 1251 |
| 49 | Ga0070700_100023124 | 3300005441 | Bacteria | 3633 |
| 50 | Ga0070700_100615448 | 3300005441 | Bacteria | 853 |
| 51 | Ga0070694_100097947 | 3300005444 | Bacteria | 2069 |
| 52 | Ga0070678_100477015 | 3300005456 | Bacteria | 1097 |
| 53 | Ga0070678_100822723 | 3300005456 | Bacteria | 844 |
| 54 | Ga0070662_100010934 | 3300005457 | Bacteria | 5982 |
| 55 | Ga0070662_100023968 | 3300005457 | Bacteria | 4199 |
| 56 | Ga0070681_10492504 | 3300005458 | Bacteria | 1139 |
| 57 | Ga0070685_10005485 | 3300005466 | Bacteria | 6427 |
| 58 | Ga0070685_10047339 | 3300005466 | Bacteria | 2472 |
| 59 | Ga0070685_10068886 | 3300005466 | Bacteria | 2091 |
| 60 | Ga0070684_100026315 | 3300005535 | Bacteria | 4900 |
| 61 | Ga0070684_100027133 | 3300005535 | Bacteria | 4831 |
| 62 | Ga0070684_100694064 | 3300005535 | Bacteria | 949 |
| 63 | Ga0068853_100111216 | 3300005539 | Bacteria | 2433 |
| 64 | Ga0070672_100000023 | 3300005543 | Bacteria | 68631 |
| 65 | Ga0070672_100312444 | 3300005543 | Bacteria | 1334 |
| 66 | Ga0070672_100327182 | 3300005543 | Bacteria | 1303 |
| 67 | Ga0070695_100063323 | 3300005545 | Bacteria | 2404 |
| 68 | Ga0070696_100104510 | 3300005546 | Bacteria | 2034 |
| 69 | Ga0070696_100141392 | 3300005546 | Bacteria | 1759 |
| 70 | Ga0070665_100000159 | 3300005548 | Bacteria | 122613 |
| 71 | Ga0070665_100139674 | 3300005548 | Bacteria | 2426 |
| 72 | Ga0070665_100206139 | 3300005548 | Bacteria | 1967 |
| 73 | Ga0070665_100449684 | 3300005548 | Bacteria | 1298 |
| 74 | Ga0068855_100744672 | 3300005563 | Bacteria | 1045 |
| 75 | Ga0070664_100115734 | 3300005564 | Bacteria | 2344 |
| 76 | Ga0068857_100197195 | 3300005577 | Bacteria | 1835 |
| 77 | Ga0068857_100501205 | 3300005577 | Bacteria | 1139 |
| 78 | Ga0068854_100283672 | 3300005578 | Bacteria | 1334 |
| 79 | Ga0068856_100006496 | 3300005614 | Bacteria | 11467 |
| 80 | Ga0068856_100027346 | 3300005614 | Bacteria | 5565 |
| 81 | Ga0068856_100037898 | 3300005614 | Bacteria | 4731 |
| 82 | Ga0068856_100226642 | 3300005614 | Bacteria | 1884 |
| 83 | Ga0070702_100490974 | 3300005615 | Bacteria | 900 |
| 84 | Ga0068852_100212849 | 3300005616 | Bacteria | 1834 |
| 85 | Ga0068864_100245432 | 3300005618 | Bacteria | 1660 |
| 86 | Ga0068866_10155218 | 3300005718 | Bacteria | 1330 |
| 87 | Ga0068861_100058564 | 3300005719 | Bacteria | 2946 |
| 88 | Ga0068861_100091020 | 3300005719 | Bacteria | 2407 |
| 89 | Ga0068861_100115803 | 3300005719 | Bacteria | 2154 |
| 90 | Ga0068851_10122515 | 3300005834 | Bacteria | 1398 |
| 91 | Ga0068870_10080389 | 3300005840 | Bacteria | 1801 |
| 92 | Ga0068863_100923672 | 3300005841 | Bacteria | 874 |
| 93 | Ga0068858_100000049 | 3300005842 | Bacteria | 122693 |
| 94 | Ga0068858_100163404 | 3300005842 | Bacteria | 2097 |
| 95 | Ga0068860_100090770 | 3300005843 | Bacteria | 2910 |
| 96 | Ga0068860_100286477 | 3300005843 | Bacteria | 1611 |
| 97 | Ga0068862_100497443 | 3300005844 | Bacteria | 1157 |
| 98 | Ga0081455_10015099 | 3300005937 | Bacteria | 7519 |
| 99 | Ga0081455_10026759 | 3300005937 | Bacteria | 5296 |
| 100 | Ga0081455_10142520 | 3300005937 | Bacteria | 1859 |
| 101 | Ga0081538_10000165 | 3300005981 | Bacteria | 70648 |
| 102 | Ga0081538_10001947 | 3300005981 | Bacteria | 20687 |
| 103 | Ga0081538_10001989 | 3300005981 | Bacteria | 20415 |
| 104 | Ga0081538_10003490 | 3300005981 | Bacteria | 14842 |
| 105 | Ga0081538_10006287 | 3300005981 | Bacteria | 10493 |
| 106 | Ga0081538_10010471 | 3300005981 | Bacteria | 7604 |
| 107 | Ga0081538_10012803 | 3300005981 | Bacteria | 6697 |
| 108 | Ga0081538_10021555 | 3300005981 | Bacteria | 4695 |
| 109 | Ga0081538_10024027 | 3300005981 | Bacteria | 4356 |
| 110 | Ga0081538_10160474 | 3300005981 | Bacteria | 1000 |
| 111 | Ga0081540_1023644 | 3300005983 | Bacteria | 3588 |
| 112 | Ga0081539_10013302 | 3300005985 | Bacteria | 6212 |
| 113 | Ga0070717_10350507 | 3300006028 | Bacteria | 1320 |
| 114 | Ga0075365_10033335 | 3300006038 | Bacteria | 3317 |
| 115 | Ga0075365_10178610 | 3300006038 | Bacteria | 1484 |
| 116 | Ga0075365_10316707 | 3300006038 | Bacteria | 1098 |
| 117 | Ga0075364_10121055 | 3300006051 | Bacteria | 1752 |
| 118 | Ga0075432_10025621 | 3300006058 | Bacteria | 2024 |
| 119 | Ga0070712_100000007 | 3300006175 | Bacteria | 157653 |
| 120 | Ga0070712_100014849 | 3300006175 | Bacteria | 5005 |
| 121 | Ga0075428_100973581 | 3300006844 | Bacteria | 898 |
| 122 | Ga0075428_101256622 | 3300006844 | Bacteria | 779 |
| 123 | Ga0075430_100035065 | 3300006846 | Bacteria | 4259 |
| 124 | Ga0075430_100746802 | 3300006846 | Bacteria | 806 |
| 125 | Ga0075433_10116773 | 3300006852 | Bacteria | 2367 |
| 126 | Ga0075433_10130165 | 3300006852 | Bacteria | 2236 |
| 127 | Ga0075434_100066505 | 3300006871 | Bacteria | 3590 |
| 128 | Ga0075434_100356954 | 3300006871 | Bacteria | 1483 |
| 129 | Ga0075429_100143981 | 3300006880 | Bacteria | 2086 |
| 130 | Ga0075429_100289649 | 3300006880 | Bacteria | 1434 |
| 131 | Ga0068865_100341796 | 3300006881 | Bacteria | 1210 |
| 132 | Ga0075436_100004261 | 3300006914 | Bacteria | 9817 |
| 133 | Ga0075435_100011926 | 3300007076 | Bacteria | 6419 |
| 134 | Ga0105240_10005215 | 3300009093 | Bacteria | 19441 |
| 135 | Ga0111539_10039339 | 3300009094 | Bacteria | 5701 |
| 136 | Ga0111539_10210067 | 3300009094 | Bacteria | 2268 |
| 137 | Ga0111539_10720937 | 3300009094 | Bacteria | 1161 |
| 138 | Ga0111539_10905237 | 3300009094 | Bacteria | 1026 |
| 139 | Ga0105245_10020122 | 3300009098 | Bacteria | 5850 |
| 140 | Ga0105245_10141473 | 3300009098 | Bacteria | 2266 |
| 141 | Ga0105245_10325787 | 3300009098 | Bacteria | 1515 |
| 142 | Ga0105245_10345849 | 3300009098 | Bacteria | 1472 |
| 143 | Ga0105245_10729136 | 3300009098 | Bacteria | 1026 |
| 144 | Ga0105247_10638487 | 3300009101 | Bacteria | 794 |
| 145 | Ga0114129_10154600 | 3300009147 | Bacteria | 3138 |
| 146 | Ga0114129_10304851 | 3300009147 | Bacteria | 2122 |
| 147 | Ga0114129_10417395 | 3300009147 | Bacteria | 1766 |
| 148 | Ga0114129_11020040 | 3300009147 | Bacteria | 1041 |
| 149 | Ga0114129_11386346 | 3300009147 | Bacteria | 868 |
| 150 | Ga0114129_11684300 | 3300009147 | Bacteria | 774 |
| 151 | Ga0105242_10199647 | 3300009176 | Bacteria | 1776 |
| 152 | Ga0105242_11035340 | 3300009176 | Bacteria | 831 |
| 153 | Ga0105238_10172716 | 3300009551 | Bacteria | 2138 |
| 154 | Ga0105238_10559022 | 3300009551 | Bacteria | 1149 |
| 155 | Ga0105249_10040756 | 3300009553 | Bacteria | 4219 |
| 156 | Ga0105249_10287682 | 3300009553 | Bacteria | 1644 |
| 157 | Ga0105249_10358833 | 3300009553 | Bacteria | 1478 |
| 158 | Ga0105239_10073153 | 3300010375 | Bacteria | 3768 |
| 159 | Ga0105239_10271319 | 3300010375 | Bacteria | 1908 |
| 160 | Ga0157371_10122023 | 3300013102 | Bacteria | 1853 |
| 161 | Ga0157374_10957726 | 3300013296 | Bacteria | 874 |
| 162 | Ga0157378_10535487 | 3300013297 | Bacteria | 1174 |
| 163 | Ga0157378_10708953 | 3300013297 | Bacteria | 1026 |
| 164 | Ga0163162_10282646 | 3300013306 | Bacteria | 1791 |
| 165 | Ga0163162_10714891 | 3300013306 | Bacteria | 1123 |
| 166 | Ga0157372_10176447 | 3300013307 | Bacteria | 2473 |
| 167 | Ga0157372_10332688 | 3300013307 | Bacteria | 1769 |
| 168 | Ga0157372_10478234 | 3300013307 | Bacteria | 1452 |
| 169 | Ga0157375_10004774 | 3300013308 | Bacteria | 11779 |
| 170 | Ga0157375_10328203 | 3300013308 | Bacteria | 1695 |
| 171 | Ga0157375_10555737 | 3300013308 | Bacteria | 1309 |
| 172 | Ga0163163_10057328 | 3300014325 | Bacteria | 3851 |
| 173 | Ga0163163_10158791 | 3300014325 | Bacteria | 2306 |
| 174 | Ga0157380_10103157 | 3300014326 | Bacteria | 2379 |
| 175 | Ga0182008_10123142 | 3300014497 | Bacteria | 1289 |
| 176 | Ga0157377_10239335 | 3300014745 | Bacteria | 1171 |
| 177 | Ga0157379_10201061 | 3300014968 | Bacteria | 1802 |
| 178 | Ga0163161_10219953 | 3300017792 | Bacteria | 1470 |
| 179 | Ga0163161_10261693 | 3300017792 | Bacteria | 1351 |
| 180 | Ga0163161_10306797 | 3300017792 | Bacteria | 1251 |
| 181 | Ga0207656_10124694 | 3300025321 | Bacteria | 1202 |
| 182 | Ga0207692_10016191 | 3300025898 | Bacteria | 3295 |
| 183 | Ga0207692_10043707 | 3300025898 | Bacteria | 2231 |
| 184 | Ga0207692_10330269 | 3300025898 | Bacteria | 935 |
| 185 | Ga0207642_10045134 | 3300025899 | Unclassified | 1955 |
| 186 | Ga0207642_10068823 | 3300025899 | Bacteria | 1676 |
| 187 | Ga0207642_10137465 | 3300025899 | Bacteria | 1283 |
| 188 | Ga0207710_10071531 | 3300025900 | Bacteria | 1591 |
| 189 | Ga0207688_10005194 | 3300025901 | Bacteria | 7079 |
| 190 | Ga0207688_10163538 | 3300025901 | Bacteria | 1320 |
| 191 | Ga0207688_10272294 | 3300025901 | Bacteria | 1030 |
| 192 | Ga0207680_10585902 | 3300025903 | Bacteria | 797 |
| 193 | Ga0207645_10061122 | 3300025907 | Bacteria | 2406 |
| 194 | Ga0207643_10036157 | 3300025908 | Bacteria | 2769 |
| 195 | Ga0207643_10329431 | 3300025908 | Bacteria | 955 |
| 196 | Ga0207705_10156717 | 3300025909 | Bacteria | 1709 |
| 197 | Ga0207705_10240910 | 3300025909 | Bacteria | 1378 |
| 198 | Ga0207695_10003355 | 3300025913 | Bacteria | 22624 |
| 199 | Ga0207693_10000001 | 3300025915 | Bacteria | 469535 |
| 200 | Ga0207693_10084407 | 3300025915 | Bacteria | 2488 |
| 201 | Ga0207663_10000426 | 3300025916 | Bacteria | 18302 |
| 202 | Ga0207663_10261971 | 3300025916 | Bacteria | 1277 |
| 203 | Ga0207662_10054365 | 3300025918 | Bacteria | 2387 |
| 204 | Ga0207657_10026411 | 3300025919 | Bacteria | 5338 |
| 205 | Ga0207657_10105455 | 3300025919 | Bacteria | 2333 |
| 206 | Ga0207657_10117623 | 3300025919 | Bacteria | 2189 |
| 207 | Ga0207657_10146296 | 3300025919 | Bacteria | 1927 |
| 208 | Ga0207657_10227717 | 3300025919 | Bacteria | 1492 |
| 209 | Ga0207657_10238336 | 3300025919 | Bacteria | 1453 |
| 210 | Ga0207649_10052660 | 3300025920 | Bacteria | 2526 |
| 211 | Ga0207649_10385068 | 3300025920 | Bacteria | 1046 |
| 212 | Ga0207681_10583378 | 3300025923 | Bacteria | 922 |
| 213 | Ga0207694_10234375 | 3300025924 | Bacteria | 1499 |
| 214 | Ga0207694_10511391 | 3300025924 | Bacteria | 1006 |
| 215 | Ga0207659_10070208 | 3300025926 | Bacteria | 2554 |
| 216 | Ga0207659_10122372 | 3300025926 | Bacteria | 1995 |
| 217 | Ga0207687_10011450 | 3300025927 | Bacteria | 5797 |
| 218 | Ga0207687_10024111 | 3300025927 | Bacteria | 4062 |
| 219 | Ga0207687_10126399 | 3300025927 | Bacteria | 1920 |
| 220 | Ga0207687_10195111 | 3300025927 | Bacteria | 1579 |
| 221 | Ga0207690_10110930 | 3300025932 | Bacteria | 1976 |
| 222 | Ga0207706_10002857 | 3300025933 | Bacteria | 16767 |
| 223 | Ga0207706_10022392 | 3300025933 | Bacteria | 5671 |
| 224 | Ga0207706_10442347 | 3300025933 | Bacteria | 1125 |
| 225 | Ga0207709_10133413 | 3300025935 | Bacteria | 1696 |
| 226 | Ga0207670_10069391 | 3300025936 | Bacteria | 2431 |
| 227 | Ga0207669_10219492 | 3300025937 | Bacteria | 1394 |
| 228 | Ga0207669_10298493 | 3300025937 | Bacteria | 1223 |
| 229 | Ga0207704_10031895 | 3300025938 | Bacteria | 2974 |
| 230 | Ga0207704_10145842 | 3300025938 | Bacteria | 1662 |
| 231 | Ga0207704_10670769 | 3300025938 | Bacteria | 856 |
| 232 | Ga0207665_10120461 | 3300025939 | Bacteria | 1853 |
| 233 | Ga0207691_10008775 | 3300025940 | Bacteria | 9698 |
| 234 | Ga0207691_10049622 | 3300025940 | Bacteria | 3846 |
| 235 | Ga0207691_10099797 | 3300025940 | Bacteria | 2592 |
| 236 | Ga0207711_10055684 | 3300025941 | Bacteria | 3395 |
| 237 | Ga0207689_10067770 | 3300025942 | Bacteria | 2933 |
| 238 | Ga0207661_10198665 | 3300025944 | Bacteria | 1762 |
| 239 | Ga0207661_10202679 | 3300025944 | Bacteria | 1745 |
| 240 | Ga0207661_10293973 | 3300025944 | Bacteria | 1454 |
| 241 | Ga0207661_10416085 | 3300025944 | Bacteria | 1220 |
| 242 | Ga0207661_10581209 | 3300025944 | Bacteria | 1027 |
| 243 | Ga0207679_10028851 | 3300025945 | Bacteria | 3857 |
| 244 | Ga0207679_10262750 | 3300025945 | Bacteria | 1473 |
| 245 | Ga0207651_10053060 | 3300025960 | Bacteria | 2769 |
| 246 | Ga0207712_10068060 | 3300025961 | Bacteria | 2550 |
| 247 | Ga0207712_10117764 | 3300025961 | Bacteria | 2004 |
| 248 | Ga0207712_10158561 | 3300025961 | Bacteria | 1756 |
| 249 | Ga0207668_10016678 | 3300025972 | Bacteria | 4588 |
| 250 | Ga0207668_10027193 | 3300025972 | Bacteria | 3725 |
| 251 | Ga0207668_10124131 | 3300025972 | Bacteria | 1960 |
| 252 | Ga0207668_10387104 | 3300025972 | Bacteria | 1179 |
| 253 | Ga0207640_10182474 | 3300025981 | Bacteria | 1575 |
| 254 | Ga0207640_10400637 | 3300025981 | Bacteria | 1117 |
| 255 | Ga0207677_10072931 | 3300026023 | Bacteria | 2429 |
| 256 | Ga0207677_10131887 | 3300026023 | Bacteria | 1899 |
| 257 | Ga0207677_10391157 | 3300026023 | Bacteria | 1176 |
| 258 | Ga0207703_10000132 | 3300026035 | Bacteria | 90163 |
| 259 | Ga0207639_10045110 | 3300026041 | Bacteria | 3319 |
| 260 | Ga0207678_10025778 | 3300026067 | Bacteria | 5131 |
| 261 | Ga0207678_10198047 | 3300026067 | Bacteria | 1717 |
| 262 | Ga0207708_10044509 | 3300026075 | Bacteria | 3382 |
| 263 | Ga0207708_10156759 | 3300026075 | Bacteria | 1796 |
| 264 | Ga0207708_10169024 | 3300026075 | Bacteria | 1730 |
| 265 | Ga0207702_10018367 | 3300026078 | Bacteria | 5786 |
| 266 | Ga0207702_10229018 | 3300026078 | Bacteria | 1736 |
| 267 | Ga0207702_10270008 | 3300026078 | Bacteria | 1604 |
| 268 | Ga0207702_10274738 | 3300026078 | Bacteria | 1591 |
| 269 | Ga0207702_10446887 | 3300026078 | Bacteria | 1254 |
| 270 | Ga0207648_10114997 | 3300026089 | Bacteria | 2364 |
| 271 | Ga0207648_10458510 | 3300026089 | Bacteria | 1162 |
| 272 | Ga0207676_10144121 | 3300026095 | Bacteria | 2043 |
| 273 | Ga0207674_10084994 | 3300026116 | Bacteria | 3161 |
| 274 | Ga0207674_10192810 | 3300026116 | Bacteria | 1988 |
| 275 | Ga0207674_10366304 | 3300026116 | Bacteria | 1393 |
| 276 | Ga0207675_100016374 | 3300026118 | Bacteria | 6921 |
| 277 | Ga0207675_100066619 | 3300026118 | Bacteria | 3366 |
| 278 | Ga0207675_100081792 | 3300026118 | Bacteria | 3029 |
| 279 | Ga0207675_100148922 | 3300026118 | Bacteria | 2227 |
| 280 | Ga0207683_10216835 | 3300026121 | Bacteria | 1743 |
| 281 | Ga0207683_10244549 | 3300026121 | Bacteria | 1637 |
| 282 | Ga0207698_10031883 | 3300026142 | Bacteria | 3810 |
| 283 | Ga0207698_10192982 | 3300026142 | Bacteria | 1816 |
| 284 | Ga0207698_10294775 | 3300026142 | Bacteria | 1507 |
| 285 | Ga0207698_11134066 | 3300026142 | Bacteria | 795 |
| 286 | Ga0207428_10010901 | 3300027907 | Bacteria | 8090 |
| 287 | Ga0207428_10066950 | 3300027907 | Bacteria | 2829 |
| 288 | Ga0207428_10307332 | 3300027907 | Bacteria | 1173 |
| 289 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 290 | Ga0268266_10072375 | 3300028379 | Bacteria | 2989 |
| 291 | Ga0268266_10104849 | 3300028379 | Bacteria | 2497 |
| 292 | Ga0268266_10153628 | 3300028379 | Bacteria | 2077 |
| 293 | Ga0268264_10151808 | 3300028381 | Bacteria | 2077 |
| 294 | Ga0268264_10414013 | 3300028381 | Bacteria | 1298 |
| 295 | Ga0265337_1040661 | 3300028556 | Bacteria | 1340 |
| 296 | Ga0265319_1000052 | 3300028563 | Bacteria | 95426 |
| 297 | Ga0265319_1000156 | 3300028563 | Bacteria | 51344 |
| 298 | Ga0265334_10000001 | 3300028573 | Bacteria | 343037 |
| 299 | Ga0265336_10048781 | 3300028666 | Bacteria | 1283 |
| 300 | Ga0265338_10019015 | 3300028800 | Bacteria | 7317 |
| 301 | Ga0265338_10023150 | 3300028800 | Bacteria | 6397 |
| 302 | Ga0265338_10106450 | 3300028800 | Bacteria | 2270 |
| 303 | Ga0265324_10002904 | 3300029957 | Bacteria | 8422 |
| 304 | Ga0265320_10006280 | 3300031240 | Bacteria | 7510 |
| 305 | Ga0265327_10043362 | 3300031251 | Bacteria | 2407 |
| 306 | Ga0265327_10085736 | 3300031251 | Bacteria | 1546 |
| 307 | Ga0265316_10124026 | 3300031344 | Bacteria | 1949 |
| 308 | Ga0265316_10287952 | 3300031344 | Bacteria | 1199 |
| 309 | Ga0307408_100165598 | 3300031548 | Bacteria | 1760 |
| 310 | Ga0307408_100225459 | 3300031548 | Bacteria | 1532 |
| 311 | Ga0265313_10049882 | 3300031595 | Bacteria | 2012 |
| 312 | Ga0265313_10059240 | 3300031595 | Bacteria | 1802 |
| 313 | Ga0265314_10021410 | 3300031711 | Bacteria | 4971 |
| 314 | Ga0265314_10397654 | 3300031711 | Bacteria | 746 |
| 315 | Ga0307405_10014328 | 3300031731 | Bacteria | 4259 |
| 316 | Ga0307405_10154718 | 3300031731 | Bacteria | 1617 |
| 317 | Ga0307405_10372846 | 3300031731 | Bacteria | 1108 |
| 318 | Ga0307413_10111082 | 3300031824 | Bacteria | 1835 |
| 319 | Ga0307413_10426122 | 3300031824 | Bacteria | 1046 |
| 320 | Ga0307413_10711094 | 3300031824 | Bacteria | 836 |
| 321 | Ga0307410_10019041 | 3300031852 | Bacteria | 4166 |
| 322 | Ga0307410_10156305 | 3300031852 | Bacteria | 1703 |
| 323 | Ga0307410_10157933 | 3300031852 | Bacteria | 1696 |
| 324 | Ga0307406_10024016 | 3300031901 | Bacteria | 3636 |
| 325 | Ga0307406_10191272 | 3300031901 | Bacteria | 1498 |
| 326 | Ga0307407_10107289 | 3300031903 | Bacteria | 1746 |
| 327 | Ga0307407_10301999 | 3300031903 | Bacteria | 1116 |
| 328 | Ga0307407_10514440 | 3300031903 | Bacteria | 879 |
| 329 | Ga0307412_10321641 | 3300031911 | Bacteria | 1231 |
| 330 | Ga0307412_10326837 | 3300031911 | Bacteria | 1222 |
| 331 | Ga0307409_100198838 | 3300031995 | Bacteria | 1791 |
| 332 | Ga0307409_100318475 | 3300031995 | Bacteria | 1454 |
| 333 | Ga0307409_100480415 | 3300031995 | Bacteria | 1205 |
| 334 | Ga0307416_100005809 | 3300032002 | Bacteria | 7649 |
| 335 | Ga0307416_100025779 | 3300032002 | Bacteria | 4318 |
| 336 | Ga0307416_100090409 | 3300032002 | Bacteria | 2625 |
| 337 | Ga0307416_100119413 | 3300032002 | Bacteria | 2345 |
| 338 | Ga0307416_100235550 | 3300032002 | Bacteria | 1769 |
| 339 | Ga0307416_100317674 | 3300032002 | Bacteria | 1558 |
| 340 | Ga0307416_100437015 | 3300032002 | Bacteria | 1357 |
| 341 | Ga0307414_10166070 | 3300032004 | Bacteria | 1759 |
| 342 | Ga0307414_10238048 | 3300032004 | Bacteria | 1505 |
| 343 | Ga0307414_10306858 | 3300032004 | Bacteria | 1345 |
| 344 | Ga0307414_10346024 | 3300032004 | Bacteria | 1274 |
| 345 | Ga0307411_10142280 | 3300032005 | Bacteria | 1770 |
| 346 | Ga0307411_10194972 | 3300032005 | Bacteria | 1550 |
| 347 | Ga0307415_100066254 | 3300032126 | Bacteria | 2519 |
| 348 | Ga0307415_100123900 | 3300032126 | Bacteria | 1944 |
| 349 | Ga0307415_100155670 | 3300032126 | Bacteria | 1764 |
| 350 | Ga0307415_100158262 | 3300032126 | Bacteria | 1752 |
| 351 | Ga0307415_100160490 | 3300032126 | Bacteria | 1742 |
| 352 | Ga0307415_100433675 | 3300032126 | Bacteria | 1131 |
| 353 | Ga0307415_100453133 | 3300032126 | Bacteria | 1110 |
| 354 | Ga0307415_100600517 | 3300032126 | Bacteria | 979 |
| 355 | Ga0373949_0030356 | 3300035090 | Bacteria | 1285 |
| 356 | Ga0373952_0042221 | 3300035092 | Bacteria | 1058 |
| 357 | Ga0373953_0022097 | 3300035117 | Bacteria | 2395 |
| 358 | Ga0373955_0432961 | 3300035172 | Bacteria | 801 |
| 359 | Ga0373927_0503078 | 3300035695 | Bacteria | 801 |
| 360 | Ga0373947_0044116 | 3300035725 | Bacteria | 2664 |
| 361 | Ga0395899_0061282 | 3300037312 | Bacteria | 2771 |
| 362 | Ga0395900_0004132 | 3300037418 | Bacteria | 15455 |
| 363 | Ga0395900_0008401 | 3300037418 | Bacteria | 10626 |
| 364 | Ga0395900_0260007 | 3300037418 | Bacteria | 1734 |
| 365 | Ga0395898_0001355 | 3300037466 | Bacteria | 35270 |
| 366 | Ga0395898_0011175 | 3300037466 | Bacteria | 9349 |
| 367 | Ga0395898_0078872 | 3300037466 | Bacteria | 3177 |
| 368 | Ga0395898_0092857 | 3300037466 | Bacteria | 2902 |
| 369 | Ga0395898_0099486 | 3300037466 | Bacteria | 2793 |
| 370 | Ga0395898_0637334 | 3300037466 | Bacteria | 1008 |
| 371 | Ga0395898_0640488 | 3300037466 | Bacteria | 1005 |
| 372 | Ga0395905_0210447 | 3300037471 | Bacteria | 1822 |
| 373 | Ga0395905_0358190 | 3300037471 | Bacteria | 1351 |
| 374 | Ga0436364_0969936 | 3300037853 | Bacteria | 3798 |
| 375 | Ga0395901_0024113 | 3300038443 | Bacteria | 6240 |
| 376 | Ga0395901_0165783 | 3300038443 | Bacteria | 2320 |
| 377 | Ga0395901_0208316 | 3300038443 | Bacteria | 2047 |
| 378 | Ga0395901_0235803 | 3300038443 | Bacteria | 1909 |
| 379 | Ga0395901_0373622 | 3300038443 | Bacteria | 1468 |
| 380 | Ga0395901_0407152 | 3300038443 | Bacteria | 1397 |
| 381 | Ga0395901_0684728 | 3300038443 | Bacteria | 1025 |
| 382 | Ga0395901_1020923 | 3300038443 | Bacteria | 802 |
| 383 | Ga0436365_0653290 | 3300039437 | Bacteria | 4733 |
| 384 | Ga0436365_0936558 | 3300039437 | Bacteria | 741 |
| 385 | Ga0436365_0937302 | 3300039437 | Bacteria | 2042 |
| 386 | Ga0436365_1605536 | 3300039437 | Bacteria | 1666 |
| 387 | Ga0451791_1547596 | 3300041451 | Bacteria | 1778 |
| 388 | Ga0451802_1160422 | 3300041460 | Bacteria | 2088 |
| 389 | Ga0451849_0387124 | 3300041505 | Bacteria | 754 |
| 390 | Ga0451853_2317565 | 3300041512 | Bacteria | 1343 |
| 391 | Ga0439454_008223 | 3300042011 | Bacteria | 1328 |
| 392 | Ga0439463_029422 | 3300042016 | Bacteria | 1384 |
| 393 | Ga0439460_0100331 | 3300042461 | Bacteria | 929 |
| 394 | Ga0450916_005405 | 3300042530 | Bacteria | 1477 |
| 395 | Ga0439440_0028562 | 3300042993 | Bacteria | 1303 |
| 396 | Ga0466966_0133787 | 3300044684 | Bacteria | 1517 |
| 397 | Ga0466961_0227405 | 3300044693 | Bacteria | 1149 |
| 398 | Ga0466963_0022333 | 3300044694 | Bacteria | 4006 |
| 399 | Ga0466963_0088040 | 3300044694 | Bacteria | 2112 |
| 400 | Ga0466963_0221203 | 3300044694 | Bacteria | 1326 |
| 401 | Ga0466964_0052157 | 3300044706 | Bacteria | 1681 |
| 402 | Ga0466964_0066709 | 3300044706 | Bacteria | 1511 |
| 403 | Ga0466971_0007767 | 3300044719 | Bacteria | 4676 |
| 404 | Ga0466970_0084714 | 3300044765 | Bacteria | 1716 |
| 405 | Ga0466960_0000858 | 3300044901 | Bacteria | 10742 |
| 406 | Ga0466960_0015274 | 3300044901 | Bacteria | 3307 |
| 407 | Ga0466960_0101844 | 3300044901 | Bacteria | 1480 |
| 408 | Ga0466960_0403036 | 3300044901 | Bacteria | 788 |
| 409 | Ga0466967_0004908 | 3300045976 | Bacteria | 9137 |
| 410 | Ga0466967_0018339 | 3300045976 | Bacteria | 5589 |
| 411 | Ga0466967_0020897 | 3300045976 | Bacteria | 5304 |
| 412 | Ga0466967_0023330 | 3300045976 | Bacteria | 5067 |
| 413 | Ga0466967_0026073 | 3300045976 | Bacteria | 4834 |
| 414 | Ga0466967_0039131 | 3300045976 | Bacteria | 4074 |
| 415 | Ga0466967_0159971 | 3300045976 | Bacteria | 2113 |
| 416 | Ga0466967_0186887 | 3300045976 | Bacteria | 1957 |
| 417 | Ga0466967_0282259 | 3300045976 | Bacteria | 1593 |
| 418 | Ga0466967_0562097 | 3300045976 | Bacteria | 1123 |
| 419 | Ga0466967_0574453 | 3300045976 | Bacteria | 1111 |
| 420 | Ga0495603_0441358 | 3300046455 | Bacteria | 745 |
| 421 | Ga0495629_0055393 | 3300046459 | Bacteria | 2773 |
| 422 | Ga0495641_0000012 | 3300046461 | Bacteria | 144818 |
| 423 | Ga0495641_0016616 | 3300046461 | Bacteria | 3868 |
| 424 | Ga0495641_0068063 | 3300046461 | Unclassified | 1601 |
| 425 | Ga0495653_0010808 | 3300046463 | Bacteria | 7471 |
| 426 | Ga0495650_0000070 | 3300046471 | Bacteria | 258497 |
| 427 | Ga0495584_0102493 | 3300046491 | Bacteria | 1447 |
| 428 | Ga0495596_0055423 | 3300046500 | Bacteria | 1549 |
| 429 | Ga0495618_0000108 | 3300046514 | Bacteria | 60531 |
| 430 | Ga0495628_0440568 | 3300046516 | Bacteria | 947 |
| 431 | Ga0495630_0001225 | 3300046517 | Bacteria | 17729 |
| 432 | Ga0495643_0177142 | 3300046522 | Bacteria | 1039 |
| 433 | Ga0495652_0416400 | 3300046529 | Bacteria | 948 |
| 434 | Ga0495587_0005615 | 3300046536 | Bacteria | 8186 |
| 435 | Ga0495609_0194671 | 3300046538 | Bacteria | 849 |
| 436 | Ga0495645_0000018 | 3300046543 | Bacteria | 155263 |
| 437 | Ga0495645_0036743 | 3300046543 | Bacteria | 3570 |
| 438 | Ga0495645_0177395 | 3300046543 | Bacteria | 1462 |
| 439 | Ga0495667_0006376 | 3300046559 | Bacteria | 7999 |
| 440 | Ga0495656_0122157 | 3300046615 | Bacteria | 1231 |
| 441 | Ga0495668_0118038 | 3300046616 | Bacteria | 1451 |
| 442 | Ga0495668_0255615 | 3300046616 | Bacteria | 959 |
| 443 | Ga0495634_0345172 | 3300046642 | Bacteria | 892 |
| 444 | Ga0495588_0208380 | 3300046674 | Bacteria | 1032 |
| 445 | Ga0495657_0000016 | 3300046675 | Bacteria | 183127 |
| 446 | Ga0495599_0061249 | 3300046678 | Bacteria | 2352 |
| 447 | Ga0495646_0095284 | 3300046680 | Bacteria | 1713 |
| 448 | Ga0495646_0156088 | 3300046680 | Bacteria | 1266 |
| 449 | Ga0495649_0005045 | 3300046694 | Bacteria | 8487 |
| 450 | Ga0495589_0152696 | 3300046794 | Bacteria | 1102 |
| 451 | Ga0495600_0419749 | 3300046809 | Bacteria | 830 |
| 452 | Ga0495676_0067014 | 3300047321 | Bacteria | 2779 |
| 453 | Ga0495676_0129801 | 3300047321 | Bacteria | 1821 |
| 454 | Ga0495680_0000255 | 3300047322 | Bacteria | 58745 |
| 455 | Ga0495680_0010505 | 3300047322 | Bacteria | 8261 |
| 456 | Ga0495684_0150504 | 3300047471 | Bacteria | 1740 |
| 457 | Ga0495686_0338544 | 3300047472 | Bacteria | 821 |
| 458 | Ga0495602_0075285 | 3300048088 | Bacteria | 2865 |
| 459 | Ga0496100_0012136 | 3300048903 | Bacteria | 4928 |
| 460 | Ga0496100_0120968 | 3300048903 | Bacteria | 1831 |
| 461 | Ga0496101_0003901 | 3300048904 | Bacteria | 9319 |
| 462 | Ga0496101_0214032 | 3300048904 | Bacteria | 1494 |
| 463 | Ga0496101_0275240 | 3300048904 | Bacteria | 1315 |
| 464 | Ga0496102_0047280 | 3300048905 | Bacteria | 3909 |
| 465 | Ga0496102_0208652 | 3300048905 | Bacteria | 1842 |
| 466 | Ga0496103_0109792 | 3300048906 | Bacteria | 1751 |
| 467 | Ga0496103_0285036 | 3300048906 | Bacteria | 1062 |
| 468 | Ga0496103_0296223 | 3300048906 | Bacteria | 1041 |
| 469 | Ga0496103_0336148 | 3300048906 | Bacteria | 971 |
| 470 | Ga0496104_0055122 | 3300048907 | Bacteria | 3758 |
| 471 | Ga0496104_0077971 | 3300048907 | Bacteria | 3157 |
| 472 | Ga0496104_0187817 | 3300048907 | Bacteria | 1977 |
| 473 | Ga0496104_0248544 | 3300048907 | Bacteria | 1691 |
| 474 | Ga0496104_0432968 | 3300048907 | Bacteria | 1227 |
| 475 | Ga0496105_0003559 | 3300048908 | Bacteria | 11556 |
| 476 | Ga0496105_0078327 | 3300048908 | Bacteria | 2729 |
| 477 | Ga0496105_0186240 | 3300048908 | Bacteria | 1699 |
| 478 | Ga0496105_0273581 | 3300048908 | Bacteria | 1363 |
| 479 | Ga0496106_0001105 | 3300048909 | Bacteria | 19947 |
| 480 | Ga0496107_0006169 | 3300048910 | Bacteria | 8232 |
| 481 | Ga0496107_0082435 | 3300048910 | Bacteria | 2345 |
| 482 | Ga0496108_0006693 | 3300048911 | Bacteria | 9332 |
| 483 | Ga0496108_0094702 | 3300048911 | Bacteria | 2542 |
| 484 | Ga0496108_0136637 | 3300048911 | Bacteria | 2110 |
| 485 | Ga0496108_0418611 | 3300048911 | Bacteria | 1170 |
| 486 | Ga0496108_0665723 | 3300048911 | Bacteria | 904 |
| 487 | Ga0496109_0000087 | 3300048912 | Bacteria | 95196 |
| 488 | Ga0496109_0063426 | 3300048912 | Bacteria | 3380 |
| 489 | Ga0496109_0332912 | 3300048912 | Bacteria | 1433 |
| 490 | Ga0496109_0547016 | 3300048912 | Bacteria | 1092 |
| 491 | Ga0496109_0850933 | 3300048912 | Bacteria | 850 |
| 492 | Ga0496110_0097240 | 3300048913 | Bacteria | 2638 |
| 493 | Ga0496111_0032348 | 3300048914 | Bacteria | 3728 |
| 494 | Ga0496111_0039272 | 3300048914 | Bacteria | 3393 |
| 495 | Ga0496111_0072564 | 3300048914 | Bacteria | 2505 |
| 496 | Ga0496111_0296368 | 3300048914 | Bacteria | 1199 |
| 497 | Ga0496111_0493745 | 3300048914 | Bacteria | 901 |
| 498 | Ga0496111_0700608 | 3300048914 | Bacteria | 737 |
| 499 | Ga0496112_0004190 | 3300048915 | Bacteria | 12150 |
| 500 | Ga0496112_0013818 | 3300048915 | Bacteria | 7469 |
| 501 | Ga0496112_0018394 | 3300048915 | Bacteria | 6577 |
| 502 | Ga0496112_0020380 | 3300048915 | Bacteria | 6285 |
| 503 | Ga0496112_0054668 | 3300048915 | Bacteria | 3923 |
| 504 | Ga0496112_0479281 | 3300048915 | Bacteria | 1181 |
| 505 | Ga0496112_0516084 | 3300048915 | Bacteria | 1130 |
| 506 | Ga0496113_0004436 | 3300048916 | Bacteria | 8627 |
| 507 | Ga0496113_0452345 | 3300048916 | Bacteria | 1032 |
| 508 | Ga0496114_0196351 | 3300048917 | Bacteria | 1766 |
| 509 | Ga0496114_0229683 | 3300048917 | Bacteria | 1630 |
| 510 | Ga0496115_0000884 | 3300048918 | Bacteria | 21818 |
| 511 | Ga0496115_0002240 | 3300048918 | Bacteria | 13856 |
| 512 | Ga0496115_0005827 | 3300048918 | Bacteria | 8976 |
| 513 | Ga0496119_0041609 | 3300048922 | Bacteria | 2924 |
| 514 | Ga0496121_0000817 | 3300048924 | Bacteria | 56786 |
| 515 | Ga0496121_0049677 | 3300048924 | Bacteria | 3553 |
| 516 | Ga0496122_0330594 | 3300048925 | Bacteria | 805 |
| 517 | Ga0501034_0018693 | 3300049571 | Bacteria | 7102 |
| 518 | Ga0501034_0024060 | 3300049571 | Bacteria | 6197 |
| 519 | Ga0501034_0242325 | 3300049571 | Bacteria | 1749 |
| 520 | Ga0501036_0723170 | 3300049572 | Bacteria | 822 |
| 521 | Ga0501037_0076922 | 3300049573 | Bacteria | 2422 |
| 522 | Ga0501038_0378055 | 3300049574 | Bacteria | 1099 |
| 523 | Ga0501039_0033578 | 3300049575 | Bacteria | 3957 |
| 524 | Ga0501039_0099444 | 3300049575 | Bacteria | 2270 |
| 525 | Ga0501039_0321423 | 3300049575 | Bacteria | 1216 |
| 526 | Ga0501040_0034798 | 3300049576 | Bacteria | 3413 |
| 527 | Ga0501040_0056693 | 3300049576 | Bacteria | 2689 |
| 528 | Ga0501040_0089450 | 3300049576 | Bacteria | 2139 |
| 529 | Ga0501041_0157312 | 3300049577 | Bacteria | 1420 |
| 530 | Ga0501042_0280217 | 3300049578 | Bacteria | 1204 |
| 531 | Ga0501042_0408150 | 3300049578 | Bacteria | 984 |
| 532 | Ga0501047_0511786 | 3300049581 | Bacteria | 1027 |
| 533 | Ga0501048_0621628 | 3300049582 | Bacteria | 775 |
| 534 | Ga0501071_0023010 | 3300049587 | Bacteria | 4348 |
| 535 | Ga0501071_0167759 | 3300049587 | Bacteria | 1643 |
| 536 | Ga0501071_0295921 | 3300049587 | Bacteria | 1226 |
| 537 | Ga0501072_0308408 | 3300049588 | Bacteria | 1258 |
| 538 | Ga0501072_0311199 | 3300049588 | Bacteria | 1252 |
| 539 | Ga0501073_0262171 | 3300049589 | Bacteria | 1193 |
| 540 | Ga0501074_0279833 | 3300049590 | Bacteria | 1186 |
| 541 | Ga0501075_0193962 | 3300049591 | Bacteria | 1549 |
| 542 | Ga0501075_0395566 | 3300049591 | Bacteria | 1053 |
| 543 | Ga0501075_0515485 | 3300049591 | Bacteria | 912 |
| 544 | Ga0501076_0077436 | 3300049592 | Bacteria | 2668 |
| 545 | Ga0501076_0241264 | 3300049592 | Bacteria | 1479 |
| 546 | Ga0501076_0496130 | 3300049592 | Bacteria | 1006 |
| 547 | Ga0501076_0574838 | 3300049592 | Bacteria | 929 |
| 548 | Ga0501077_0250255 | 3300049593 | Bacteria | 1127 |
| 549 | Ga0501079_0093630 | 3300049741 | Bacteria | 2328 |
| 550 | Ga0501079_0104327 | 3300049741 | Bacteria | 2199 |
| 551 | Ga0501079_0207438 | 3300049741 | Bacteria | 1530 |
| 552 | Ga0501079_0395934 | 3300049741 | Bacteria | 1083 |
| 553 | Ga0501080_0025686 | 3300049742 | Bacteria | 5470 |
| 554 | Ga0501081_0081318 | 3300049743 | Bacteria | 2269 |
| 555 | Ga0501081_0116531 | 3300049743 | Bacteria | 1899 |
| 556 | Ga0501083_0346345 | 3300049744 | Bacteria | 966 |
| 557 | Ga0501044_0078736 | 3300049823 | Bacteria | 3340 |
| 558 | Ga0501044_0533904 | 3300049823 | Bacteria | 1072 |
| 559 | Ga0501045_0077194 | 3300049824 | Bacteria | 2454 |
| 560 | Ga0501045_0363891 | 3300049824 | Bacteria | 1076 |
| 561 | nmdc:mga00v17_80631_c1 | 3300050491 | Bacteria | 2031 |
| 562 | nmdc:mga0yw44_183728_c1 | 3300050492 | Bacteria | 1377 |
| 563 | nmdc:mga0yw44_295541_c1 | 3300050492 | Bacteria | 1084 |
| 564 | nmdc:mga05p37_1436854_c1 | 3300050507 | Bacteria | 692 |
| 565 | nmdc:mga05p37_184608_c1 | 3300050507 | Bacteria | 2536 |
| 566 | nmdc:mga05p37_20460_c1 | 3300050507 | Bacteria | 8005 |
| 567 | nmdc:mga05p37_288999_c1 | 3300050507 | Bacteria | 1952 |
| 568 | nmdc:mga05p37_317643_c1 | 3300050507 | Bacteria | 1844 |
| 569 | nmdc:mga09592_249027_c1 | 3300050508 | Bacteria | 1540 |
| 570 | nmdc:mga09592_32587_c1 | 3300050508 | Bacteria | 4344 |
| 571 | nmdc:mga09592_369929_c1 | 3300050508 | Bacteria | 1240 |
| 572 | nmdc:mga0qj67_1748_c1 | 3300050509 | Bacteria | 15355 |
| 573 | nmdc:mga0qj67_758884_c1 | 3300050509 | Bacteria | 769 |
| 574 | nmdc:mga06r32_338752_c1 | 3300050510 | Bacteria | 1489 |
| 575 | nmdc:mga08y16_136335_c1 | 3300050511 | Bacteria | 2551 |
| 576 | nmdc:mga08y16_14692_c1 | 3300050511 | Bacteria | 8231 |
| 577 | nmdc:mga08y16_18396_c1 | 3300050511 | Bacteria | 7365 |
| 578 | nmdc:mga08y16_19504_c1 | 3300050511 | Bacteria | 7150 |
| 579 | nmdc:mga08y16_562077_c1 | 3300050511 | Bacteria | 1153 |
| 580 | nmdc:mga0n895_32457_c1 | 3300050512 | Bacteria | 5013 |
| 581 | nmdc:mga0n895_398793_c1 | 3300050512 | Bacteria | 1391 |
| 582 | nmdc:mga0n895_603084_c1 | 3300050512 | Bacteria | 1100 |
| 583 | nmdc:mga0rr50_18209_c1 | 3300050513 | Bacteria | 4712 |
| 584 | nmdc:mga08x19_171528_c1 | 3300050514 | Bacteria | 1478 |
| 585 | nmdc:mga0a205_26654_c1 | 3300050515 | Bacteria | 5514 |
| 586 | nmdc:mga0a205_657143_c1 | 3300050515 | Bacteria | 899 |
| 587 | nmdc:mga0a205_734599_c1 | 3300050515 | Bacteria | 836 |
| 588 | Ga0495601_0000753 | 3300053077 | Bacteria | 17457 |
| 589 | Ga0495601_0036882 | 3300053077 | Bacteria | 3055 |
| 590 | Ga0495612_0000027 | 3300053078 | Bacteria | 100974 |
| 591 | Ga0495612_0064078 | 3300053078 | Bacteria | 1525 |
| 592 | Ga0495655_0154576 | 3300053083 | Bacteria | 724 |
| 593 | Ga0500556_0002022 | 3300053104 | Bacteria | 7080 |
| 594 | Ga0500572_030482 | 3300053111 | Bacteria | 1500 |
| 595 | Ga0500614_000932 | 3300053123 | Bacteria | 7299 |
| 596 | Ga0500614_090043 | 3300053123 | Bacteria | 870 |
| 597 | Ga0500616_0012065 | 3300053153 | Bacteria | 5071 |
| 598 | Ga0500616_0019531 | 3300053153 | Bacteria | 3818 |
| 599 | Ga0500599_000801 | 3300053736 | Bacteria | 3463 |
| 600 | Ga0501084_0063809 | 3300054114 | Bacteria | 3084 |
| 601 | Ga0501084_0070381 | 3300054114 | Bacteria | 2929 |
| 602 | Ga0501084_0152319 | 3300054114 | Bacteria | 1949 |
| 603 | Ga0501084_0345799 | 3300054114 | Bacteria | 1256 |
| 604 | Ga0501082_0104020 | 3300060353 | Bacteria | 2456 |
| 605 | Ga0501082_0368783 | 3300060353 | Bacteria | 1252 |
| 606 | Ga0501082_0785517 | 3300060353 | Bacteria | 833 |
| 607 | Ga0501082_0927810 | 3300060353 | Bacteria | 761 |
| 608 | Ga0466962_0016276 | 3300061719 | Bacteria | 3586 |
| 609 | Ga0530510_0053449 | 3300061734 | Bacteria | 2919 |
| 610 | Ga0530510_0077060 | 3300061734 | Bacteria | 2423 |
| 611 | Ga0530510_0102179 | 3300061734 | Bacteria | 2096 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031548 | Ga0307408_100165598 | Ga0307408_1001655982 | 157 |
| 2 | 3300031731 | Ga0307405_10154718 | Ga0307405_101547182 | 157 |
| 3 | 3300031824 | Ga0307413_10111082 | Ga0307413_101110822 | 157 |
| 4 | 3300031852 | Ga0307410_10156305 | Ga0307410_101563052 | 157 |
| 5 | 3300031903 | Ga0307407_10514440 | Ga0307407_105144402 | 157 |
| 6 | 3300031911 | Ga0307412_10326837 | Ga0307412_103268372 | 157 |
| 7 | 3300031995 | Ga0307409_100318475 | Ga0307409_1003184752 | 157 |
| 8 | 3300032002 | Ga0307416_100025779 | Ga0307416_1000257792 | 157 |
| 9 | 3300032004 | Ga0307414_10166070 | Ga0307414_101660701 | 157 |
| 10 | 3300032126 | Ga0307415_100158262 | Ga0307415_1001582622 | 157 |
| 11 | 3300009093 | Ga0105240_10005215 | Ga0105240_100052158 | 167 |
| 12 | 3300028800 | Ga0265338_10019015 | Ga0265338_100190154 | 168 |
| 13 | 3300031251 | Ga0265327_10043362 | Ga0265327_100433622 | 168 |
| 14 | 3300031344 | Ga0265316_10287952 | Ga0265316_102879521 | 168 |
| 15 | 3300005614 | Ga0068856_100027346 | Ga0068856_1000273461 | 172 |
| 16 | 3300039437 | Ga0436365_0937302 | Ga0436365_0937302_391_957 | 174 |
| 17 | 3300005344 | Ga0070661_100472762 | Ga0070661_1004727621 | 175 |
| 18 | 3300025920 | Ga0207649_10385068 | Ga0207649_103850682 | 175 |
| 19 | 3300037418 | Ga0395900_0004132 | Ga0395900_0004132_10468_11037 | 177 |
| 20 | 3300037466 | Ga0395898_0001355 | Ga0395898_0001355_1586_2155 | 177 |
| 21 | 3300005366 | Ga0070659_100499268 | Ga0070659_1004992682 | 180 |
| 22 | 3300046680 | Ga0495646_0156088 | Ga0495646_0156088_635_1198 | 181 |
| 23 | 3300006175 | Ga0070712_100014849 | Ga0070712_1000148495 | 182 |
| 24 | 3300025898 | Ga0207692_10043707 | Ga0207692_100437072 | 182 |
| 25 | 3300048918 | Ga0496115_0000884 | Ga0496115_0000884_7854_8531 | 182 |
| 26 | 3300048918 | Ga0496115_0002240 | Ga0496115_0002240_7905_8582 | 182 |
| 27 | 3300005435 | Ga0070714_100063622 | Ga0070714_1000636223 | 183 |
| 28 | 3300005439 | Ga0070711_100361037 | Ga0070711_1003610372 | 183 |
| 29 | 3300025916 | Ga0207663_10261971 | Ga0207663_102619712 | 183 |
| 30 | 3300005439 | Ga0070711_100000637 | Ga0070711_1000006376 | 184 |
| 31 | 3300013308 | Ga0157375_10328203 | Ga0157375_103282032 | 184 |
| 32 | 3300025916 | Ga0207663_10000426 | Ga0207663_1000042615 | 184 |
| 33 | 3300046809 | Ga0495600_0419749 | Ga0495600_0419749_108_749 | 184 |
| 34 | 3300005458 | Ga0070681_10492504 | Ga0070681_104925042 | 185 |
| 35 | 3300025913 | Ga0207695_10003355 | Ga0207695_1000335510 | 185 |
| 36 | 3300009553 | Ga0105249_10358833 | Ga0105249_103588332 | 186 |
| 37 | 3300013307 | Ga0157372_10332688 | Ga0157372_103326882 | 186 |
| 38 | 3300017792 | Ga0163161_10306797 | Ga0163161_103067972 | 186 |
| 39 | 3300025903 | Ga0207680_10585902 | Ga0207680_105859022 | 186 |
| 40 | 3300026023 | Ga0207677_10391157 | Ga0207677_103911572 | 186 |
| 41 | 3300026089 | Ga0207648_10458510 | Ga0207648_104585102 | 186 |
| 42 | 3300037466 | Ga0395898_0099486 | Ga0395898_0099486_2113_2709 | 186 |
| 43 | 3300048904 | Ga0496101_0214032 | Ga0496101_0214032_682_1278 | 186 |
| 44 | 3300048906 | Ga0496103_0285036 | Ga0496103_0285036_185_781 | 186 |
| 45 | 3300048907 | Ga0496104_0055122 | Ga0496104_0055122_186_782 | 186 |
| 46 | 3300048907 | Ga0496104_0077971 | Ga0496104_0077971_880_1476 | 186 |
| 47 | 3300048907 | Ga0496104_0187817 | Ga0496104_0187817_344_940 | 186 |
| 48 | 3300048908 | Ga0496105_0003559 | Ga0496105_0003559_6273_6869 | 186 |
| 49 | 3300048908 | Ga0496105_0273581 | Ga0496105_0273581_319_915 | 186 |
| 50 | 3300048911 | Ga0496108_0094702 | Ga0496108_0094702_1438_2034 | 186 |
| 51 | 3300048911 | Ga0496108_0136637 | Ga0496108_0136637_624_1220 | 186 |
| 52 | 3300048911 | Ga0496108_0665723 | Ga0496108_0665723_179_775 | 186 |
| 53 | 3300048912 | Ga0496109_0063426 | Ga0496109_0063426_268_864 | 186 |
| 54 | 3300048912 | Ga0496109_0332912 | Ga0496109_0332912_342_938 | 186 |
| 55 | 3300048912 | Ga0496109_0547016 | Ga0496109_0547016_94_690 | 186 |
| 56 | 3300048913 | Ga0496110_0097240 | Ga0496110_0097240_811_1407 | 186 |
| 57 | 3300048914 | Ga0496111_0039272 | Ga0496111_0039272_2415_3011 | 186 |
| 58 | 3300048915 | Ga0496112_0004190 | Ga0496112_0004190_2665_3351 | 186 |
| 59 | 3300048915 | Ga0496112_0013818 | Ga0496112_0013818_1109_1705 | 186 |
| 60 | 3300048915 | Ga0496112_0018394 | Ga0496112_0018394_524_1120 | 186 |
| 61 | 3300048915 | Ga0496112_0020380 | Ga0496112_0020380_222_818 | 186 |
| 62 | 3300048916 | Ga0496113_0004436 | Ga0496113_0004436_68_664 | 186 |
| 63 | 3300048916 | Ga0496113_0452345 | Ga0496113_0452345_255_851 | 186 |
| 64 | 3300048917 | Ga0496114_0229683 | Ga0496114_0229683_418_1014 | 186 |
| 65 | 3300050512 | nmdc:mga0n895_398793_c1 | nmdc:mga0n895_398793_c1_132_728 | 186 |
| 66 | 3300031731 | Ga0307405_10372846 | Ga0307405_103728462 | 187 |
| 67 | 3300031852 | Ga0307410_10019041 | Ga0307410_100190413 | 187 |
| 68 | 3300032002 | Ga0307416_100119413 | Ga0307416_1001194132 | 187 |
| 69 | 3300032005 | Ga0307411_10194972 | Ga0307411_101949722 | 187 |
| 70 | 3300041451 | Ga0451791_1547596 | Ga0451791_1547596_237_869 | 187 |
| 71 | 3300005327 | Ga0070658_10195059 | Ga0070658_101950592 | 188 |
| 72 | 3300005339 | Ga0070660_100016882 | Ga0070660_1000168823 | 188 |
| 73 | 3300005981 | Ga0081538_10024027 | Ga0081538_100240272 | 188 |
| 74 | 3300025909 | Ga0207705_10156717 | Ga0207705_101567172 | 188 |
| 75 | 3300025919 | Ga0207657_10026411 | Ga0207657_100264114 | 188 |
| 76 | 3300037418 | Ga0395900_0260007 | Ga0395900_0260007_1036_1668 | 188 |
| 77 | 3300037466 | Ga0395898_0640488 | Ga0395898_0640488_197_829 | 188 |
| 78 | 3300037471 | Ga0395905_0210447 | Ga0395905_0210447_1159_1791 | 188 |
| 79 | 3300005535 | Ga0070684_100694064 | Ga0070684_1006940641 | 189 |
| 80 | 3300005981 | Ga0081538_10012803 | Ga0081538_100128033 | 189 |
| 81 | 3300045976 | Ga0466967_0026073 | Ga0466967_0026073_2310_2903 | 189 |
| 82 | 3300005339 | Ga0070660_100340631 | Ga0070660_1003406312 | 190 |
| 83 | 3300005345 | Ga0070692_10020142 | Ga0070692_100201423 | 190 |
| 84 | 3300005441 | Ga0070700_100615448 | Ga0070700_1006154481 | 190 |
| 85 | 3300005457 | Ga0070662_100023968 | Ga0070662_1000239682 | 190 |
| 86 | 3300005539 | Ga0068853_100111216 | Ga0068853_1001112162 | 190 |
| 87 | 3300005564 | Ga0070664_100115734 | Ga0070664_1001157342 | 190 |
| 88 | 3300005840 | Ga0068870_10080389 | Ga0068870_100803892 | 190 |
| 89 | 3300006846 | Ga0075430_100035065 | Ga0075430_1000350654 | 190 |
| 90 | 3300006880 | Ga0075429_100289649 | Ga0075429_1002896492 | 190 |
| 91 | 3300009098 | Ga0105245_10729136 | Ga0105245_107291362 | 190 |
| 92 | 3300025899 | Ga0207642_10137465 | Ga0207642_101374652 | 190 |
| 93 | 3300025919 | Ga0207657_10105455 | Ga0207657_101054552 | 190 |
| 94 | 3300025933 | Ga0207706_10022392 | Ga0207706_100223922 | 190 |
| 95 | 3300025938 | Ga0207704_10670769 | Ga0207704_106707691 | 190 |
| 96 | 3300025945 | Ga0207679_10262750 | Ga0207679_102627502 | 190 |
| 97 | 3300025981 | Ga0207640_10182474 | Ga0207640_101824741 | 190 |
| 98 | 3300026067 | Ga0207678_10025778 | Ga0207678_100257782 | 190 |
| 99 | 3300026118 | Ga0207675_100081792 | Ga0207675_1000817923 | 190 |
| 100 | 3300026121 | Ga0207683_10244549 | Ga0207683_102445492 | 190 |
| 101 | 3300028563 | Ga0265319_1000156 | Ga0265319_10001563 | 190 |
| 102 | 3300028573 | Ga0265334_10000001 | Ga0265334_10000001329 | 190 |
| 103 | 3300028666 | Ga0265336_10048781 | Ga0265336_100487812 | 190 |
| 104 | 3300028800 | Ga0265338_10106450 | Ga0265338_101064502 | 190 |
| 105 | 3300029957 | Ga0265324_10002904 | Ga0265324_100029042 | 190 |
| 106 | 3300031251 | Ga0265327_10085736 | Ga0265327_100857361 | 190 |
| 107 | 3300031824 | Ga0307413_10426122 | Ga0307413_104261222 | 190 |
| 108 | 3300032002 | Ga0307416_100317674 | Ga0307416_1003176742 | 190 |
| 109 | 3300035695 | Ga0373927_0503078 | Ga0373927_0503078_167_769 | 190 |
| 110 | 3300039437 | Ga0436365_1605536 | Ga0436365_1605536_194_790 | 190 |
| 111 | 3300044901 | Ga0466960_0101844 | Ga0466960_0101844_21_626 | 190 |
| 112 | 3300044901 | Ga0466960_0403036 | Ga0466960_0403036_69_674 | 190 |
| 113 | 3300049571 | Ga0501034_0024060 | Ga0501034_0024060_1074_1679 | 190 |
| 114 | 3300049576 | Ga0501040_0089450 | Ga0501040_0089450_129_728 | 190 |
| 115 | 3300049744 | Ga0501083_0346345 | Ga0501083_0346345_189_794 | 190 |
| 116 | 3300050508 | nmdc:mga09592_32587_c1 | nmdc:mga09592_32587_c1_450_1085 | 190 |
| 117 | 3300050509 | nmdc:mga0qj67_1748_c1 | nmdc:mga0qj67_1748_c1_12700_13296 | 190 |
| 118 | 3300005329 | Ga0070683_100259281 | Ga0070683_1002592812 | 191 |
| 119 | 3300005337 | Ga0070682_100615751 | Ga0070682_1006157511 | 191 |
| 120 | 3300005718 | Ga0068866_10155218 | Ga0068866_101552182 | 191 |
| 121 | 3300005937 | Ga0081455_10026759 | Ga0081455_100267592 | 191 |
| 122 | 3300006038 | Ga0075365_10316707 | Ga0075365_103167072 | 191 |
| 123 | 3300006051 | Ga0075364_10121055 | Ga0075364_101210552 | 191 |
| 124 | 3300009176 | Ga0105242_11035340 | Ga0105242_110353402 | 191 |
| 125 | 3300025944 | Ga0207661_10198665 | Ga0207661_101986652 | 191 |
| 126 | 3300026142 | Ga0207698_11134066 | Ga0207698_111340662 | 191 |
| 127 | 3300028800 | Ga0265338_10023150 | Ga0265338_100231508 | 191 |
| 128 | 3300031240 | Ga0265320_10006280 | Ga0265320_100062803 | 191 |
| 129 | 3300031344 | Ga0265316_10124026 | Ga0265316_101240262 | 191 |
| 130 | 3300031595 | Ga0265313_10059240 | Ga0265313_100592402 | 191 |
| 131 | 3300031711 | Ga0265314_10021410 | Ga0265314_100214102 | 191 |
| 132 | 3300035172 | Ga0373955_0432961 | Ga0373955_0432961_42_641 | 191 |
| 133 | 3300046500 | Ga0495596_0055423 | Ga0495596_0055423_558_1184 | 191 |
| 134 | 3300046615 | Ga0495656_0122157 | Ga0495656_0122157_386_1009 | 191 |
| 135 | 3300046674 | Ga0495588_0208380 | Ga0495588_0208380_189_791 | 191 |
| 136 | 3300047472 | Ga0495686_0338544 | Ga0495686_0338544_33_659 | 191 |
| 137 | 3300048914 | Ga0496111_0296368 | Ga0496111_0296368_369_995 | 191 |
| 138 | 3300049742 | Ga0501080_0025686 | Ga0501080_0025686_1893_2492 | 191 |
| 139 | 3300050492 | nmdc:mga0yw44_295541_c1 | nmdc:mga0yw44_295541_c1_111_737 | 191 |
| 140 | 3300009094 | Ga0111539_10905237 | Ga0111539_109052372 | 192 |
| 141 | 3300013297 | Ga0157378_10708953 | Ga0157378_107089532 | 192 |
| 142 | 3300041460 | Ga0451802_1160422 | Ga0451802_1160422_590_1198 | 192 |
| 143 | 3300044901 | Ga0466960_0000858 | Ga0466960_0000858_494_1105 | 192 |
| 144 | 3300045976 | Ga0466967_0562097 | Ga0466967_0562097_211_810 | 192 |
| 145 | 3300046471 | Ga0495650_0000070 | Ga0495650_0000070_74389_74997 | 192 |
| 146 | 3300048914 | Ga0496111_0700608 | Ga0496111_0700608_26_664 | 192 |
| 147 | 3300050511 | nmdc:mga08y16_562077_c1 | nmdc:mga08y16_562077_c1_371_973 | 192 |
| 148 | 3300053077 | Ga0495601_0036882 | Ga0495601_0036882_1000_1701 | 192 |
| 149 | 3300053111 | Ga0500572_030482 | Ga0500572_030482_282_893 | 192 |
| 150 | 3300053153 | Ga0500616_0012065 | Ga0500616_0012065_2072_2680 | 192 |
| 151 | 3300005327 | Ga0070658_10220464 | Ga0070658_102204642 | 193 |
| 152 | 3300005328 | Ga0070676_10196589 | Ga0070676_101965891 | 193 |
| 153 | 3300005339 | Ga0070660_100224350 | Ga0070660_1002243502 | 193 |
| 154 | 3300005341 | Ga0070691_10024194 | Ga0070691_100241943 | 193 |
| 155 | 3300005347 | Ga0070668_100013689 | Ga0070668_1000136891 | 193 |
| 156 | 3300005366 | Ga0070659_100140687 | Ga0070659_1001406872 | 193 |
| 157 | 3300005456 | Ga0070678_100477015 | Ga0070678_1004770152 | 193 |
| 158 | 3300005456 | Ga0070678_100822723 | Ga0070678_1008227231 | 193 |
| 159 | 3300005457 | Ga0070662_100010934 | Ga0070662_1000109341 | 193 |
| 160 | 3300005546 | Ga0070696_100104510 | Ga0070696_1001045102 | 193 |
| 161 | 3300005719 | Ga0068861_100115803 | Ga0068861_1001158032 | 193 |
| 162 | 3300006846 | Ga0075430_100746802 | Ga0075430_1007468022 | 193 |
| 163 | 3300009147 | Ga0114129_11020040 | Ga0114129_110200402 | 193 |
| 164 | 3300009147 | Ga0114129_11684300 | Ga0114129_116843002 | 193 |
| 165 | 3300017792 | Ga0163161_10261693 | Ga0163161_102616932 | 193 |
| 166 | 3300025901 | Ga0207688_10163538 | Ga0207688_101635382 | 193 |
| 167 | 3300025907 | Ga0207645_10061122 | Ga0207645_100611223 | 193 |
| 168 | 3300025908 | Ga0207643_10329431 | Ga0207643_103294312 | 193 |
| 169 | 3300025909 | Ga0207705_10240910 | Ga0207705_102409102 | 193 |
| 170 | 3300025919 | Ga0207657_10227717 | Ga0207657_102277172 | 193 |
| 171 | 3300025927 | Ga0207687_10011450 | Ga0207687_100114504 | 193 |
| 172 | 3300025932 | Ga0207690_10110930 | Ga0207690_101109302 | 193 |
| 173 | 3300025933 | Ga0207706_10002857 | Ga0207706_100028576 | 193 |
| 174 | 3300025961 | Ga0207712_10117764 | Ga0207712_101177642 | 193 |
| 175 | 3300025972 | Ga0207668_10016678 | Ga0207668_100166782 | 193 |
| 176 | 3300026118 | Ga0207675_100016374 | Ga0207675_1000163744 | 193 |
| 177 | 3300031548 | Ga0307408_100225459 | Ga0307408_1002254592 | 193 |
| 178 | 3300031852 | Ga0307410_10157933 | Ga0307410_101579332 | 193 |
| 179 | 3300031911 | Ga0307412_10321641 | Ga0307412_103216412 | 193 |
| 180 | 3300031995 | Ga0307409_100198838 | Ga0307409_1001988382 | 193 |
| 181 | 3300032002 | Ga0307416_100005809 | Ga0307416_1000058099 | 193 |
| 182 | 3300032126 | Ga0307415_100160490 | Ga0307415_1001604902 | 193 |
| 183 | 3300032126 | Ga0307415_100433675 | Ga0307415_1004336752 | 193 |
| 184 | 3300038443 | Ga0395901_0373622 | Ga0395901_0373622_710_1318 | 193 |
| 185 | 3300046491 | Ga0495584_0102493 | Ga0495584_0102493_181_789 | 193 |
| 186 | 3300046538 | Ga0495609_0194671 | Ga0495609_0194671_40_648 | 193 |
| 187 | 3300046616 | Ga0495668_0255615 | Ga0495668_0255615_196_804 | 193 |
| 188 | 3300048904 | Ga0496101_0003901 | Ga0496101_0003901_5088_5714 | 193 |
| 189 | 3300048909 | Ga0496106_0001105 | Ga0496106_0001105_6356_6982 | 193 |
| 190 | 3300048910 | Ga0496107_0006169 | Ga0496107_0006169_1594_2220 | 193 |
| 191 | 3300048918 | Ga0496115_0005827 | Ga0496115_0005827_3685_4311 | 193 |
| 192 | 3300049572 | Ga0501036_0723170 | Ga0501036_0723170_95_703 | 193 |
| 193 | 3300049577 | Ga0501041_0157312 | Ga0501041_0157312_195_803 | 193 |
| 194 | 3300049578 | Ga0501042_0408150 | Ga0501042_0408150_222_830 | 193 |
| 195 | 3300049591 | Ga0501075_0395566 | Ga0501075_0395566_256_864 | 193 |
| 196 | 3300049592 | Ga0501076_0496130 | Ga0501076_0496130_184_792 | 193 |
| 197 | 3300049741 | Ga0501079_0395934 | Ga0501079_0395934_156_764 | 193 |
| 198 | 3300050507 | nmdc:mga05p37_1436854_c1 | nmdc:mga05p37_1436854_c1_67_675 | 193 |
| 199 | 3300050507 | nmdc:mga05p37_288999_c1 | nmdc:mga05p37_288999_c1_1182_1790 | 193 |
| 200 | 3300050511 | nmdc:mga08y16_136335_c1 | nmdc:mga08y16_136335_c1_717_1325 | 193 |
| 201 | 3300050515 | nmdc:mga0a205_657143_c1 | nmdc:mga0a205_657143_c1_113_721 | 193 |
| 202 | 3300054114 | Ga0501084_0152319 | Ga0501084_0152319_1293_1901 | 193 |
| 203 | 3300054114 | Ga0501084_0345799 | Ga0501084_0345799_184_792 | 193 |
| 204 | 3300060353 | Ga0501082_0785517 | Ga0501082_0785517_26_634 | 193 |
| 205 | 3300061734 | Ga0530510_0053449 | Ga0530510_0053449_1491_2099 | 193 |
| 206 | 3300041505 | Ga0451849_0387124 | Ga0451849_0387124_65_685 | 194 |
| 207 | 3300044694 | Ga0466963_0221203 | Ga0466963_0221203_447_1088 | 194 |
| 208 | 3300045976 | Ga0466967_0020897 | Ga0466967_0020897_796_1425 | 194 |
| 209 | 3300045976 | Ga0466967_0282259 | Ga0466967_0282259_300_941 | 194 |
| 210 | 3300046463 | Ga0495653_0010808 | Ga0495653_0010808_4552_5286 | 194 |
| 211 | 3300005435 | Ga0070714_100491131 | Ga0070714_1004911312 | 195 |
| 212 | 3300005937 | Ga0081455_10142520 | Ga0081455_101425202 | 195 |
| 213 | 3300005983 | Ga0081540_1023644 | Ga0081540_10236443 | 195 |
| 214 | 3300013296 | Ga0157374_10957726 | Ga0157374_109577261 | 195 |
| 215 | 3300025944 | Ga0207661_10416085 | Ga0207661_104160852 | 195 |
| 216 | 3300026078 | Ga0207702_10270008 | Ga0207702_102700082 | 195 |
| 217 | 3300026116 | Ga0207674_10192810 | Ga0207674_101928102 | 195 |
| 218 | 3300031824 | Ga0307413_10711094 | Ga0307413_107110941 | 195 |
| 219 | 3300038443 | Ga0395901_1020923 | Ga0395901_1020923_137_739 | 195 |
| 220 | 3300048904 | Ga0496101_0275240 | Ga0496101_0275240_386_988 | 195 |
| 221 | 3300048905 | Ga0496102_0208652 | Ga0496102_0208652_1180_1782 | 195 |
| 222 | 3300048912 | Ga0496109_0850933 | Ga0496109_0850933_83_685 | 195 |
| 223 | 3300049573 | Ga0501037_0076922 | Ga0501037_0076922_463_1068 | 195 |
| 224 | 3300049575 | Ga0501039_0033578 | Ga0501039_0033578_2623_3228 | 195 |
| 225 | 3300049575 | Ga0501039_0321423 | Ga0501039_0321423_281_886 | 195 |
| 226 | 3300049576 | Ga0501040_0056693 | Ga0501040_0056693_1374_1979 | 195 |
| 227 | 3300049578 | Ga0501042_0280217 | Ga0501042_0280217_462_1067 | 195 |
| 228 | 3300049582 | Ga0501048_0621628 | Ga0501048_0621628_140_745 | 195 |
| 229 | 3300049587 | Ga0501071_0023010 | Ga0501071_0023010_3104_3709 | 195 |
| 230 | 3300049587 | Ga0501071_0295921 | Ga0501071_0295921_598_1203 | 195 |
| 231 | 3300049588 | Ga0501072_0308408 | Ga0501072_0308408_313_918 | 195 |
| 232 | 3300049589 | Ga0501073_0262171 | Ga0501073_0262171_402_1007 | 195 |
| 233 | 3300049590 | Ga0501074_0279833 | Ga0501074_0279833_355_960 | 195 |
| 234 | 3300049591 | Ga0501075_0515485 | Ga0501075_0515485_258_863 | 195 |
| 235 | 3300049592 | Ga0501076_0077436 | Ga0501076_0077436_1062_1667 | 195 |
| 236 | 3300049592 | Ga0501076_0241264 | Ga0501076_0241264_776_1381 | 195 |
| 237 | 3300049593 | Ga0501077_0250255 | Ga0501077_0250255_232_837 | 195 |
| 238 | 3300049741 | Ga0501079_0104327 | Ga0501079_0104327_761_1366 | 195 |
| 239 | 3300049741 | Ga0501079_0207438 | Ga0501079_0207438_440_1045 | 195 |
| 240 | 3300049743 | Ga0501081_0116531 | Ga0501081_0116531_1195_1800 | 195 |
| 241 | 3300049823 | Ga0501044_0533904 | Ga0501044_0533904_288_893 | 195 |
| 242 | 3300049824 | Ga0501045_0077194 | Ga0501045_0077194_955_1563 | 195 |
| 243 | 3300049824 | Ga0501045_0363891 | Ga0501045_0363891_251_856 | 195 |
| 244 | 3300054114 | Ga0501084_0063809 | Ga0501084_0063809_399_1004 | 195 |
| 245 | 3300060353 | Ga0501082_0104020 | Ga0501082_0104020_516_1121 | 195 |
| 246 | 3300060353 | Ga0501082_0368783 | Ga0501082_0368783_261_866 | 195 |
| 247 | 3300060353 | Ga0501082_0927810 | Ga0501082_0927810_29_637 | 195 |
| 248 | 3300061734 | Ga0530510_0102179 | Ga0530510_0102179_151_756 | 195 |
| 249 | 3300005439 | Ga0070711_100338266 | Ga0070711_1003382662 | 196 |
| 250 | 3300005614 | Ga0068856_100037898 | Ga0068856_1000378982 | 196 |
| 251 | 3300025915 | Ga0207693_10084407 | Ga0207693_100844073 | 196 |
| 252 | 3300025939 | Ga0207665_10120461 | Ga0207665_101204612 | 196 |
| 253 | 3300026078 | Ga0207702_10229018 | Ga0207702_102290182 | 196 |
| 254 | 3300028563 | Ga0265319_1000052 | Ga0265319_100005218 | 196 |
| 255 | 3300039437 | Ga0436365_0936558 | Ga0436365_0936558_56_682 | 196 |
| 256 | 3300044901 | Ga0466960_0015274 | Ga0466960_0015274_1660_2319 | 196 |
| 257 | 3300050512 | nmdc:mga0n895_603084_c1 | nmdc:mga0n895_603084_c1_93_740 | 196 |
| 258 | 3300053077 | Ga0495601_0000753 | Ga0495601_0000753_2679_3413 | 196 |
| 259 | 3300005444 | Ga0070694_100097947 | Ga0070694_1000979472 | 197 |
| 260 | 3300005548 | Ga0070665_100449684 | Ga0070665_1004496842 | 197 |
| 261 | 3300027907 | Ga0207428_10010901 | Ga0207428_100109012 | 197 |
| 262 | 3300028379 | Ga0268266_10072375 | Ga0268266_100723752 | 197 |
| 263 | 3300046543 | Ga0495645_0000018 | Ga0495645_0000018_43785_44465 | 197 |
| 264 | 3300046678 | Ga0495599_0061249 | Ga0495599_0061249_1128_1808 | 197 |
| 265 | 3300049588 | Ga0501072_0311199 | Ga0501072_0311199_346_972 | 197 |
| 266 | 3300050507 | nmdc:mga05p37_20460_c1 | nmdc:mga05p37_20460_c1_6318_6944 | 197 |
| 267 | 3300050509 | nmdc:mga0qj67_758884_c1 | nmdc:mga0qj67_758884_c1_74_727 | 197 |
| 268 | 3300050511 | nmdc:mga08y16_14692_c1 | nmdc:mga08y16_14692_c1_570_1196 | 197 |
| 269 | 3300053083 | Ga0495655_0154576 | Ga0495655_0154576_23_649 | 197 |
| 270 | 3300009098 | Ga0105245_10020122 | Ga0105245_100201222 | 198 |
| 271 | 3300009553 | Ga0105249_10287682 | Ga0105249_102876822 | 198 |
| 272 | 3300010375 | Ga0105239_10073153 | Ga0105239_100731533 | 198 |
| 273 | 3300013306 | Ga0163162_10714891 | Ga0163162_107148912 | 198 |
| 274 | 3300013307 | Ga0157372_10176447 | Ga0157372_101764472 | 198 |
| 275 | 3300005365 | Ga0070688_100000506 | Ga0070688_1000005066 | 199 |
| 276 | 3300005466 | Ga0070685_10005485 | Ga0070685_100054853 | 199 |
| 277 | 3300005981 | Ga0081538_10021555 | Ga0081538_100215552 | 199 |
| 278 | 3300009101 | Ga0105247_10638487 | Ga0105247_106384871 | 199 |
| 279 | 3300009147 | Ga0114129_10304851 | Ga0114129_103048512 | 199 |
| 280 | 3300026078 | Ga0207702_10446887 | Ga0207702_104468872 | 199 |
| 281 | 3300027907 | Ga0207428_10066950 | Ga0207428_100669502 | 199 |
| 282 | 3300031901 | Ga0307406_10191272 | Ga0307406_101912722 | 199 |
| 283 | 3300032004 | Ga0307414_10238048 | Ga0307414_102380482 | 199 |
| 284 | 3300032126 | Ga0307415_100453133 | Ga0307415_1004531332 | 199 |
| 285 | 3300032126 | Ga0307415_100600517 | Ga0307415_1006005172 | 199 |
| 286 | 3300037853 | Ga0436364_0969936 | Ga0436364_0969936_2936_3634 | 199 |
| 287 | 3300048906 | Ga0496103_0336148 | Ga0496103_0336148_171_809 | 199 |
| 288 | 3300048924 | Ga0496121_0049677 | Ga0496121_0049677_1605_2234 | 199 |
| 289 | 3300050507 | nmdc:mga05p37_317643_c1 | nmdc:mga05p37_317643_c1_243_860 | 199 |
| 290 | 3300050508 | nmdc:mga09592_249027_c1 | nmdc:mga09592_249027_c1_264_881 | 199 |
| 291 | 3300050511 | nmdc:mga08y16_18396_c1 | nmdc:mga08y16_18396_c1_2798_3415 | 199 |
| 292 | 3300003203 | JGI25406J46586_10006137 | JGI25406J46586_100061373 | 200 |
| 293 | 3300005328 | Ga0070676_10163690 | Ga0070676_101636902 | 200 |
| 294 | 3300005345 | Ga0070692_10449222 | Ga0070692_104492221 | 200 |
| 295 | 3300005535 | Ga0070684_100026315 | Ga0070684_1000263152 | 200 |
| 296 | 3300005548 | Ga0070665_100206139 | Ga0070665_1002061392 | 200 |
| 297 | 3300005843 | Ga0068860_100286477 | Ga0068860_1002864772 | 200 |
| 298 | 3300005985 | Ga0081539_10013302 | Ga0081539_100133026 | 200 |
| 299 | 3300006844 | Ga0075428_100973581 | Ga0075428_1009735812 | 200 |
| 300 | 3300009147 | Ga0114129_11386346 | Ga0114129_113863461 | 200 |
| 301 | 3300013297 | Ga0157378_10535487 | Ga0157378_105354872 | 200 |
| 302 | 3300013308 | Ga0157375_10555737 | Ga0157375_105557372 | 200 |
| 303 | 3300025933 | Ga0207706_10442347 | Ga0207706_104423472 | 200 |
| 304 | 3300025972 | Ga0207668_10387104 | Ga0207668_103871042 | 200 |
| 305 | 3300026023 | Ga0207677_10072931 | Ga0207677_100729312 | 200 |
| 306 | 3300026067 | Ga0207678_10198047 | Ga0207678_101980472 | 200 |
| 307 | 3300026075 | Ga0207708_10169024 | Ga0207708_101690243 | 200 |
| 308 | 3300026142 | Ga0207698_10294775 | Ga0207698_102947752 | 200 |
| 309 | 3300028379 | Ga0268266_10153628 | Ga0268266_101536282 | 200 |
| 310 | 3300028381 | Ga0268264_10414013 | Ga0268264_104140132 | 200 |
| 311 | 3300031595 | Ga0265313_10049882 | Ga0265313_100498822 | 200 |
| 312 | 3300037466 | Ga0395898_0078872 | Ga0395898_0078872_1779_2414 | 200 |
| 313 | 3300038443 | Ga0395901_0208316 | Ga0395901_0208316_1060_1695 | 200 |
| 314 | 3300038443 | Ga0395901_0407152 | Ga0395901_0407152_364_999 | 200 |
| 315 | 3300039437 | Ga0436365_0653290 | Ga0436365_0653290_1943_2623 | 200 |
| 316 | 3300042011 | Ga0439454_008223 | Ga0439454_008223_96_713 | 200 |
| 317 | 3300042461 | Ga0439460_0100331 | Ga0439460_0100331_32_649 | 200 |
| 318 | 3300042530 | Ga0450916_005405 | Ga0450916_005405_203_820 | 200 |
| 319 | 3300042993 | Ga0439440_0028562 | Ga0439440_0028562_639_1256 | 200 |
| 320 | 3300044693 | Ga0466961_0227405 | Ga0466961_0227405_101_781 | 200 |
| 321 | 3300044719 | Ga0466971_0007767 | Ga0466971_0007767_2133_2813 | 200 |
| 322 | 3300045976 | Ga0466967_0039131 | Ga0466967_0039131_605_1231 | 200 |
| 323 | 3300048915 | Ga0496112_0054668 | Ga0496112_0054668_1967_2602 | 200 |
| 324 | 3300048922 | Ga0496119_0041609 | Ga0496119_0041609_488_1126 | 200 |
| 325 | 3300050515 | nmdc:mga0a205_734599_c1 | nmdc:mga0a205_734599_c1_74_691 | 200 |
| 326 | 3300061719 | Ga0466962_0016276 | Ga0466962_0016276_145_825 | 200 |
| 327 | 3300005329 | Ga0070683_100344845 | Ga0070683_1003448451 | 201 |
| 328 | 3300005439 | Ga0070711_100430001 | Ga0070711_1004300011 | 201 |
| 329 | 3300005543 | Ga0070672_100000023 | Ga0070672_1000000238 | 201 |
| 330 | 3300005981 | Ga0081538_10010471 | Ga0081538_100104719 | 201 |
| 331 | 3300025940 | Ga0207691_10008775 | Ga0207691_100087753 | 201 |
| 332 | 3300025944 | Ga0207661_10293973 | Ga0207661_102939732 | 201 |
| 333 | 3300028556 | Ga0265337_1040661 | Ga0265337_10406612 | 201 |
| 334 | 3300031711 | Ga0265314_10397654 | Ga0265314_103976541 | 201 |
| 335 | 3300038443 | Ga0395901_0165783 | Ga0395901_0165783_362_985 | 201 |
| 336 | 3300042016 | Ga0439463_029422 | Ga0439463_029422_574_1215 | 201 |
| 337 | 3300044694 | Ga0466963_0088040 | Ga0466963_0088040_513_1190 | 201 |
| 338 | 3300045976 | Ga0466967_0159971 | Ga0466967_0159971_1394_2035 | 201 |
| 339 | 3300047321 | Ga0495676_0129801 | Ga0495676_0129801_1020_1679 | 201 |
| 340 | 3300005548 | Ga0070665_100000159 | Ga0070665_10000015923 | 202 |
| 341 | 3300005614 | Ga0068856_100006496 | Ga0068856_1000064963 | 202 |
| 342 | 3300005842 | Ga0068858_100000049 | Ga0068858_100000049120 | 202 |
| 343 | 3300026035 | Ga0207703_10000132 | Ga0207703_1000013287 | 202 |
| 344 | 3300026041 | Ga0207639_10045110 | Ga0207639_100451103 | 202 |
| 345 | 3300026078 | Ga0207702_10018367 | Ga0207702_100183672 | 202 |
| 346 | 3300028379 | Ga0268266_10000023 | Ga0268266_10000023243 | 202 |
| 347 | 3300031903 | Ga0307407_10107289 | Ga0307407_101072892 | 202 |
| 348 | 3300031995 | Ga0307409_100480415 | Ga0307409_1004804152 | 202 |
| 349 | 3300032002 | Ga0307416_100235550 | Ga0307416_1002355502 | 202 |
| 350 | 3300032002 | Ga0307416_100437015 | Ga0307416_1004370152 | 202 |
| 351 | 3300032004 | Ga0307414_10346024 | Ga0307414_103460242 | 202 |
| 352 | 3300032126 | Ga0307415_100123900 | Ga0307415_1001239002 | 202 |
| 353 | 3300032126 | Ga0307415_100155670 | Ga0307415_1001556702 | 202 |
| 354 | 3300037312 | Ga0395899_0061282 | Ga0395899_0061282_799_1437 | 202 |
| 355 | 3300037418 | Ga0395900_0008401 | Ga0395900_0008401_748_1386 | 202 |
| 356 | 3300037466 | Ga0395898_0011175 | Ga0395898_0011175_8057_8695 | 202 |
| 357 | 3300037466 | Ga0395898_0637334 | Ga0395898_0637334_172_825 | 202 |
| 358 | 3300038443 | Ga0395901_0024113 | Ga0395901_0024113_655_1293 | 202 |
| 359 | 3300044706 | Ga0466964_0052157 | Ga0466964_0052157_163_786 | 202 |
| 360 | 3300044706 | Ga0466964_0066709 | Ga0466964_0066709_121_750 | 202 |
| 361 | 3300044765 | Ga0466970_0084714 | Ga0466970_0084714_970_1623 | 202 |
| 362 | 3300045976 | Ga0466967_0018339 | Ga0466967_0018339_4058_4687 | 202 |
| 363 | 3300045976 | Ga0466967_0023330 | Ga0466967_0023330_3948_4571 | 202 |
| 364 | 3300046461 | Ga0495641_0000012 | Ga0495641_0000012_125024_125689 | 202 |
| 365 | 3300046543 | Ga0495645_0177395 | Ga0495645_0177395_388_1053 | 202 |
| 366 | 3300046694 | Ga0495649_0005045 | Ga0495649_0005045_2870_3535 | 202 |
| 367 | 3300047322 | Ga0495680_0000255 | Ga0495680_0000255_41313_41978 | 202 |
| 368 | 3300048906 | Ga0496103_0296223 | Ga0496103_0296223_283_912 | 202 |
| 369 | 3300048911 | Ga0496108_0006693 | Ga0496108_0006693_708_1388 | 202 |
| 370 | 3300048912 | Ga0496109_0000087 | Ga0496109_0000087_85166_85846 | 202 |
| 371 | 3300048915 | Ga0496112_0479281 | Ga0496112_0479281_420_1049 | 202 |
| 372 | 3300053123 | Ga0500614_000932 | Ga0500614_000932_5398_6063 | 202 |
| 373 | 3300005438 | Ga0070701_10198296 | Ga0070701_101982962 | 203 |
| 374 | 3300005441 | Ga0070700_100023124 | Ga0070700_1000231242 | 203 |
| 375 | 3300005543 | Ga0070672_100327182 | Ga0070672_1003271822 | 203 |
| 376 | 3300005578 | Ga0068854_100283672 | Ga0068854_1002836722 | 203 |
| 377 | 3300005615 | Ga0070702_100490974 | Ga0070702_1004909742 | 203 |
| 378 | 3300005719 | Ga0068861_100091020 | Ga0068861_1000910203 | 203 |
| 379 | 3300006038 | Ga0075365_10033335 | Ga0075365_100333352 | 203 |
| 380 | 3300006844 | Ga0075428_101256622 | Ga0075428_1012566222 | 203 |
| 381 | 3300006881 | Ga0068865_100341796 | Ga0068865_1003417961 | 203 |
| 382 | 3300009094 | Ga0111539_10210067 | Ga0111539_102100672 | 203 |
| 383 | 3300009094 | Ga0111539_10720937 | Ga0111539_107209372 | 203 |
| 384 | 3300009098 | Ga0105245_10325787 | Ga0105245_103257872 | 203 |
| 385 | 3300014326 | Ga0157380_10103157 | Ga0157380_101031573 | 203 |
| 386 | 3300025901 | Ga0207688_10272294 | Ga0207688_102722942 | 203 |
| 387 | 3300025919 | Ga0207657_10117623 | Ga0207657_101176233 | 203 |
| 388 | 3300025940 | Ga0207691_10049622 | Ga0207691_100496222 | 203 |
| 389 | 3300025972 | Ga0207668_10124131 | Ga0207668_101241312 | 203 |
| 390 | 3300026075 | Ga0207708_10044509 | Ga0207708_100445094 | 203 |
| 391 | 3300035117 | Ga0373953_0022097 | Ga0373953_0022097_939_1586 | 203 |
| 392 | 3300046517 | Ga0495630_0001225 | Ga0495630_0001225_5372_6106 | 203 |
| 393 | 3300046675 | Ga0495657_0000016 | Ga0495657_0000016_127533_128267 | 203 |
| 394 | 3300046680 | Ga0495646_0095284 | Ga0495646_0095284_938_1672 | 203 |
| 395 | 3300048903 | Ga0496100_0012136 | Ga0496100_0012136_2158_2835 | 203 |
| 396 | 3300048907 | Ga0496104_0248544 | Ga0496104_0248544_584_1231 | 203 |
| 397 | 3300048908 | Ga0496105_0078327 | Ga0496105_0078327_43_690 | 203 |
| 398 | 3300048914 | Ga0496111_0493745 | Ga0496111_0493745_117_764 | 203 |
| 399 | 3300048924 | Ga0496121_0000817 | Ga0496121_0000817_11813_12472 | 203 |
| 400 | 3300049571 | Ga0501034_0242325 | Ga0501034_0242325_786_1436 | 203 |
| 401 | 3300050491 | nmdc:mga00v17_80631_c1 | nmdc:mga00v17_80631_c1_830_1474 | 203 |
| 402 | 3300053104 | Ga0500556_0002022 | Ga0500556_0002022_1578_2213 | 203 |
| 403 | 3300053123 | Ga0500614_090043 | Ga0500614_090043_129_788 | 203 |
| 404 | 3300053153 | Ga0500616_0019531 | Ga0500616_0019531_1921_2556 | 203 |
| 405 | 3300053736 | Ga0500599_000801 | Ga0500599_000801_163_798 | 203 |
| 406 | 3300005843 | Ga0068860_100090770 | Ga0068860_1000907702 | 204 |
| 407 | 3300005981 | Ga0081538_10001947 | Ga0081538_1000194713 | 204 |
| 408 | 3300006028 | Ga0070717_10350507 | Ga0070717_103505072 | 204 |
| 409 | 3300006038 | Ga0075365_10178610 | Ga0075365_101786102 | 204 |
| 410 | 3300013308 | Ga0157375_10004774 | Ga0157375_1000477411 | 204 |
| 411 | 3300044694 | Ga0466963_0022333 | Ga0466963_0022333_1627_2259 | 204 |
| 412 | 3300045976 | Ga0466967_0004908 | Ga0466967_0004908_4600_5229 | 204 |
| 413 | 3300045976 | Ga0466967_0186887 | Ga0466967_0186887_303_932 | 204 |
| 414 | 3300046514 | Ga0495618_0000108 | Ga0495618_0000108_24894_25625 | 204 |
| 415 | 3300046616 | Ga0495668_0118038 | Ga0495668_0118038_696_1358 | 204 |
| 416 | 3300046794 | Ga0495589_0152696 | Ga0495589_0152696_79_741 | 204 |
| 417 | 3300048925 | Ga0496122_0330594 | Ga0496122_0330594_91_735 | 204 |
| 418 | 3300049571 | Ga0501034_0018693 | Ga0501034_0018693_3396_4052 | 204 |
| 419 | 3300049581 | Ga0501047_0511786 | Ga0501047_0511786_336_992 | 204 |
| 420 | 3300049823 | Ga0501044_0078736 | Ga0501044_0078736_1126_1782 | 204 |
| 421 | 3300050492 | nmdc:mga0yw44_183728_c1 | nmdc:mga0yw44_183728_c1_466_1116 | 204 |
| 422 | 3300053078 | Ga0495612_0000027 | Ga0495612_0000027_24839_25573 | 204 |
| 423 | 3300003373 | JGI25407J50210_10000018 | JGI25407J50210_1000001813 | 205 |
| 424 | 3300005614 | Ga0068856_100226642 | Ga0068856_1002266422 | 205 |
| 425 | 3300005981 | Ga0081538_10000165 | Ga0081538_1000016574 | 205 |
| 426 | 3300005981 | Ga0081538_10003490 | Ga0081538_100034905 | 205 |
| 427 | 3300005981 | Ga0081538_10006287 | Ga0081538_100062875 | 205 |
| 428 | 3300005981 | Ga0081538_10160474 | Ga0081538_101604742 | 205 |
| 429 | 3300009147 | Ga0114129_10417395 | Ga0114129_104173953 | 205 |
| 430 | 3300031731 | Ga0307405_10014328 | Ga0307405_100143283 | 205 |
| 431 | 3300031901 | Ga0307406_10024016 | Ga0307406_100240162 | 205 |
| 432 | 3300031903 | Ga0307407_10301999 | Ga0307407_103019991 | 205 |
| 433 | 3300032002 | Ga0307416_100090409 | Ga0307416_1000904092 | 205 |
| 434 | 3300032004 | Ga0307414_10306858 | Ga0307414_103068582 | 205 |
| 435 | 3300032005 | Ga0307411_10142280 | Ga0307411_101422802 | 205 |
| 436 | 3300032126 | Ga0307415_100066254 | Ga0307415_1000662542 | 205 |
| 437 | 3300035725 | Ga0373947_0044116 | Ga0373947_0044116_351_977 | 205 |
| 438 | 3300046455 | Ga0495603_0441358 | Ga0495603_0441358_59_685 | 205 |
| 439 | 3300046459 | Ga0495629_0055393 | Ga0495629_0055393_807_1460 | 205 |
| 440 | 3300046461 | Ga0495641_0016616 | Ga0495641_0016616_1327_1953 | 205 |
| 441 | 3300046461 | Ga0495641_0068063 | Ga0495641_0068063_142_795 | 205 |
| 442 | 3300046516 | Ga0495628_0440568 | Ga0495628_0440568_278_931 | 205 |
| 443 | 3300046529 | Ga0495652_0416400 | Ga0495652_0416400_31_684 | 205 |
| 444 | 3300046536 | Ga0495587_0005615 | Ga0495587_0005615_139_792 | 205 |
| 445 | 3300046543 | Ga0495645_0036743 | Ga0495645_0036743_2332_2985 | 205 |
| 446 | 3300046559 | Ga0495667_0006376 | Ga0495667_0006376_4764_5417 | 205 |
| 447 | 3300046642 | Ga0495634_0345172 | Ga0495634_0345172_25_678 | 205 |
| 448 | 3300047321 | Ga0495676_0067014 | Ga0495676_0067014_206_832 | 205 |
| 449 | 3300047322 | Ga0495680_0010505 | Ga0495680_0010505_139_792 | 205 |
| 450 | 3300047471 | Ga0495684_0150504 | Ga0495684_0150504_815_1468 | 205 |
| 451 | 3300048088 | Ga0495602_0075285 | Ga0495602_0075285_624_1277 | 205 |
| 452 | 3300048907 | Ga0496104_0432968 | Ga0496104_0432968_137_790 | 205 |
| 453 | 3300048908 | Ga0496105_0186240 | Ga0496105_0186240_175_801 | 205 |
| 454 | 3300048914 | Ga0496111_0072564 | Ga0496111_0072564_1407_2033 | 205 |
| 455 | 3300048915 | Ga0496112_0516084 | Ga0496112_0516084_213_866 | 205 |
| 456 | 3300050508 | nmdc:mga09592_369929_c1 | nmdc:mga09592_369929_c1_248_898 | 205 |
| 457 | 3300050510 | nmdc:mga06r32_338752_c1 | nmdc:mga06r32_338752_c1_434_1084 | 205 |
| 458 | 3300053078 | Ga0495612_0064078 | Ga0495612_0064078_287_940 | 205 |
| 459 | 3300044684 | Ga0466966_0133787 | Ga0466966_0133787_482_1126 | 206 |
| 460 | 3300046522 | Ga0495643_0177142 | Ga0495643_0177142_122_769 | 206 |
| 461 | 3300049592 | Ga0501076_0574838 | Ga0501076_0574838_153_806 | 206 |
| 462 | 3300005328 | Ga0070676_10058367 | Ga0070676_100583672 | 207 |
| 463 | 3300005339 | Ga0070660_100190193 | Ga0070660_1001901932 | 207 |
| 464 | 3300005341 | Ga0070691_10023847 | Ga0070691_100238472 | 207 |
| 465 | 3300005344 | Ga0070661_100066766 | Ga0070661_1000667662 | 207 |
| 466 | 3300005345 | Ga0070692_10317217 | Ga0070692_103172172 | 207 |
| 467 | 3300005354 | Ga0070675_100092248 | Ga0070675_1000922481 | 207 |
| 468 | 3300005364 | Ga0070673_100032861 | Ga0070673_1000328613 | 207 |
| 469 | 3300005435 | Ga0070714_100194002 | Ga0070714_1001940022 | 207 |
| 470 | 3300005440 | Ga0070705_100246791 | Ga0070705_1002467912 | 207 |
| 471 | 3300005466 | Ga0070685_10068886 | Ga0070685_100688862 | 207 |
| 472 | 3300005548 | Ga0070665_100139674 | Ga0070665_1001396743 | 207 |
| 473 | 3300005563 | Ga0068855_100744672 | Ga0068855_1007446722 | 207 |
| 474 | 3300005577 | Ga0068857_100197195 | Ga0068857_1001971952 | 207 |
| 475 | 3300005616 | Ga0068852_100212849 | Ga0068852_1002128492 | 207 |
| 476 | 3300005842 | Ga0068858_100163404 | Ga0068858_1001634043 | 207 |
| 477 | 3300005937 | Ga0081455_10015099 | Ga0081455_100150999 | 207 |
| 478 | 3300005981 | Ga0081538_10001989 | Ga0081538_1000198921 | 207 |
| 479 | 3300006852 | Ga0075433_10116773 | Ga0075433_101167732 | 207 |
| 480 | 3300006871 | Ga0075434_100066505 | Ga0075434_1000665053 | 207 |
| 481 | 3300006880 | Ga0075429_100143981 | Ga0075429_1001439812 | 207 |
| 482 | 3300006914 | Ga0075436_100004261 | Ga0075436_1000042614 | 207 |
| 483 | 3300007076 | Ga0075435_100011926 | Ga0075435_1000119265 | 207 |
| 484 | 3300009094 | Ga0111539_10039339 | Ga0111539_100393395 | 207 |
| 485 | 3300009147 | Ga0114129_10154600 | Ga0114129_101546001 | 207 |
| 486 | 3300025898 | Ga0207692_10016191 | Ga0207692_100161913 | 207 |
| 487 | 3300025899 | Ga0207642_10045134 | Ga0207642_100451343 | 207 |
| 488 | 3300025919 | Ga0207657_10238336 | Ga0207657_102383362 | 207 |
| 489 | 3300025920 | Ga0207649_10052660 | Ga0207649_100526602 | 207 |
| 490 | 3300025926 | Ga0207659_10070208 | Ga0207659_100702083 | 207 |
| 491 | 3300025927 | Ga0207687_10126399 | Ga0207687_101263992 | 207 |
| 492 | 3300025935 | Ga0207709_10133413 | Ga0207709_101334132 | 207 |
| 493 | 3300025937 | Ga0207669_10298493 | Ga0207669_102984932 | 207 |
| 494 | 3300025938 | Ga0207704_10031895 | Ga0207704_100318953 | 207 |
| 495 | 3300025941 | Ga0207711_10055684 | Ga0207711_100556842 | 207 |
| 496 | 3300025944 | Ga0207661_10581209 | Ga0207661_105812092 | 207 |
| 497 | 3300025945 | Ga0207679_10028851 | Ga0207679_100288513 | 207 |
| 498 | 3300025960 | Ga0207651_10053060 | Ga0207651_100530602 | 207 |
| 499 | 3300025961 | Ga0207712_10158561 | Ga0207712_101585612 | 207 |
| 500 | 3300026023 | Ga0207677_10131887 | Ga0207677_101318872 | 207 |
| 501 | 3300026089 | Ga0207648_10114997 | Ga0207648_101149972 | 207 |
| 502 | 3300026095 | Ga0207676_10144121 | Ga0207676_101441212 | 207 |
| 503 | 3300026116 | Ga0207674_10084994 | Ga0207674_100849944 | 207 |
| 504 | 3300026118 | Ga0207675_100148922 | Ga0207675_1001489223 | 207 |
| 505 | 3300026142 | Ga0207698_10192982 | Ga0207698_101929822 | 207 |
| 506 | 3300028379 | Ga0268266_10104849 | Ga0268266_101048493 | 207 |
| 507 | 3300037466 | Ga0395898_0092857 | Ga0395898_0092857_1686_2387 | 207 |
| 508 | 3300037471 | Ga0395905_0358190 | Ga0395905_0358190_261_962 | 207 |
| 509 | 3300038443 | Ga0395901_0235803 | Ga0395901_0235803_677_1378 | 207 |
| 510 | 3300038443 | Ga0395901_0684728 | Ga0395901_0684728_62_763 | 207 |
| 511 | 3300041512 | Ga0451853_2317565 | Ga0451853_2317565_94_795 | 207 |
| 512 | 3300050507 | nmdc:mga05p37_184608_c1 | nmdc:mga05p37_184608_c1_715_1404 | 207 |
| 513 | 3300050511 | nmdc:mga08y16_19504_c1 | nmdc:mga08y16_19504_c1_937_1626 | 207 |
| 514 | 3300050512 | nmdc:mga0n895_32457_c1 | nmdc:mga0n895_32457_c1_4170_4859 | 207 |
| 515 | 3300050513 | nmdc:mga0rr50_18209_c1 | nmdc:mga0rr50_18209_c1_225_914 | 207 |
| 516 | 3300050514 | nmdc:mga08x19_171528_c1 | nmdc:mga08x19_171528_c1_610_1299 | 207 |
| 517 | 3300050515 | nmdc:mga0a205_26654_c1 | nmdc:mga0a205_26654_c1_4417_5106 | 207 |
| 518 | 3300006175 | Ga0070712_100000007 | Ga0070712_10000000740 | 208 |
| 519 | 3300025915 | Ga0207693_10000001 | Ga0207693_10000001396 | 208 |
| 520 | 3300049574 | Ga0501038_0378055 | Ga0501038_0378055_28_696 | 208 |
| 521 | 3300049575 | Ga0501039_0099444 | Ga0501039_0099444_1448_2116 | 208 |
| 522 | 3300049576 | Ga0501040_0034798 | Ga0501040_0034798_1317_1985 | 208 |
| 523 | 3300049587 | Ga0501071_0167759 | Ga0501071_0167759_493_1161 | 208 |
| 524 | 3300049591 | Ga0501075_0193962 | Ga0501075_0193962_54_722 | 208 |
| 525 | 3300049741 | Ga0501079_0093630 | Ga0501079_0093630_1130_1798 | 208 |
| 526 | 3300049743 | Ga0501081_0081318 | Ga0501081_0081318_1317_1985 | 208 |
| 527 | 3300054114 | Ga0501084_0070381 | Ga0501084_0070381_256_924 | 208 |
| 528 | 3300061734 | Ga0530510_0077060 | Ga0530510_0077060_1129_1797 | 208 |
| 529 | 3300002077 | JGI24744J21845_10018784 | JGI24744J21845_100187841 | 212 |
| 530 | 3300005329 | Ga0070683_100049926 | Ga0070683_1000499266 | 212 |
| 531 | 3300005337 | Ga0070682_100027093 | Ga0070682_1000270933 | 212 |
| 532 | 3300005337 | Ga0070682_100186069 | Ga0070682_1001860692 | 212 |
| 533 | 3300005338 | Ga0068868_100353240 | Ga0068868_1003532401 | 212 |
| 534 | 3300005339 | Ga0070660_100297552 | Ga0070660_1002975522 | 212 |
| 535 | 3300005340 | Ga0070689_100247617 | Ga0070689_1002476172 | 212 |
| 536 | 3300005347 | Ga0070668_100074027 | Ga0070668_1000740272 | 212 |
| 537 | 3300005354 | Ga0070675_100265192 | Ga0070675_1002651922 | 212 |
| 538 | 3300005355 | Ga0070671_100116007 | Ga0070671_1001160073 | 212 |
| 539 | 3300005365 | Ga0070688_100048863 | Ga0070688_1000488632 | 212 |
| 540 | 3300005366 | Ga0070659_100655101 | Ga0070659_1006551011 | 212 |
| 541 | 3300005466 | Ga0070685_10047339 | Ga0070685_100473392 | 212 |
| 542 | 3300005535 | Ga0070684_100027133 | Ga0070684_1000271332 | 212 |
| 543 | 3300005543 | Ga0070672_100312444 | Ga0070672_1003124442 | 212 |
| 544 | 3300005545 | Ga0070695_100063323 | Ga0070695_1000633233 | 212 |
| 545 | 3300005546 | Ga0070696_100141392 | Ga0070696_1001413922 | 212 |
| 546 | 3300005577 | Ga0068857_100501205 | Ga0068857_1005012052 | 212 |
| 547 | 3300005618 | Ga0068864_100245432 | Ga0068864_1002454322 | 212 |
| 548 | 3300005719 | Ga0068861_100058564 | Ga0068861_1000585642 | 212 |
| 549 | 3300005834 | Ga0068851_10122515 | Ga0068851_101225152 | 212 |
| 550 | 3300005841 | Ga0068863_100923672 | Ga0068863_1009236721 | 212 |
| 551 | 3300005844 | Ga0068862_100497443 | Ga0068862_1004974432 | 212 |
| 552 | 3300006058 | Ga0075432_10025621 | Ga0075432_100256212 | 212 |
| 553 | 3300006852 | Ga0075433_10130165 | Ga0075433_101301652 | 212 |
| 554 | 3300006871 | Ga0075434_100356954 | Ga0075434_1003569542 | 212 |
| 555 | 3300009098 | Ga0105245_10141473 | Ga0105245_101414732 | 212 |
| 556 | 3300009098 | Ga0105245_10345849 | Ga0105245_103458492 | 212 |
| 557 | 3300009176 | Ga0105242_10199647 | Ga0105242_101996472 | 212 |
| 558 | 3300009551 | Ga0105238_10172716 | Ga0105238_101727163 | 212 |
| 559 | 3300009551 | Ga0105238_10559022 | Ga0105238_105590222 | 212 |
| 560 | 3300009553 | Ga0105249_10040756 | Ga0105249_100407566 | 212 |
| 561 | 3300010375 | Ga0105239_10271319 | Ga0105239_102713192 | 212 |
| 562 | 3300013102 | Ga0157371_10122023 | Ga0157371_101220232 | 212 |
| 563 | 3300013306 | Ga0163162_10282646 | Ga0163162_102826462 | 212 |
| 564 | 3300013307 | Ga0157372_10478234 | Ga0157372_104782342 | 212 |
| 565 | 3300014325 | Ga0163163_10057328 | Ga0163163_100573286 | 212 |
| 566 | 3300014325 | Ga0163163_10158791 | Ga0163163_101587912 | 212 |
| 567 | 3300014497 | Ga0182008_10123142 | Ga0182008_101231422 | 212 |
| 568 | 3300014745 | Ga0157377_10239335 | Ga0157377_102393352 | 212 |
| 569 | 3300014968 | Ga0157379_10201061 | Ga0157379_102010612 | 212 |
| 570 | 3300017792 | Ga0163161_10219953 | Ga0163161_102199532 | 212 |
| 571 | 3300025321 | Ga0207656_10124694 | Ga0207656_101246942 | 212 |
| 572 | 3300025898 | Ga0207692_10330269 | Ga0207692_103302692 | 212 |
| 573 | 3300025899 | Ga0207642_10068823 | Ga0207642_100688232 | 212 |
| 574 | 3300025900 | Ga0207710_10071531 | Ga0207710_100715312 | 212 |
| 575 | 3300025901 | Ga0207688_10005194 | Ga0207688_100051942 | 212 |
| 576 | 3300025908 | Ga0207643_10036157 | Ga0207643_100361572 | 212 |
| 577 | 3300025918 | Ga0207662_10054365 | Ga0207662_100543653 | 212 |
| 578 | 3300025919 | Ga0207657_10146296 | Ga0207657_101462962 | 212 |
| 579 | 3300025923 | Ga0207681_10583378 | Ga0207681_105833781 | 212 |
| 580 | 3300025924 | Ga0207694_10234375 | Ga0207694_102343752 | 212 |
| 581 | 3300025924 | Ga0207694_10511391 | Ga0207694_105113912 | 212 |
| 582 | 3300025926 | Ga0207659_10122372 | Ga0207659_101223722 | 212 |
| 583 | 3300025927 | Ga0207687_10024111 | Ga0207687_100241114 | 212 |
| 584 | 3300025927 | Ga0207687_10195111 | Ga0207687_101951112 | 212 |
| 585 | 3300025936 | Ga0207670_10069391 | Ga0207670_100693912 | 212 |
| 586 | 3300025937 | Ga0207669_10219492 | Ga0207669_102194922 | 212 |
| 587 | 3300025938 | Ga0207704_10145842 | Ga0207704_101458422 | 212 |
| 588 | 3300025940 | Ga0207691_10099797 | Ga0207691_100997972 | 212 |
| 589 | 3300025942 | Ga0207689_10067770 | Ga0207689_100677703 | 212 |
| 590 | 3300025944 | Ga0207661_10202679 | Ga0207661_102026792 | 212 |
| 591 | 3300025961 | Ga0207712_10068060 | Ga0207712_100680602 | 212 |
| 592 | 3300025972 | Ga0207668_10027193 | Ga0207668_100271933 | 212 |
| 593 | 3300025981 | Ga0207640_10400637 | Ga0207640_104006372 | 212 |
| 594 | 3300026075 | Ga0207708_10156759 | Ga0207708_101567592 | 212 |
| 595 | 3300026078 | Ga0207702_10274738 | Ga0207702_102747382 | 212 |
| 596 | 3300026116 | Ga0207674_10366304 | Ga0207674_103663043 | 212 |
| 597 | 3300026118 | Ga0207675_100066619 | Ga0207675_1000666193 | 212 |
| 598 | 3300026121 | Ga0207683_10216835 | Ga0207683_102168352 | 212 |
| 599 | 3300026142 | Ga0207698_10031883 | Ga0207698_100318834 | 212 |
| 600 | 3300027907 | Ga0207428_10307332 | Ga0207428_103073321 | 212 |
| 601 | 3300028381 | Ga0268264_10151808 | Ga0268264_101518082 | 212 |
| 602 | 3300035090 | Ga0373949_0030356 | Ga0373949_0030356_388_1026 | 212 |
| 603 | 3300035092 | Ga0373952_0042221 | Ga0373952_0042221_273_911 | 212 |
| 604 | 3300045976 | Ga0466967_0574453 | Ga0466967_0574453_423_1061 | 212 |
| 605 | 3300048903 | Ga0496100_0120968 | Ga0496100_0120968_550_1188 | 212 |
| 606 | 3300048905 | Ga0496102_0047280 | Ga0496102_0047280_2928_3566 | 212 |
| 607 | 3300048906 | Ga0496103_0109792 | Ga0496103_0109792_900_1538 | 212 |
| 608 | 3300048910 | Ga0496107_0082435 | Ga0496107_0082435_199_837 | 212 |
| 609 | 3300048911 | Ga0496108_0418611 | Ga0496108_0418611_371_1015 | 212 |
| 610 | 3300048914 | Ga0496111_0032348 | Ga0496111_0032348_2925_3563 | 212 |
| 611 | 3300048917 | Ga0496114_0196351 | Ga0496114_0196351_720_1358 | 212 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5d92-assembly2.cif.gz_B | structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum | 0.8848 | 39 | 209 |
| 5d91-assembly1.cif.gz_A | structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum | 0.8778 | 39 | 209 |
| 4o6m-assembly1.cif.gz_A | structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) | 0.8637 | 39 | 203 |
| 4q7c-assembly1.cif.gz_B | structure of af2299, a cdp-alcohol phosphotransferase | 0.8625 | 39 | 202 |
| 6wm5-assembly1.cif.gz_A | structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii | 0.8456 | 28 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WPG7_9_203_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8454 | 23 | 201 | 1.20.120.1760 |
| 5d92A02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.814 | 22 | 209 | 1.20.120.1760 |
| 4o6mB02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.7982 | 25 | 202 | 1.20.120.1760 |
| af_P9WPG7_9_203_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.7757 | 23 | 201 | 1.20.120.1760 |
| af_P76226_9_202_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.7566 | 39 | 206 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9BE61-F1-model_v4 | CDP-alcohol phosphatidyltransferase family protein | 0.9713 | 46 | 210 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-X0VL54-F1-model_v4 | CDP-alcohol phosphatidyltransferase family protein | 0.9694 | 43 | 209 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A538D557-F1-model_v4 | CDP-alcohol phosphatidyltransferase family protein | 0.967 | 61 | 208 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A7W1ASY7-F1-model_v4 | CDP-alcohol phosphatidyltransferase family protein | 0.9651 | 46 | 211 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A3B8MGK7-F1-model_v4 | CDP-alcohol phosphatidyltransferase family protein | 0.954 | 47 | 206 |
GO:0008654
GO:0016020 GO:0016780 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar