F468924

General Info

Members Datasets Scaffolds Average Seq Length
609 378 521 472

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2841760612|2841763604
Length 513
Sequence FANLGLGFSTVWKIVWWSPAFLQGAFTVPVPINIALCFVGCLVGTLIGVLPGVGPIATIAMLLPITFGLDPVGALIMLAGIYYGAQYGGSTTAILVNIPGEATSVVTTLDGHQMAKQGRAGVALGTAALASFFAGTIATVVIAALGAPLTKLALLFGPAEYFSLMVMGLCFAVVLARGSILKAFCMIMLGLLLSTVGTDLETGQERMTFGFPPLSDGIDFAVLAMGVFGFAEVLRNLENPETRDVVRTKIGRLLPNWEDIKQSIAPVVRGTSVGAILGILPGNGAVLGPFASYTIEKKIAKDPSRFGKGAIEGVAGPEAANNAGAQTAFIPLLTLGIPPNAVMALMVGAMTIHGIIPGPQVMTKNPDLFWGMIASMWIGNLMLLVINLPLVGVWVKLLQVPYRLMFPAILIFCSIGIYSVNNQPVDVAFTAMFGLFGYILIKLGFEPAPMLLGFVLGKLMEEKLRQALIISRGSFMTFIERPISAGLLLVAVAILVIALLPSMSKKREEVFTE

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
3 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
4 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
5 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
6 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
7 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
8 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
9 2643221557 Ensifer sp. Root558 Isolate Unclassified
10 2643221558 Rhizobium sp. Root149 Isolate Unclassified
11 2643221582 Rhizobium sp. Root651 Isolate Unclassified
12 2643221610 Ensifer sp. Root74 Isolate Unclassified
13 2643221668 Ensifer sp. Root423 Isolate Unclassified
14 2643221675 Ensifer sp. Root1298 Isolate Unclassified
15 2643221680 Ensifer sp. Root1312 Isolate Unclassified
16 2643221726 Ensifer sp. Root954 Isolate Unclassified
17 2643221733 Bosea sp. Root381 Isolate Unclassified
18 2643221734 Bosea sp. Root670 Isolate Unclassified
19 2643221736 Bosea sp. Root483D1 Isolate Unclassified
20 2751185800 Brucella pituitosa AA2 Isolate Unclassified
21 2773857925 Microvirga vignae BR3299 Isolate Unclassified
22 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
23 2802429633 Rhizobium anhuiense J3 Isolate Nodule
24 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
25 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
26 2818991467 Bosea vestrisii 3192 Isolate Unclassified
27 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
28 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
29 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
30 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
31 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
32 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
33 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
34 2841760612 Bosea sp. Tri-49 Isolate Nodule
35 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
36 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
37 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
38 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
39 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
40 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
41 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
42 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
43 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
44 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
45 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
46 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
47 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
48 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
49 2842694124 Methylopila sp. R-72369 Isolate Unclassified
50 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
51 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
52 2844104063 Bosea sp. Tri-39 Isolate Nodule
53 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
54 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
55 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
56 2851182111 Bosea sp. Tri-44 Isolate Nodule
57 2851246043 Bosea sp. Tri-54 Isolate Nodule
58 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
59 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
60 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
61 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
62 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
63 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
64 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
65 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
66 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
67 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
68 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
69 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
70 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
71 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
72 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
73 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
74 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
75 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
76 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
77 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
78 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
79 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
80 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
81 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
82 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
83 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
84 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
85 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
86 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
87 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
88 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
89 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
90 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
91 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
92 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
93 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
94 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
95 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
96 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
97 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
98 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
99 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
100 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
101 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
102 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
103 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
104 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
105 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
106 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
107 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
108 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
109 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
110 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
111 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
112 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
113 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
114 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
115 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
116 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
117 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
118 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
119 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
120 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
121 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
122 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
123 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
124 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
125 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
126 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
127 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
128 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
129 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
130 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
131 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
132 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
133 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
134 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
135 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
136 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
137 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
138 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
139 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
140 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
141 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
142 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
143 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
144 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
145 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
146 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
147 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
148 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
149 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
150 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
151 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
152 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
153 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
154 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
155 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
156 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
157 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
158 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
159 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
160 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
161 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
162 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
163 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
164 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
165 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
166 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
167 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
168 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
169 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
170 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
171 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
172 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
173 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
174 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
175 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
176 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
177 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
178 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
179 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
180 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
181 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
182 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
183 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
184 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
185 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
186 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
187 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
188 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
189 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
190 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
191 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
192 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
194 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
196 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
253 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
254 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
258 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
259 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
260 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
261 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
262 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
263 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
264 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
265 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
266 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
267 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
270 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
272 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
273 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
274 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
275 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
276 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
277 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
278 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
279 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
280 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
281 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
282 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
283 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
284 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
285 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
286 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
287 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
288 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
289 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
290 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
291 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
292 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
293 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
294 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
300 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
301 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
302 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
303 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
304 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
305 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
306 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
307 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
308 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
309 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
310 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
311 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
312 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
313 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
314 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
315 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
316 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
333 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
336 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
337 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
338 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
339 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
340 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
344 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
345 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
346 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
347 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
348 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
349 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
350 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
351 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
352 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
356 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
357 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
358 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
359 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
360 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
361 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
362 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
363 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
364 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
365 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
366 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
367 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
368 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
369 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
370 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
371 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
372 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
373 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
374 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
375 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
376 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
377 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
378 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.55
Metatranscriptomes 0
Isolates 14.45

Biome Distribution

Category Percentage (%)
Aerial Root 0.66
Bulb 0
Endosphere 9.2
Nodule 5.58
Rhizoplane 5.25
Rhizosphere 71.1
Stem 0
Stem Tuber 0
Unclassified 8.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1007505 3300002987 Bacteria 3120
2 JGI25151J46595_10000022 3300003187 Bacteria 223477
3 Ga0055526_1000912 3300003771 Bacteria 21968
4 Ga0055524_1000055 3300003775 Bacteria 141970
5 Ga0055524_1000789 3300003775 Bacteria 21114
6 Ga0065165_1000605 3300005262 Bacteria 52381
7 Ga0065704_10078884 3300005289 Bacteria 4310
8 Ga0065715_10098135 3300005293 Bacteria 3593
9 Ga0070658_10065653 3300005327 Bacteria 2962
10 Ga0070676_10000280 3300005328 Bacteria 22584
11 Ga0070683_100001003 3300005329 Bacteria 21149
12 Ga0070690_100001092 3300005330 Bacteria 13936
13 Ga0070670_100005274 3300005331 Bacteria 10890
14 Ga0070677_10002172 3300005333 Bacteria 6274
15 Ga0068869_100004295 3300005334 Bacteria 8847
16 Ga0070666_10003606 3300005335 Bacteria 9385
17 Ga0070680_100010016 3300005336 Bacteria 7302
18 Ga0070682_100030445 3300005337 Bacteria 3257
19 Ga0068868_100053608 3300005338 Bacteria 3177
20 Ga0070660_100003198 3300005339 Bacteria 11260
21 Ga0070689_100000505 3300005340 Bacteria 23043
22 Ga0070687_100000384 3300005343 Bacteria 15006
23 Ga0070661_100011847 3300005344 Bacteria 6084
24 Ga0070668_100000287 3300005347 Bacteria 33356
25 Ga0070669_100003878 3300005353 Bacteria 10817
26 Ga0070671_100033213 3300005355 Bacteria 4266
27 Ga0070674_100003288 3300005356 Bacteria 9043
28 Ga0070673_100001873 3300005364 Bacteria 12593
29 Ga0070688_100000091 3300005365 Bacteria 45816
30 Ga0070659_100004822 3300005366 Bacteria 9641
31 Ga0070667_100061588 3300005367 Bacteria 3177
32 Ga0070701_10010152 3300005438 Bacteria 4152
33 Ga0070701_10023768 3300005438 Bacteria 2956
34 Ga0070705_100001394 3300005440 Bacteria 12811
35 Ga0070705_100009749 3300005440 Bacteria 4786
36 Ga0070700_100006271 3300005441 Bacteria 6346
37 Ga0070700_100011671 3300005441 Bacteria 4873
38 Ga0070663_100006702 3300005455 Bacteria 6947
39 Ga0070663_100007946 3300005455 Bacteria 6498
40 Ga0070678_100002671 3300005456 Bacteria 9826
41 Ga0070662_100001146 3300005457 Bacteria 16250
42 Ga0070681_10038882 3300005458 Bacteria 4770
43 Ga0068867_100038613 3300005459 Bacteria 3476
44 Ga0070685_10000854 3300005466 Bacteria 16582
45 Ga0070699_100011469 3300005518 Bacteria 7654
46 Ga0070679_100086515 3300005530 Bacteria 3121
47 Ga0070679_100147502 3300005530 Bacteria 2330
48 Ga0070684_100031272 3300005535 Bacteria 4530
49 Ga0068853_100003745 3300005539 Bacteria 11662
50 Ga0070672_100007581 3300005543 Bacteria 7376
51 Ga0070686_100001694 3300005544 Bacteria 12331
52 Ga0070695_100001925 3300005545 Bacteria 11755
53 Ga0070695_100003492 3300005545 Bacteria 9176
54 Ga0070695_100025378 3300005545 Bacteria 3660
55 Ga0070696_100001543 3300005546 Bacteria 15094
56 Ga0070704_100018124 3300005549 Bacteria 4493
57 Ga0068855_100001311 3300005563 Bacteria 30813
58 Ga0070664_100000070 3300005564 Bacteria 63788
59 Ga0070664_100024123 3300005564 Bacteria 5029
60 Ga0068857_100004925 3300005577 Bacteria 11333
61 Ga0068857_100026496 3300005577 Bacteria 5111
62 Ga0068856_100011570 3300005614 Bacteria 8558
63 Ga0070702_100004734 3300005615 Bacteria 6249
64 Ga0068852_100007906 3300005616 Bacteria 7790
65 Ga0068859_100010949 3300005617 Bacteria 9128
66 Ga0068859_100010967 3300005617 Bacteria 9121
67 Ga0068864_100004901 3300005618 Bacteria 10964
68 Ga0068866_10005676 3300005718 Bacteria 5169
69 Ga0068861_100013794 3300005719 Bacteria 5661
70 Ga0068861_100050707 3300005719 Bacteria 3148
71 Ga0068851_10000674 3300005834 Bacteria 14580
72 Ga0068870_10001116 3300005840 Bacteria 10702
73 Ga0068863_100000798 3300005841 Bacteria 31651
74 Ga0068858_100027299 3300005842 Bacteria 5305
75 Ga0068858_100188655 3300005842 Bacteria 1948
76 Ga0068860_100005241 3300005843 Bacteria 13166
77 Ga0068860_100010806 3300005843 Bacteria 9011
78 Ga0068862_100003018 3300005844 Bacteria 14676
79 Ga0068862_100026701 3300005844 Bacteria 4855
80 Ga0068862_100070167 3300005844 Bacteria 3025
81 Ga0081455_10000063 3300005937 Bacteria 115842
82 Ga0081455_10000689 3300005937 Bacteria 43834
83 Ga0081455_10007153 3300005937 Bacteria 11809
84 Ga0081455_10027794 3300005937 Bacteria 5180
85 Ga0081455_10045767 3300005937 Bacteria 3804
86 Ga0081455_10146849 3300005937 Bacteria 1823
87 Ga0081538_10022286 3300005981 Bacteria 4592
88 Ga0081540_1000024 3300005983 Bacteria 158868
89 Ga0081540_1000138 3300005983 Bacteria 76659
90 Ga0081540_1002355 3300005983 Bacteria 15443
91 Ga0081540_1003233 3300005983 Bacteria 12982
92 Ga0075365_10004579 3300006038 Bacteria 7353
93 Ga0075368_10001912 3300006042 Bacteria 6696
94 Ga0075363_100010116 3300006048 Bacteria 4462
95 Ga0075363_100019142 3300006048 Bacteria 3420
96 Ga0075363_100056132 3300006048 Bacteria 2111
97 Ga0075364_10026856 3300006051 Bacteria 3675
98 Ga0075367_10000458 3300006178 Bacteria 15161
99 Ga0075369_10002639 3300006186 Bacteria 6417
100 Ga0075366_10012366 3300006195 Bacteria 4841
101 Ga0097621_100001573 3300006237 Bacteria 15606
102 Ga0075428_100005672 3300006844 Bacteria 13875
103 Ga0075428_100005816 3300006844 Bacteria 13698
104 Ga0075428_100017973 3300006844 Bacteria 7813
105 Ga0075428_100027939 3300006844 Bacteria 6243
106 Ga0075430_100014165 3300006846 Bacteria 6798
107 Ga0075430_100031880 3300006846 Bacteria 4474
108 Ga0075430_100108586 3300006846 Bacteria 2315
109 Ga0075431_100001046 3300006847 Bacteria 24694
110 Ga0075431_100002212 3300006847 Bacteria 18636
111 Ga0075431_100004021 3300006847 Bacteria 14330
112 Ga0075431_100039393 3300006847 Bacteria 4867
113 Ga0075431_100057085 3300006847 Bacteria 4026
114 Ga0075431_100234318 3300006847 Bacteria 1869
115 Ga0075433_10066374 3300006852 Bacteria 3166
116 Ga0075434_100011486 3300006871 Bacteria 8357
117 Ga0075434_100034195 3300006871 Bacteria 5019
118 Ga0075434_100048325 3300006871 Bacteria 4222
119 Ga0075434_100078714 3300006871 Bacteria 3293
120 Ga0075434_100233517 3300006871 Bacteria 1859
121 Ga0075429_100005180 3300006880 Bacteria 11217
122 Ga0075429_100006836 3300006880 Bacteria 9899
123 Ga0075429_100007998 3300006880 Bacteria 9183
124 Ga0075429_100010182 3300006880 Bacteria 8140
125 Ga0068865_100000181 3300006881 Bacteria 35056
126 Ga0075436_100063989 3300006914 Bacteria 2542
127 Ga0097620_100010949 3300006931 Bacteria 9128
128 Ga0097620_100010968 3300006931 Bacteria 9121
129 Ga0099826_10006295 3300006948 Bacteria 8634
130 Ga0075435_100019956 3300007076 Bacteria 5124
131 Ga0099794_10052294 3300007265 Bacteria 1969
132 Ga0105240_10001320 3300009093 Bacteria 42809
133 Ga0111539_10004562 3300009094 Bacteria 18106
134 Ga0111539_10035683 3300009094 Bacteria 6020
135 Ga0111539_10052538 3300009094 Bacteria 4851
136 Ga0111539_10054669 3300009094 Bacteria 4749
137 Ga0111539_10128373 3300009094 Bacteria 2970
138 Ga0111539_10289165 3300009094 Bacteria 1907
139 Ga0105245_10001569 3300009098 Bacteria 20736
140 Ga0105247_10000414 3300009101 Bacteria 36129
141 Ga0114129_10000938 3300009147 Bacteria 38115
142 Ga0114129_10007147 3300009147 Bacteria 15887
143 Ga0114129_10022728 3300009147 Bacteria 8893
144 Ga0114129_10110410 3300009147 Bacteria 3796
145 Ga0114129_10148426 3300009147 Bacteria 3210
146 Ga0114129_10155040 3300009147 Bacteria 3133
147 Ga0114129_10265092 3300009147 Bacteria 2300
148 Ga0105243_10012884 3300009148 Bacteria 6318
149 Ga0105241_10005118 3300009174 Bacteria 9674
150 Ga0105241_10052544 3300009174 Bacteria 3112
151 Ga0105242_10005737 3300009176 Bacteria 9569
152 Ga0105248_10002756 3300009177 Bacteria 19521
153 Ga0105248_10045137 3300009177 Bacteria 4941
154 Ga0105237_10000336 3300009545 Bacteria 66188
155 Ga0105237_10001216 3300009545 Bacteria 34392
156 Ga0105238_10000424 3300009551 Bacteria 44527
157 Ga0105249_10000352 3300009553 Bacteria 46130
158 Ga0105249_10048906 3300009553 Bacteria 3856
159 Ga0105239_10019062 3300010375 Bacteria 7581
160 Ga0105239_10046542 3300010375 Bacteria 4754
161 Ga0105239_10055172 3300010375 Bacteria 4358
162 Ga0105246_10002039 3300011119 Bacteria 12195
163 Ga0157373_10003226 3300013100 Bacteria 12340
164 Ga0157371_10005222 3300013102 Bacteria 11032
165 Ga0157370_10055235 3300013104 Bacteria 3783
166 Ga0157369_10004683 3300013105 Bacteria 16083
167 Ga0157369_10009161 3300013105 Bacteria 11325
168 Ga0171462_1009 3300013250 Bacteria 344993
169 Ga0157374_10010885 3300013296 Bacteria 7850
170 Ga0157374_10069178 3300013296 Bacteria 3324
171 Ga0157378_10005291 3300013297 Bacteria 11334
172 Ga0163162_10060083 3300013306 Bacteria 3834
173 Ga0157375_10025194 3300013308 Bacteria 5521
174 Ga0163163_10038070 3300014325 Bacteria 4683
175 Ga0157377_10000560 3300014745 Bacteria 15574
176 Ga0157379_10004705 3300014968 Bacteria 11721
177 Ga0157376_10006959 3300014969 Bacteria 8021
178 Ga0182006_1035559 3300015261 Bacteria 1984
179 Ga0209675_1000652 3300025291 Bacteria 24482
180 Ga0209675_1001032 3300025291 Bacteria 17386
181 Ga0209025_1000016 3300025294 Bacteria 770739
182 Ga0209025_1004076 3300025294 Bacteria 13036
183 Ga0209025_1035429 3300025294 Bacteria 2255
184 Ga0209564_1000019 3300025295 Bacteria 573686
185 Ga0209564_1000034 3300025295 Bacteria 444284
186 Ga0209758_1000532 3300025297 Bacteria 60639
187 Ga0209256_1000026 3300025299 Bacteria 432835
188 Ga0209256_1000027 3300025299 Bacteria 423283
189 Ga0209256_1000188 3300025299 Bacteria 117988
190 Ga0209256_1002092 3300025299 Bacteria 17500
191 Ga0207656_10002946 3300025321 Bacteria 5806
192 Ga0207653_10001405 3300025885 Bacteria 7810
193 Ga0207682_10000204 3300025893 Bacteria 26883
194 Ga0207710_10002070 3300025900 Bacteria 9512
195 Ga0207688_10000201 3300025901 Bacteria 26662
196 Ga0207680_10000671 3300025903 Bacteria 16142
197 Ga0207647_10001418 3300025904 Bacteria 18397
198 Ga0207647_10003890 3300025904 Bacteria 11152
199 Ga0207645_10000133 3300025907 Bacteria 56722
200 Ga0207643_10000073 3300025908 Bacteria 65264
201 Ga0207705_10014657 3300025909 Bacteria 5640
202 Ga0207654_10017466 3300025911 Bacteria 3751
203 Ga0207654_10079477 3300025911 Bacteria 1970
204 Ga0207654_10083195 3300025911 Bacteria 1932
205 Ga0207707_10009982 3300025912 Bacteria 8235
206 Ga0207695_10000008 3300025913 Bacteria 1058268
207 Ga0207695_10006360 3300025913 Bacteria 15368
208 Ga0207671_10010690 3300025914 Bacteria 7548
209 Ga0207671_10012665 3300025914 Bacteria 6768
210 Ga0207660_10026035 3300025917 Bacteria 3979
211 Ga0207662_10000810 3300025918 Bacteria 14388
212 Ga0207657_10000369 3300025919 Bacteria 47484
213 Ga0207649_10001117 3300025920 Bacteria 16280
214 Ga0207649_10007863 3300025920 Bacteria 5802
215 Ga0207652_10036748 3300025921 Bacteria 4141
216 Ga0207652_10103014 3300025921 Bacteria 2523
217 Ga0207652_10117552 3300025921 Bacteria 2363
218 Ga0207681_10000454 3300025923 Bacteria 28694
219 Ga0207694_10006184 3300025924 Bacteria 9143
220 Ga0207650_10000343 3300025925 Bacteria 45078
221 Ga0207659_10000458 3300025926 Bacteria 24569
222 Ga0207687_10004378 3300025927 Bacteria 9420
223 Ga0207687_10102511 3300025927 Bacteria 2108
224 Ga0207644_10003498 3300025931 Bacteria 10161
225 Ga0207706_10006992 3300025933 Bacteria 10429
226 Ga0207706_10015506 3300025933 Bacteria 6886
227 Ga0207686_10010811 3300025934 Bacteria 4976
228 Ga0207709_10021662 3300025935 Bacteria 3639
229 Ga0207670_10002350 3300025936 Bacteria 9912
230 Ga0207669_10001051 3300025937 Bacteria 11783
231 Ga0207704_10001823 3300025938 Bacteria 9547
232 Ga0207691_10000325 3300025940 Bacteria 47386
233 Ga0207711_10005164 3300025941 Bacteria 11063
234 Ga0207711_10072150 3300025941 Bacteria 2999
235 Ga0207689_10000265 3300025942 Bacteria 47208
236 Ga0207661_10024475 3300025944 Bacteria 4577
237 Ga0207679_10000560 3300025945 Bacteria 24996
238 Ga0207679_10016255 3300025945 Bacteria 4938
239 Ga0207679_10131949 3300025945 Bacteria 2006
240 Ga0207651_10000109 3300025960 Bacteria 35165
241 Ga0207712_10000490 3300025961 Bacteria 32851
242 Ga0207712_10006160 3300025961 Bacteria 7562
243 Ga0207668_10128684 3300025972 Bacteria 1930
244 Ga0207640_10008040 3300025981 Bacteria 5831
245 Ga0207658_10000380 3300025986 Bacteria 43369
246 Ga0207677_10000355 3300026023 Bacteria 32084
247 Ga0207703_10000416 3300026035 Bacteria 45430
248 Ga0207703_10062636 3300026035 Bacteria 3047
249 Ga0207639_10000472 3300026041 Bacteria 27772
250 Ga0207678_10000200 3300026067 Bacteria 52538
251 Ga0207678_10013419 3300026067 Bacteria 7192
252 Ga0207678_10016462 3300026067 Bacteria 6491
253 Ga0207678_10092716 3300026067 Bacteria 2581
254 Ga0207708_10011729 3300026075 Bacteria 6532
255 Ga0207708_10013122 3300026075 Bacteria 6183
256 Ga0207702_10076109 3300026078 Bacteria 2900
257 Ga0207641_10005681 3300026088 Bacteria 10617
258 Ga0207648_10007749 3300026089 Bacteria 10492
259 Ga0207676_10001815 3300026095 Bacteria 15654
260 Ga0207676_10020791 3300026095 Bacteria 4807
261 Ga0207674_10000691 3300026116 Bacteria 43969
262 Ga0207674_10005484 3300026116 Bacteria 15067
263 Ga0207674_10019702 3300026116 Bacteria 7303
264 Ga0207674_10023774 3300026116 Bacteria 6557
265 Ga0207675_100000010 3300026118 Bacteria 147838
266 Ga0207675_100004507 3300026118 Bacteria 13454
267 Ga0207675_100066676 3300026118 Bacteria 3365
268 Ga0207683_10000116 3300026121 Bacteria 65051
269 Ga0207698_10000880 3300026142 Bacteria 17419
270 Ga0209371_1000534 3300027312 Bacteria 36079
271 Ga0209813_10000917 3300027866 Bacteria 6637
272 Ga0209813_10004592 3300027866 Bacteria 3305
273 Ga0209813_10010243 3300027866 Bacteria 2418
274 Ga0207428_10022749 3300027907 Bacteria 5284
275 Ga0207428_10032520 3300027907 Bacteria 4289
276 Ga0207428_10068584 3300027907 Bacteria 2789
277 Ga0268266_10006791 3300028379 Bacteria 10429
278 Ga0268265_10006012 3300028380 Bacteria 8257
279 Ga0268265_10011245 3300028380 Bacteria 6050
280 Ga0268265_10044017 3300028380 Bacteria 3322
281 Ga0268264_10000090 3300028381 Bacteria 234383
282 Ga0268264_10006929 3300028381 Bacteria 9508
283 Ga0268256_1001706 3300030500 Bacteria 12533
284 Ga0307408_100092288 3300031548 Bacteria 2289
285 Ga0307508_10017911 3300031616 Bacteria 6437
286 Ga0307407_10030589 3300031903 Bacteria 2906
287 Ga0307414_10016785 3300032004 Bacteria 4463
288 Ga0307415_100109850 3300032126 Bacteria 2044
289 Ga0373940_0030561 3300035088 Bacteria 1433
290 Ga0373949_0012870 3300035090 Bacteria 1853
291 Ga0373939_0004731 3300035114 Bacteria 3229
292 Ga0373960_0016399 3300035121 Bacteria 1905
293 Ga0373931_0001100 3300035691 Bacteria 11473
294 Ga0373931_0043242 3300035691 Bacteria 2371
295 Ga0373935_0018083 3300035692 Bacteria 4285
296 Ga0373933_0040774 3300035724 Bacteria 2737
297 Ga0373925_0051878 3300037068 Bacteria 3063
298 Ga0395898_0016137 3300037466 Bacteria 7648
299 Ga0395905_0010207 3300037471 Bacteria 9152
300 Ga0436364_1543814 3300037853 Bacteria 2101
301 Ga0395901_0150393 3300038443 Bacteria 2447
302 Ga0436365_1057605 3300039437 Bacteria 25229
303 Ga0439436_0000681 3300041404 Bacteria 9142
304 Ga0439438_012453 3300041405 Bacteria 2608
305 Ga0439453_0004580 3300041408 Bacteria 2061
306 Ga0439466_0031122 3300041411 Bacteria 1827
307 Ga0439441_000490 3300042001 Bacteria 4301
308 Ga0439441_004700 3300042001 Bacteria 2084
309 Ga0439443_000697 3300042003 Bacteria 3238
310 Ga0439435_0001851 3300042436 Bacteria 4041
311 Ga0439444_0003050 3300042437 Bacteria 2340
312 Ga0439444_0005458 3300042437 Bacteria 1885
313 Ga0439460_0001689 3300042461 Bacteria 5230
314 Ga0439460_0013826 3300042461 Bacteria 2115
315 Ga0450918_003352 3300042531 Bacteria 2978
316 Ga0451577_0000130 3300042876 Bacteria 167763
317 Ga0451577_0010686 3300042876 Bacteria 8740
318 Ga0451577_0015386 3300042876 Bacteria 7119
319 Ga0451577_0035141 3300042876 Bacteria 4515
320 Ga0451577_0067134 3300042876 Bacteria 3198
321 Ga0453683_0004697 3300044673 Bacteria 9639
322 Ga0453683_0007131 3300044673 Bacteria 7615
323 Ga0453683_0018184 3300044673 Bacteria 4513
324 Ga0453683_0023706 3300044673 Bacteria 3910
325 Ga0453683_0024066 3300044673 Bacteria 3878
326 Ga0453683_0025337 3300044673 Bacteria 3770
327 Ga0453683_0043708 3300044673 Bacteria 2811
328 Ga0453684_0000301 3300044712 Bacteria 207812
329 Ga0453684_0000605 3300044712 Bacteria 132206
330 Ga0453684_0001202 3300044712 Bacteria 79837
331 Ga0453684_0003907 3300044712 Bacteria 32744
332 Ga0453684_0019816 3300044712 Bacteria 10205
333 Ga0453684_0022335 3300044712 Bacteria 9392
334 Ga0453684_0034338 3300044712 Bacteria 7041
335 Ga0453684_0040138 3300044712 Bacteria 6364
336 Ga0453684_0051226 3300044712 Bacteria 5416
337 Ga0453684_0051355 3300044712 Bacteria 5406
338 Ga0453684_0094873 3300044712 Bacteria 3668
339 Ga0453684_0118542 3300044712 Bacteria 3201
340 Ga0453684_0177504 3300044712 Bacteria 2503
341 Ga0453684_0182513 3300044712 Unclassified 2462
342 Ga0453684_0235755 3300044712 Bacteria 2109
343 Ga0453684_0291383 3300044712 Bacteria 1858
344 Ga0451576_0001769 3300045051 Bacteria 35409
345 Ga0451576_0020273 3300045051 Bacteria 7242
346 Ga0451576_0038171 3300045051 Bacteria 5083
347 Ga0451576_0077496 3300045051 Bacteria 3459
348 Ga0451576_0258642 3300045051 Bacteria 1819
349 Ga0451576_0306475 3300045051 Bacteria 1661
350 Ga0495638_0041259 3300046460 Bacteria 2921
351 Ga0495584_0035968 3300046491 Bacteria 2502
352 Ga0495610_0046770 3300046512 Bacteria 2133
353 Ga0495643_0021918 3300046522 Bacteria 3654
354 Ga0495640_0009751 3300046533 Bacteria 7460
355 Ga0495674_0077296 3300047319 Bacteria 2862
356 Ga0495687_006005 3300047443 Bacteria 7568
357 Ga0496100_0050872 3300048903 Bacteria 2687
358 Ga0496100_0097812 3300048903 Bacteria 2016
359 Ga0496102_0009497 3300048905 Bacteria 8363
360 Ga0496102_0018936 3300048905 Bacteria 6057
361 Ga0496103_0012984 3300048906 Bacteria 4939
362 Ga0496103_0024840 3300048906 Bacteria 3617
363 Ga0496104_0000175 3300048907 Bacteria 56916
364 Ga0496104_0021666 3300048907 Bacteria 5902
365 Ga0496104_0106092 3300048907 Bacteria 2692
366 Ga0496105_0134251 3300048908 Bacteria 2039
367 Ga0496106_0008816 3300048909 Bacteria 7453
368 Ga0496106_0034124 3300048909 Bacteria 3799
369 Ga0496106_0179765 3300048909 Bacteria 1679
370 Ga0496107_0012112 3300048910 Bacteria 6015
371 Ga0496108_0023664 3300048911 Bacteria 5055
372 Ga0496109_0004749 3300048912 Bacteria 11355
373 Ga0496109_0042608 3300048912 Bacteria 4112
374 Ga0496109_0082174 3300048912 Bacteria 2969
375 Ga0496109_0131533 3300048912 Bacteria 2336
376 Ga0496110_0007879 3300048913 Bacteria 8532
377 Ga0496111_0023536 3300048914 Bacteria 4325
378 Ga0496111_0061346 3300048914 Bacteria 2726
379 Ga0496112_0002187 3300048915 Bacteria 15559
380 Ga0496112_0008682 3300048915 Bacteria 9112
381 Ga0496113_0001486 3300048916 Bacteria 13109
382 Ga0496113_0014566 3300048916 Bacteria 5369
383 Ga0496113_0070155 3300048916 Bacteria 2663
384 Ga0496114_0069822 3300048917 Bacteria 2950
385 Ga0496114_0181138 3300048917 Bacteria 1840
386 Ga0496115_0067833 3300048918 Bacteria 2886
387 Ga0496117_0031736 3300048920 Bacteria 4028
388 Ga0496119_0004645 3300048922 Bacteria 13551
389 Ga0496119_0013800 3300048922 Bacteria 6390
390 Ga0496122_0000262 3300048925 Bacteria 118706
391 Ga0496122_0008075 3300048925 Bacteria 11476
392 Ga0496122_0029909 3300048925 Bacteria 4579
393 Ga0496122_0067011 3300048925 Bacteria 2588
394 Ga0496123_0000288 3300048926 Bacteria 98492
395 Ga0496123_0014681 3300048926 Bacteria 6474
396 Ga0496124_0104954 3300048927 Bacteria 2284
397 Ga0496124_0108105 3300048927 Bacteria 2243
398 Ga0496126_0074572 3300048929 Bacteria 3013
399 Ga0501031_0033434 3300049568 Bacteria 3355
400 Ga0501031_0070497 3300049568 Bacteria 2277
401 Ga0501032_0000213 3300049569 Bacteria 48075
402 Ga0501033_0001058 3300049570 Bacteria 25160
403 Ga0501033_0162923 3300049570 Bacteria 1605
404 Ga0501034_0000569 3300049571 Bacteria 58487
405 Ga0501034_0197366 3300049571 Bacteria 1972
406 Ga0501034_0214180 3300049571 Bacteria 1881
407 Ga0501036_0000562 3300049572 Bacteria 26673
408 Ga0501036_0077577 3300049572 Bacteria 2811
409 Ga0501037_0000791 3300049573 Bacteria 23790
410 Ga0501038_0000124 3300049574 Bacteria 64786
411 Ga0501039_0000095 3300049575 Bacteria 61547
412 Ga0501040_0013785 3300049576 Bacteria 5320
413 Ga0501041_0014379 3300049577 Bacteria 4699
414 Ga0501041_0019003 3300049577 Bacteria 4096
415 Ga0501041_0024679 3300049577 Bacteria 3609
416 Ga0501041_0042515 3300049577 Bacteria 2762
417 Ga0501041_0055231 3300049577 Bacteria 2424
418 Ga0501041_0093527 3300049577 Bacteria 1857
419 Ga0501042_0028248 3300049578 Bacteria 3950
420 Ga0501042_0035752 3300049578 Bacteria 3524
421 Ga0501043_0000331 3300049579 Bacteria 42804
422 Ga0501046_0026090 3300049580 Bacteria 4775
423 Ga0501046_0083188 3300049580 Bacteria 2471
424 Ga0501046_0122299 3300049580 Bacteria 1980
425 Ga0501046_0132433 3300049580 Bacteria 1890
426 Ga0501047_0044606 3300049581 Bacteria 4285
427 Ga0501047_0121208 3300049581 Bacteria 2497
428 Ga0501071_0046382 3300049587 Bacteria 3121
429 Ga0501072_0002449 3300049588 Bacteria 13904
430 Ga0501072_0096659 3300049588 Bacteria 2347
431 Ga0501074_0047223 3300049590 Bacteria 3113
432 Ga0501074_0049459 3300049590 Bacteria 3035
433 Ga0501074_0103936 3300049590 Bacteria 2033
434 Ga0501075_0005546 3300049591 Bacteria 8635
435 Ga0501075_0031141 3300049591 Bacteria 3958
436 Ga0501075_0115669 3300049591 Bacteria 2039
437 Ga0501076_0006832 3300049592 Bacteria 8281
438 Ga0501076_0016566 3300049592 Bacteria 5588
439 Ga0501077_0001851 3300049593 Bacteria 12783
440 Ga0501077_0012850 3300049593 Bacteria 5247
441 Ga0501079_0002659 3300049741 Bacteria 12995
442 Ga0501079_0012977 3300049741 Bacteria 6356
443 Ga0501079_0027392 3300049741 Bacteria 4369
444 Ga0501080_0018978 3300049742 Bacteria 6369
445 Ga0501081_0006081 3300049743 Bacteria 7822
446 Ga0501081_0032775 3300049743 Bacteria 3526
447 Ga0501081_0064150 3300049743 Bacteria 2551
448 Ga0501081_0088162 3300049743 Bacteria 2180
449 Ga0501081_0122768 3300049743 Bacteria 1851
450 Ga0501035_0000204 3300049822 Bacteria 72214
451 Ga0501044_0001177 3300049823 Bacteria 30995
452 Ga0501045_0006895 3300049824 Bacteria 7876
453 Ga0501045_0013562 3300049824 Bacteria 5758
454 Ga0501045_0123186 3300049824 Bacteria 1925
455 nmdc:mga03n38_11978_c1 3300050490 Bacteria 3248
456 nmdc:mga03n38_4296_c1 3300050490 Bacteria 4697
457 nmdc:mga03n38_53020_c1 3300050490 Bacteria 1817
458 nmdc:mga0yw44_1051_c1 3300050492 Bacteria 10615
459 nmdc:mga0k408_2154_c1 3300050493 Bacteria 10564
460 nmdc:mga06z11_13159_c1 3300050494 Bacteria 3624
461 nmdc:mga06z11_30336_c1 3300050494 Bacteria 2615
462 nmdc:mga06z11_4508_c1 3300050494 Bacteria 5485
463 nmdc:mga04h51_10456_c1 3300050495 Bacteria 2549
464 nmdc:mga04h51_3561_c1 3300050495 Bacteria 3794
465 nmdc:mga05p37_111908_c1 3300050507 Bacteria 3357
466 nmdc:mga05p37_130591_c1 3300050507 Bacteria 3082
467 nmdc:mga05p37_140_c1 3300050507 Bacteria 67571
468 nmdc:mga05p37_20594_c1 3300050507 Bacteria 7981
469 nmdc:mga05p37_95891_c1 3300050507 Bacteria 3654
470 nmdc:mga09592_278712_c1 3300050508 Bacteria 1450
471 nmdc:mga09592_32035_c1 3300050508 Bacteria 4382
472 nmdc:mga09592_52730_c1 3300050508 Bacteria 3433
473 nmdc:mga09592_59965_c1 3300050508 Bacteria 3217
474 nmdc:mga09592_6736_c1 3300050508 Bacteria 9346
475 nmdc:mga09592_8848_c1 3300050508 Bacteria 8189
476 nmdc:mga0qj67_194428_c1 3300050509 Bacteria 1648
477 nmdc:mga0qj67_41716_c1 3300050509 Bacteria 3610
478 nmdc:mga0qj67_48248_c1 3300050509 Bacteria 3364
479 nmdc:mga0qj67_6431_c1 3300050509 Bacteria 8635
480 nmdc:mga0qj67_75653_c1 3300050509 Bacteria 2691
481 nmdc:mga0qj67_9723_c1 3300050509 Bacteria 7163
482 nmdc:mga06r32_13686_c1 3300050510 Bacteria 5066
483 nmdc:mga06r32_1985_c1 3300050510 Bacteria 18277
484 nmdc:mga06r32_228430_c1 3300050510 Bacteria 1849
485 nmdc:mga06r32_251231_c1 3300050510 Bacteria 1756
486 nmdc:mga06r32_671_c1 3300050510 Bacteria 29849
487 nmdc:mga06r32_7252_c1 3300050510 Bacteria 9988
488 nmdc:mga06r32_916_c1 3300050510 Bacteria 26223
489 nmdc:mga08y16_100518_c1 3300050511 Bacteria 3011
490 nmdc:mga08y16_104_c1 3300050511 Bacteria 70280
491 nmdc:mga08y16_11150_c1 3300050511 Bacteria 9439
492 nmdc:mga08y16_14201_c1 3300050511 Bacteria 8381
493 nmdc:mga08y16_163743_c1 3300050511 Bacteria 2310
494 nmdc:mga08y16_20577_c1 3300050511 Bacteria 6965
495 nmdc:mga08y16_2230_c1 3300050511 Bacteria 19858
496 nmdc:mga08y16_37848_c1 3300050511 Bacteria 4503
497 nmdc:mga0n895_9510_c1 3300050512 Bacteria 8509
498 nmdc:mga0rr50_130231_c1 3300050513 Bacteria 2013
499 nmdc:mga08x19_39230_c1 3300050514 Bacteria 3010
500 nmdc:mga0a205_111754_c1 3300050515 Bacteria 2631
501 nmdc:mga0a205_2192_c1 3300050515 Bacteria 17192
502 nmdc:mga0sz30_28504_c1 3300050516 Bacteria 2298
503 Ga0500643_018347 3300053087 Bacteria 2324
504 Ga0500566_0001581 3300053094 Bacteria 13396
505 Ga0500641_0045087 3300053096 Bacteria 1795
506 Ga0500556_0000034 3300053104 Bacteria 145623
507 Ga0500557_000013 3300053105 Bacteria 108649
508 Ga0500594_0013566 3300053118 Bacteria 1938
509 Ga0500642_0002306 3300053130 Bacteria 5579
510 Ga0500568_0006725 3300053139 Bacteria 5746
511 Ga0500568_0015141 3300053139 Bacteria 3459
512 Ga0500616_0000072 3300053153 Bacteria 231471
513 Ga0500616_0012627 3300053153 Bacteria 4939
514 Ga0500616_0020555 3300053153 Bacteria 3707
515 Ga0500616_0026687 3300053153 Bacteria 3195
516 Ga0500622_0008312 3300053156 Bacteria 5816
517 Ga0500634_0011500 3300053161 Bacteria 4572
518 Ga0501084_0030829 3300054114 Bacteria 4483
519 Ga0501082_0024558 3300060353 Bacteria 5196
520 Ga0501082_0176882 3300060353 Bacteria 1856
521 Ga0530510_0019010 3300061734 Bacteria 4874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0121208 Ga0501047_0121208_886_2346 395
2 3300025938 Ga0207704_10001823 Ga0207704_1000182311 418
3 3300048922 Ga0496119_0013800 Ga0496119_0013800_2833_4335 420
4 3300049577 Ga0501041_0024679 Ga0501041_0024679_1793_3313 421
5 3300044673 Ga0453683_0023706 Ga0453683_0023706_1807_3318 423
6 3300053153 Ga0500616_0000072 Ga0500616_0000072_125158_126663 423
7 3300044712 Ga0453684_0019816 Ga0453684_0019816_7987_9489 424
8 3300048909 Ga0496106_0179765 Ga0496106_0179765_343_1656 425
9 3300050508 nmdc:mga09592_278712_c1 nmdc:mga09592_278712_c1_116_1429 425
10 3300050510 nmdc:mga06r32_228430_c1 nmdc:mga06r32_228430_c1_456_1823 425
11 3300049577 Ga0501041_0093527 Ga0501041_0093527_448_1845 429
12 3300042876 Ga0451577_0010686 Ga0451577_0010686_1922_3424 430
13 3300049591 Ga0501075_0031141 Ga0501075_0031141_2103_3665 430
14 3300049824 Ga0501045_0123186 Ga0501045_0123186_348_1910 430
15 3300005289 Ga0065704_10078884 Ga0065704_100788845 431
16 3300048912 Ga0496109_0131533 Ga0496109_0131533_684_2213 431
17 3300049570 Ga0501033_0162923 Ga0501033_0162923_14_1378 431
18 3300053153 Ga0500616_0012627 Ga0500616_0012627_1067_2464 431
19 3300005937 Ga0081455_10146849 Ga0081455_101468491 433
20 3300044712 Ga0453684_0235755 Ga0453684_0235755_220_1728 433
21 3300060353 Ga0501082_0176882 Ga0501082_0176882_64_1623 434
22 3300005983 Ga0081540_1000138 Ga0081540_100013810 435
23 3300045051 Ga0451576_0306475 Ga0451576_0306475_53_1555 435
24 3300044673 Ga0453683_0004697 Ga0453683_0004697_406_1914 436
25 3300049742 Ga0501080_0018978 Ga0501080_0018978_4439_5836 436
26 3300005564 Ga0070664_100000070 Ga0070664_10000007053 437
27 3300005577 Ga0068857_100026496 Ga0068857_1000264962 437
28 3300025291 Ga0209675_1000652 Ga0209675_100065210 437
29 3300025920 Ga0207649_10007863 Ga0207649_100078633 437
30 3300025945 Ga0207679_10016255 Ga0207679_100162552 437
31 3300025972 Ga0207668_10128684 Ga0207668_101286842 437
32 3300026116 Ga0207674_10019702 Ga0207674_100197023 437
33 3300028380 Ga0268265_10044017 Ga0268265_100440174 437
34 3300035088 Ga0373940_0030561 Ga0373940_0030561_23_1342 437
35 3300042876 Ga0451577_0035141 Ga0451577_0035141_2365_3867 437
36 3300045051 Ga0451576_0077496 Ga0451576_0077496_1522_3036 437
37 3300050509 nmdc:mga0qj67_75653_c1 nmdc:mga0qj67_75653_c1_1324_2670 437
38 3300049578 Ga0501042_0028248 Ga0501042_0028248_772_2277 438
39 3300049588 Ga0501072_0002449 Ga0501072_0002449_6572_8077 438
40 3300049591 Ga0501075_0005546 Ga0501075_0005546_6673_8178 438
41 3300049592 Ga0501076_0016566 Ga0501076_0016566_26_1531 438
42 3300049593 Ga0501077_0001851 Ga0501077_0001851_4377_5882 438
43 3300049741 Ga0501079_0027392 Ga0501079_0027392_417_1922 438
44 3300049743 Ga0501081_0006081 Ga0501081_0006081_5270_6775 438
45 3300009147 Ga0114129_10007147 Ga0114129_100071471 439
46 3300015261 Ga0182006_1035559 Ga0182006_10355592 439
47 3300027907 Ga0207428_10022749 Ga0207428_100227495 439
48 3300048927 Ga0496124_0108105 Ga0496124_0108105_77_1579 439
49 3300050507 nmdc:mga05p37_140_c1 nmdc:mga05p37_140_c1_37844_39349 439
50 3300050508 nmdc:mga09592_59965_c1 nmdc:mga09592_59965_c1_1604_3109 439
51 3300050510 nmdc:mga06r32_671_c1 nmdc:mga06r32_671_c1_28070_29575 439
52 3300050511 nmdc:mga08y16_104_c1 nmdc:mga08y16_104_c1_12248_13753 439
53 3300006914 Ga0075436_100063989 Ga0075436_1000639892 440
54 3300039437 Ga0436365_1057605 Ga0436365_1057605_16462_17961 440
55 3300050514 nmdc:mga08x19_39230_c1 nmdc:mga08x19_39230_c1_555_2063 440
56 3300053105 Ga0500557_000013 Ga0500557_000013_11691_13190 440
57 3300025933 Ga0207706_10015506 Ga0207706_100155064 441
58 3300006846 Ga0075430_100031880 Ga0075430_1000318803 442
59 3300006847 Ga0075431_100002212 Ga0075431_10000221212 442
60 3300044712 Ga0453684_0051355 Ga0453684_0051355_3452_4945 442
61 3300050509 nmdc:mga0qj67_48248_c1 nmdc:mga0qj67_48248_c1_92_1612 442
62 3300050510 nmdc:mga06r32_1985_c1 nmdc:mga06r32_1985_c1_10670_12190 442
63 3300005844 Ga0068862_100070167 Ga0068862_1000701672 443
64 3300005937 Ga0081455_10045767 Ga0081455_100457673 443
65 3300006042 Ga0075368_10001912 Ga0075368_100019123 443
66 3300006048 Ga0075363_100010116 Ga0075363_1000101163 443
67 3300006178 Ga0075367_10000458 Ga0075367_100004586 443
68 3300027866 Ga0209813_10000917 Ga0209813_100009175 443
69 3300050490 nmdc:mga03n38_4296_c1 nmdc:mga03n38_4296_c1_3023_4588 443
70 3300050494 nmdc:mga06z11_4508_c1 nmdc:mga06z11_4508_c1_621_2186 443
71 3300050495 nmdc:mga04h51_10456_c1 nmdc:mga04h51_10456_c1_142_1707 443
72 3300006048 Ga0075363_100056132 Ga0075363_1000561321 444
73 3300009177 Ga0105248_10002756 Ga0105248_1000275617 444
74 3300009553 Ga0105249_10048906 Ga0105249_100489062 444
75 3300010375 Ga0105239_10019062 Ga0105239_100190627 444
76 3300025299 Ga0209256_1002092 Ga0209256_100209211 444
77 3300025904 Ga0207647_10001418 Ga0207647_1000141815 444
78 3300025941 Ga0207711_10072150 Ga0207711_100721503 444
79 3300026035 Ga0207703_10062636 Ga0207703_100626363 444
80 3300046522 Ga0495643_0021918 Ga0495643_0021918_89_1588 444
81 3300047443 Ga0495687_006005 Ga0495687_006005_2466_3965 444
82 3300048906 Ga0496103_0024840 Ga0496103_0024840_979_2478 444
83 3300048911 Ga0496108_0023664 Ga0496108_0023664_89_1588 444
84 3300048915 Ga0496112_0002187 Ga0496112_0002187_10544_12043 444
85 3300049580 Ga0501046_0122299 Ga0501046_0122299_220_1722 444
86 3300050490 nmdc:mga03n38_53020_c1 nmdc:mga03n38_53020_c1_230_1795 444
87 3300050494 nmdc:mga06z11_30336_c1 nmdc:mga06z11_30336_c1_495_2060 444
88 3300005981 Ga0081538_10022286 Ga0081538_100222862 445
89 3300006880 Ga0075429_100007998 Ga0075429_10000799810 445
90 3300009093 Ga0105240_10001320 Ga0105240_100013204 445
91 3300009147 Ga0114129_10022728 Ga0114129_100227282 445
92 3300009545 Ga0105237_10001216 Ga0105237_100012164 445
93 3300010375 Ga0105239_10055172 Ga0105239_100551722 445
94 3300013104 Ga0157370_10055235 Ga0157370_100552352 445
95 3300013105 Ga0157369_10004683 Ga0157369_100046835 445
96 3300025911 Ga0207654_10083195 Ga0207654_100831951 445
97 3300025913 Ga0207695_10000008 Ga0207695_10000008311 445
98 3300025914 Ga0207671_10012665 Ga0207671_100126652 445
99 3300025921 Ga0207652_10036748 Ga0207652_100367484 445
100 3300025927 Ga0207687_10102511 Ga0207687_101025112 445
101 3300026116 Ga0207674_10023774 Ga0207674_100237744 445
102 3300048916 Ga0496113_0014566 Ga0496113_0014566_12_1406 445
103 3300050508 nmdc:mga09592_32035_c1 nmdc:mga09592_32035_c1_2245_3747 445
104 3300050509 nmdc:mga0qj67_194428_c1 nmdc:mga0qj67_194428_c1_11_1378 445
105 3300050509 nmdc:mga0qj67_6431_c1 nmdc:mga0qj67_6431_c1_3051_4553 445
106 3300005983 Ga0081540_1002355 Ga0081540_100235522 446
107 3300006847 Ga0075431_100234318 Ga0075431_1002343181 446
108 3300044673 Ga0453683_0024066 Ga0453683_0024066_1063_2565 446
109 3300050510 nmdc:mga06r32_251231_c1 nmdc:mga06r32_251231_c1_74_1576 446
110 iso_pu_bacteria 2816332139 2816510378 446
111 iso_pu_bacteria 2974315732 2974316234 446
112 iso_pu_bacteria 2984523437 2984524396 446
113 3300006844 Ga0075428_100027939 Ga0075428_1000279397 447
114 3300006846 Ga0075430_100108586 Ga0075430_1001085862 447
115 3300042001 Ga0439441_000490 Ga0439441_000490_1870_3369 447
116 3300042437 Ga0439444_0003050 Ga0439444_0003050_628_2127 447
117 3300042461 Ga0439460_0001689 Ga0439460_0001689_2116_3615 447
118 3300044712 Ga0453684_0040138 Ga0453684_0040138_2981_4489 447
119 3300044712 Ga0453684_0182513 Ga0453684_0182513_690_2183 447
120 3300053139 Ga0500568_0006725 Ga0500568_0006725_2525_4021 447
121 3300049743 Ga0501081_0088162 Ga0501081_0088162_269_1771 448
122 3300049824 Ga0501045_0013562 Ga0501045_0013562_224_1726 448
123 iso_pu_bacteria 2834578030 2834580989 448
124 3300037466 Ga0395898_0016137 Ga0395898_0016137_159_1661 449
125 3300049590 Ga0501074_0047223 Ga0501074_0047223_949_2451 449
126 3300050511 nmdc:mga08y16_20577_c1 nmdc:mga08y16_20577_c1_5464_6951 449
127 iso_pu_bacteria 2844104063 2844110147 449
128 iso_pu_bacteria 2851246043 2851251809 449
129 3300006195 Ga0075366_10012366 Ga0075366_100123663 450
130 3300006847 Ga0075431_100001046 Ga0075431_10000104616 450
131 3300006847 Ga0075431_100057085 Ga0075431_1000570853 450
132 3300006880 Ga0075429_100006836 Ga0075429_1000068367 450
133 3300044712 Ga0453684_0291383 Ga0453684_0291383_125_1648 450
134 3300050493 nmdc:mga0k408_2154_c1 nmdc:mga0k408_2154_c1_2946_4445 450
135 3300050508 nmdc:mga09592_6736_c1 nmdc:mga09592_6736_c1_2198_3754 450
136 3300050509 nmdc:mga0qj67_9723_c1 nmdc:mga0qj67_9723_c1_2407_3912 450
137 3300050510 nmdc:mga06r32_7252_c1 nmdc:mga06r32_7252_c1_6801_8357 450
138 3300053156 Ga0500622_0008312 Ga0500622_0008312_2485_3978 450
139 iso_pu_bacteria 2899275550 2899277770 450
140 3300006871 Ga0075434_100011486 Ga0075434_1000114863 451
141 3300006871 Ga0075434_100078714 Ga0075434_1000787142 451
142 3300042876 Ga0451577_0067134 Ga0451577_0067134_1624_3141 451
143 3300044712 Ga0453684_0118542 Ga0453684_0118542_118_1629 451
144 3300045051 Ga0451576_0258642 Ga0451576_0258642_96_1598 451
145 3300053130 Ga0500642_0002306 Ga0500642_0002306_2929_4431 451
146 iso_pu_bacteria 8055225921 8055228894 451
147 3300044712 Ga0453684_0003907 Ga0453684_0003907_20867_22375 452
148 3300044712 Ga0453684_0022335 Ga0453684_0022335_4473_5984 452
149 3300044712 Ga0453684_0051226 Ga0453684_0051226_3347_4876 452
150 3300046512 Ga0495610_0046770 Ga0495610_0046770_97_1596 452
151 3300050516 nmdc:mga0sz30_28504_c1 nmdc:mga0sz30_28504_c1_307_1806 452
152 3300053153 Ga0500616_0020555 Ga0500616_0020555_1438_2940 452
153 3300053153 Ga0500616_0026687 Ga0500616_0026687_324_1823 452
154 iso_pu_bacteria 2513237140 2513884850 452
155 iso_pu_bacteria 2751185800 2753357006 452
156 iso_pu_bacteria 2818991439 2819562414 452
157 iso_pu_bacteria 2818991467 2819717011 452
158 iso_pu_bacteria 2842694124 2842695545 452
159 iso_pu_bacteria 2847930680 2847936839 452
160 iso_pu_bacteria 2848858292 2848865037 452
161 iso_pu_bacteria 2879083081 2879087695 452
162 iso_pu_bacteria 2984509177 2984514168 452
163 iso_pu_bacteria 2984518228 2984523199 452
164 iso_pu_bacteria 2984537506 2984542265 452
165 iso_pu_bacteria 8006984368 8006984782 452
166 3300005983 Ga0081540_1000024 Ga0081540_1000024127 453
167 3300006051 Ga0075364_10026856 Ga0075364_100268564 453
168 3300007076 Ga0075435_100019956 Ga0075435_1000199563 453
169 3300007265 Ga0099794_10052294 Ga0099794_100522941 453
170 3300009094 Ga0111539_10035683 Ga0111539_100356834 453
171 3300009094 Ga0111539_10128373 Ga0111539_101283731 453
172 3300027907 Ga0207428_10032520 Ga0207428_100325203 453
173 3300027907 Ga0207428_10068584 Ga0207428_100685841 453
174 3300035090 Ga0373949_0012870 Ga0373949_0012870_208_1719 453
175 3300035114 Ga0373939_0004731 Ga0373939_0004731_79_1590 453
176 3300035121 Ga0373960_0016399 Ga0373960_0016399_304_1803 453
177 3300035691 Ga0373931_0001100 Ga0373931_0001100_9441_10940 453
178 3300035691 Ga0373931_0043242 Ga0373931_0043242_750_2261 453
179 3300050510 nmdc:mga06r32_916_c1 nmdc:mga06r32_916_c1_6049_7551 453
180 3300050511 nmdc:mga08y16_11150_c1 nmdc:mga08y16_11150_c1_2004_3512 453
181 3300050512 nmdc:mga0n895_9510_c1 nmdc:mga0n895_9510_c1_5770_7281 453
182 3300050515 nmdc:mga0a205_2192_c1 nmdc:mga0a205_2192_c1_13432_14943 453
183 iso_pu_bacteria 2508501114 2509079465 453
184 iso_pu_bacteria 2510917026 2511169645 453
185 iso_pu_bacteria 2510917026 2511173090 453
186 iso_pu_bacteria 2513237159 2514001795 453
187 iso_pu_bacteria 2537561587 2537873020 453
188 iso_pu_bacteria 2558860983 2561469316 453
189 iso_pu_bacteria 2582581283 2585168687 453
190 iso_pu_bacteria 2599185156 2599334283 453
191 iso_pu_bacteria 2643221557 2643806183 453
192 iso_pu_bacteria 2643221558 2643814140 453
193 iso_pu_bacteria 2643221582 2643916788 453
194 iso_pu_bacteria 2643221610 2644070213 453
195 iso_pu_bacteria 2643221668 2644377445 453
196 iso_pu_bacteria 2643221675 2644420975 453
197 iso_pu_bacteria 2643221680 2644454498 453
198 iso_pu_bacteria 2643221726 2644692436 453
199 iso_pu_bacteria 2643221733 2644727908 453
200 iso_pu_bacteria 2643221734 2644733715 453
201 iso_pu_bacteria 2643221736 2644742186 453
202 iso_pu_bacteria 2773857925 2774873347 453
203 iso_pu_bacteria 2775506901 2776261913 453
204 iso_pu_bacteria 2775506901 2776264913 453
205 iso_pu_bacteria 2802429633 2806048172 453
206 iso_pu_bacteria 2829745981 2829747281 453
207 iso_pu_bacteria 2835312727 2835320117 453
208 iso_pu_bacteria 2838675328 2838678395 453
209 iso_pu_bacteria 2838714209 2838716697 453
210 iso_pu_bacteria 2838719591 2838722691 453
211 iso_pu_bacteria 2838724970 2838727448 453
212 iso_pu_bacteria 2841760612 2841763604 453
213 iso_pu_bacteria 2841846520 2841849078 453
214 iso_pu_bacteria 2841859092 2841861899 453
215 iso_pu_bacteria 2841911363 2841916702 453
216 iso_pu_bacteria 2841917233 2841917463 453
217 iso_pu_bacteria 2842124991 2842128173 453
218 iso_pu_bacteria 2842130223 2842133288 453
219 iso_pu_bacteria 2842152218 2842155281 453
220 iso_pu_bacteria 2842170452 2842173781 453
221 iso_pu_bacteria 2842175837 2842178902 453
222 iso_pu_bacteria 2842187318 2842189805 453
223 iso_pu_bacteria 2842211629 2842214119 453
224 iso_pu_bacteria 2842224351 2842226839 453
225 iso_pu_bacteria 2842515876 2842517835 453
226 iso_pu_bacteria 2842521101 2842527304 453
227 iso_pu_bacteria 2842698319 2842699488 453
228 iso_pu_bacteria 2842922631 2842925435 453
229 iso_pu_bacteria 2844104063 2844109492 453
230 iso_pu_bacteria 2846952575 2846958616 453
231 iso_pu_bacteria 2851182111 2851182854 453
232 iso_pu_bacteria 2851246043 2851251599 453
233 iso_pu_bacteria 2857531043 2857537068 453
234 iso_pu_bacteria 2882456835 2882457132 453
235 iso_pu_bacteria 2882456835 2882459610 453
236 iso_pu_bacteria 2884298095 2884299143 453
237 iso_pu_bacteria 2894232714 2894241172 453
238 iso_pu_bacteria 2899792073 2899792986 453
239 iso_pu_bacteria 2917699015 2917701484 453
240 iso_pu_bacteria 2919114240 2919116914 453
241 iso_pu_bacteria 2919114240 2919119058 453
242 iso_pu_bacteria 2919171160 2919177288 453
243 iso_pu_bacteria 2919450847 2919453607 453
244 iso_pu_bacteria 2926754445 2926758427 453
245 iso_pu_bacteria 2933006813 2933009340 453
246 iso_pu_bacteria 2933011516 2933013464 453
247 iso_pu_bacteria 8003570095 8003573126 453
248 iso_pu_bacteria 8005246636 8005247924 453
249 iso_pu_bacteria 8024479707 8024484700 453
250 iso_pu_bacteria 8057529695 8057534465 453
251 3300003187 JGI25151J46595_10000022 JGI25151J46595_10000022162 454
252 3300003771 Ga0055526_1000912 Ga0055526_10009128 454
253 3300003775 Ga0055524_1000055 Ga0055524_1000055111 454
254 3300005545 Ga0070695_100001925 Ga0070695_1000019256 454
255 3300005937 Ga0081455_10000689 Ga0081455_1000068945 454
256 3300006844 Ga0075428_100005672 Ga0075428_1000056725 454
257 3300009147 Ga0114129_10110410 Ga0114129_101104103 454
258 3300025291 Ga0209675_1001032 Ga0209675_10010324 454
259 3300025294 Ga0209025_1000016 Ga0209025_1000016707 454
260 3300025295 Ga0209564_1000034 Ga0209564_1000034124 454
261 3300025299 Ga0209256_1000026 Ga0209256_1000026112 454
262 3300026118 Ga0207675_100066676 Ga0207675_1000666762 454
263 3300035724 Ga0373933_0040774 Ga0373933_0040774_254_1756 454
264 3300046491 Ga0495584_0035968 Ga0495584_0035968_862_2373 454
265 3300049588 Ga0501072_0096659 Ga0501072_0096659_182_1696 454
266 3300049590 Ga0501074_0103936 Ga0501074_0103936_459_1973 454
267 3300049593 Ga0501077_0012850 Ga0501077_0012850_373_1887 454
268 3300049741 Ga0501079_0002659 Ga0501079_0002659_3029_4543 454
269 3300050507 nmdc:mga05p37_95891_c1 nmdc:mga05p37_95891_c1_1315_2826 454
270 3300053087 Ga0500643_018347 Ga0500643_018347_786_2291 454
271 3300053139 Ga0500568_0015141 Ga0500568_0015141_1680_3221 454
272 3300005844 Ga0068862_100026701 Ga0068862_1000267013 455
273 3300005983 Ga0081540_1003233 Ga0081540_100323312 455
274 3300009147 Ga0114129_10148426 Ga0114129_101484263 455
275 3300035692 Ga0373935_0018083 Ga0373935_0018083_1304_2809 455
276 3300042876 Ga0451577_0015386 Ga0451577_0015386_3738_5246 455
277 3300046460 Ga0495638_0041259 Ga0495638_0041259_141_1640 455
278 3300046533 Ga0495640_0009751 Ga0495640_0009751_3021_4526 455
279 3300047319 Ga0495674_0077296 Ga0495674_0077296_719_2224 455
280 3300048903 Ga0496100_0050872 Ga0496100_0050872_381_1889 455
281 3300048907 Ga0496104_0021666 Ga0496104_0021666_3171_4679 455
282 3300048912 Ga0496109_0082174 Ga0496109_0082174_990_2498 455
283 3300048916 Ga0496113_0001486 Ga0496113_0001486_11431_12969 455
284 3300048917 Ga0496114_0069822 Ga0496114_0069822_331_1839 455
285 3300048927 Ga0496124_0104954 Ga0496124_0104954_349_1848 455
286 3300049568 Ga0501031_0070497 Ga0501031_0070497_357_1859 455
287 3300049577 Ga0501041_0019003 Ga0501041_0019003_802_2304 455
288 3300049577 Ga0501041_0055231 Ga0501041_0055231_73_1590 455
289 3300049580 Ga0501046_0026090 Ga0501046_0026090_876_2378 455
290 3300049580 Ga0501046_0132433 Ga0501046_0132433_303_1820 455
291 3300049592 Ga0501076_0006832 Ga0501076_0006832_6537_8039 455
292 3300049743 Ga0501081_0032775 Ga0501081_0032775_1842_3359 455
293 3300049743 Ga0501081_0064150 Ga0501081_0064150_995_2497 455
294 3300050507 nmdc:mga05p37_130591_c1 nmdc:mga05p37_130591_c1_1115_2620 455
295 3300050511 nmdc:mga08y16_14201_c1 nmdc:mga08y16_14201_c1_3279_4784 455
296 3300053118 Ga0500594_0013566 Ga0500594_0013566_206_1705 455
297 3300003775 Ga0055524_1000789 Ga0055524_10007898 456
298 3300005336 Ga0070680_100010016 Ga0070680_1000100163 456
299 3300005337 Ga0070682_100030445 Ga0070682_1000304453 456
300 3300005438 Ga0070701_10010152 Ga0070701_100101523 456
301 3300005440 Ga0070705_100001394 Ga0070705_1000013943 456
302 3300005441 Ga0070700_100006271 Ga0070700_1000062712 456
303 3300005455 Ga0070663_100006702 Ga0070663_1000067024 456
304 3300005455 Ga0070663_100007946 Ga0070663_1000079462 456
305 3300005458 Ga0070681_10038882 Ga0070681_100388823 456
306 3300005518 Ga0070699_100011469 Ga0070699_1000114693 456
307 3300005530 Ga0070679_100147502 Ga0070679_1001475022 456
308 3300005545 Ga0070695_100003492 Ga0070695_1000034925 456
309 3300005546 Ga0070696_100001543 Ga0070696_1000015439 456
310 3300005615 Ga0070702_100004734 Ga0070702_1000047343 456
311 3300005617 Ga0068859_100010949 Ga0068859_1000109498 456
312 3300005842 Ga0068858_100188655 Ga0068858_1001886551 456
313 3300005843 Ga0068860_100005241 Ga0068860_1000052418 456
314 3300005937 Ga0081455_10000063 Ga0081455_1000006331 456
315 3300005937 Ga0081455_10027794 Ga0081455_100277943 456
316 3300006038 Ga0075365_10004579 Ga0075365_100045794 456
317 3300006048 Ga0075363_100019142 Ga0075363_1000191423 456
318 3300006844 Ga0075428_100017973 Ga0075428_1000179734 456
319 3300006847 Ga0075431_100039393 Ga0075431_1000393934 456
320 3300006852 Ga0075433_10066374 Ga0075433_100663743 456
321 3300006871 Ga0075434_100048325 Ga0075434_1000483254 456
322 3300006871 Ga0075434_100233517 Ga0075434_1002335171 456
323 3300006931 Ga0097620_100010949 Ga0097620_1000109498 456
324 3300009094 Ga0111539_10054669 Ga0111539_100546696 456
325 3300009147 Ga0114129_10155040 Ga0114129_101550403 456
326 3300009174 Ga0105241_10052544 Ga0105241_100525442 456
327 3300013250 Ga0171462_1009 Ga0171462_1009178 456
328 3300013296 Ga0157374_10069178 Ga0157374_100691782 456
329 3300025294 Ga0209025_1035429 Ga0209025_10354292 456
330 3300025295 Ga0209564_1000019 Ga0209564_1000019122 456
331 3300025299 Ga0209256_1000027 Ga0209256_1000027366 456
332 3300025299 Ga0209256_1000188 Ga0209256_1000188102 456
333 3300025885 Ga0207653_10001405 Ga0207653_100014053 456
334 3300025911 Ga0207654_10079477 Ga0207654_100794772 456
335 3300025912 Ga0207707_10009982 Ga0207707_100099823 456
336 3300025917 Ga0207660_10026035 Ga0207660_100260352 456
337 3300025921 Ga0207652_10117552 Ga0207652_101175522 456
338 3300025945 Ga0207679_10131949 Ga0207679_101319492 456
339 3300025961 Ga0207712_10006160 Ga0207712_100061604 456
340 3300026067 Ga0207678_10013419 Ga0207678_100134194 456
341 3300026067 Ga0207678_10016462 Ga0207678_100164622 456
342 3300026067 Ga0207678_10092716 Ga0207678_100927162 456
343 3300026075 Ga0207708_10011729 Ga0207708_100117292 456
344 3300026095 Ga0207676_10020791 Ga0207676_100207913 456
345 3300026116 Ga0207674_10005484 Ga0207674_100054849 456
346 3300027866 Ga0209813_10004592 Ga0209813_100045923 456
347 3300028380 Ga0268265_10011245 Ga0268265_100112454 456
348 3300028381 Ga0268264_10006929 Ga0268264_100069298 456
349 3300031548 Ga0307408_100092288 Ga0307408_1000922882 456
350 3300031616 Ga0307508_10017911 Ga0307508_100179115 456
351 3300032004 Ga0307414_10016785 Ga0307414_100167852 456
352 3300032126 Ga0307415_100109850 Ga0307415_1001098502 456
353 3300037853 Ga0436364_1543814 Ga0436364_1543814_350_1855 456
354 3300041404 Ga0439436_0000681 Ga0439436_0000681_2516_4018 456
355 3300041405 Ga0439438_012453 Ga0439438_012453_979_2481 456
356 3300041408 Ga0439453_0004580 Ga0439453_0004580_31_1530 456
357 3300041411 Ga0439466_0031122 Ga0439466_0031122_31_1533 456
358 3300042001 Ga0439441_004700 Ga0439441_004700_495_1994 456
359 3300042003 Ga0439443_000697 Ga0439443_000697_1019_2518 456
360 3300042436 Ga0439435_0001851 Ga0439435_0001851_1387_2886 456
361 3300042437 Ga0439444_0005458 Ga0439444_0005458_281_1780 456
362 3300042461 Ga0439460_0013826 Ga0439460_0013826_31_1530 456
363 3300042531 Ga0450918_003352 Ga0450918_003352_181_1683 456
364 3300042876 Ga0451577_0000130 Ga0451577_0000130_45560_47062 456
365 3300044673 Ga0453683_0007131 Ga0453683_0007131_4180_5682 456
366 3300044673 Ga0453683_0018184 Ga0453683_0018184_2992_4494 456
367 3300044712 Ga0453684_0000301 Ga0453684_0000301_66896_68398 456
368 3300045051 Ga0451576_0001769 Ga0451576_0001769_4221_5723 456
369 3300045051 Ga0451576_0020273 Ga0451576_0020273_2610_4112 456
370 3300048903 Ga0496100_0097812 Ga0496100_0097812_266_1783 456
371 3300048905 Ga0496102_0009497 Ga0496102_0009497_5149_6666 456
372 3300048907 Ga0496104_0000175 Ga0496104_0000175_5402_6967 456
373 3300048907 Ga0496104_0106092 Ga0496104_0106092_835_2340 456
374 3300048908 Ga0496105_0134251 Ga0496105_0134251_450_1955 456
375 3300048909 Ga0496106_0008816 Ga0496106_0008816_2634_4151 456
376 3300048910 Ga0496107_0012112 Ga0496107_0012112_1423_2940 456
377 3300048912 Ga0496109_0004749 Ga0496109_0004749_7839_9404 456
378 3300048913 Ga0496110_0007879 Ga0496110_0007879_1450_3015 456
379 3300048914 Ga0496111_0023536 Ga0496111_0023536_1671_3236 456
380 3300048914 Ga0496111_0061346 Ga0496111_0061346_1053_2561 456
381 3300048917 Ga0496114_0181138 Ga0496114_0181138_130_1635 456
382 3300048918 Ga0496115_0067833 Ga0496115_0067833_859_2364 456
383 3300048920 Ga0496117_0031736 Ga0496117_0031736_375_1874 456
384 3300048922 Ga0496119_0004645 Ga0496119_0004645_4622_6127 456
385 3300048925 Ga0496122_0000262 Ga0496122_0000262_11820_13325 456
386 3300048925 Ga0496122_0008075 Ga0496122_0008075_952_2460 456
387 3300048925 Ga0496122_0029909 Ga0496122_0029909_1980_3479 456
388 3300048926 Ga0496123_0000288 Ga0496123_0000288_92880_94385 456
389 3300048926 Ga0496123_0014681 Ga0496123_0014681_3291_4790 456
390 3300049568 Ga0501031_0033434 Ga0501031_0033434_53_1558 456
391 3300049569 Ga0501032_0000213 Ga0501032_0000213_9937_11442 456
392 3300049570 Ga0501033_0001058 Ga0501033_0001058_9957_11462 456
393 3300049571 Ga0501034_0000569 Ga0501034_0000569_36656_38161 456
394 3300049571 Ga0501034_0197366 Ga0501034_0197366_420_1928 456
395 3300049571 Ga0501034_0214180 Ga0501034_0214180_297_1796 456
396 3300049572 Ga0501036_0000562 Ga0501036_0000562_9520_11025 456
397 3300049572 Ga0501036_0077577 Ga0501036_0077577_29_1528 456
398 3300049573 Ga0501037_0000791 Ga0501037_0000791_12336_13841 456
399 3300049574 Ga0501038_0000124 Ga0501038_0000124_9955_11460 456
400 3300049575 Ga0501039_0000095 Ga0501039_0000095_17647_19152 456
401 3300049576 Ga0501040_0013785 Ga0501040_0013785_2264_3763 456
402 3300049577 Ga0501041_0014379 Ga0501041_0014379_1433_2932 456
403 3300049577 Ga0501041_0042515 Ga0501041_0042515_444_1943 456
404 3300049578 Ga0501042_0035752 Ga0501042_0035752_969_2468 456
405 3300049579 Ga0501043_0000331 Ga0501043_0000331_20323_21828 456
406 3300049580 Ga0501046_0083188 Ga0501046_0083188_104_1603 456
407 3300049581 Ga0501047_0044606 Ga0501047_0044606_344_1855 456
408 3300049587 Ga0501071_0046382 Ga0501071_0046382_1036_2535 456
409 3300049590 Ga0501074_0049459 Ga0501074_0049459_1279_2778 456
410 3300049591 Ga0501075_0115669 Ga0501075_0115669_437_1936 456
411 3300049741 Ga0501079_0012977 Ga0501079_0012977_3452_4951 456
412 3300049743 Ga0501081_0122768 Ga0501081_0122768_104_1603 456
413 3300049822 Ga0501035_0000204 Ga0501035_0000204_21516_23021 456
414 3300049823 Ga0501044_0001177 Ga0501044_0001177_3631_5130 456
415 3300049824 Ga0501045_0006895 Ga0501045_0006895_1635_3134 456
416 3300050490 nmdc:mga03n38_11978_c1 nmdc:mga03n38_11978_c1_545_2110 456
417 3300050492 nmdc:mga0yw44_1051_c1 nmdc:mga0yw44_1051_c1_5039_6604 456
418 3300050494 nmdc:mga06z11_13159_c1 nmdc:mga06z11_13159_c1_940_2505 456
419 3300050495 nmdc:mga04h51_3561_c1 nmdc:mga04h51_3561_c1_1275_2840 456
420 3300050507 nmdc:mga05p37_111908_c1 nmdc:mga05p37_111908_c1_1580_3085 456
421 3300050510 nmdc:mga06r32_13686_c1 nmdc:mga06r32_13686_c1_1233_2798 456
422 3300050511 nmdc:mga08y16_100518_c1 nmdc:mga08y16_100518_c1_274_1779 456
423 3300050515 nmdc:mga0a205_111754_c1 nmdc:mga0a205_111754_c1_484_1986 456
424 3300053094 Ga0500566_0001581 Ga0500566_0001581_10762_12261 456
425 3300053096 Ga0500641_0045087 Ga0500641_0045087_91_1602 456
426 3300053104 Ga0500556_0000034 Ga0500556_0000034_127550_129055 456
427 3300053161 Ga0500634_0011500 Ga0500634_0011500_949_2457 456
428 3300054114 Ga0501084_0030829 Ga0501084_0030829_2511_4010 456
429 3300060353 Ga0501082_0024558 Ga0501082_0024558_357_1856 456
430 3300002987 JGI25159J45721_1007505 JGI25159J45721_10075053 457
431 3300005262 Ga0065165_1000605 Ga0065165_100060553 457
432 3300005293 Ga0065715_10098135 Ga0065715_100981352 457
433 3300005327 Ga0070658_10065653 Ga0070658_100656532 457
434 3300005328 Ga0070676_10000280 Ga0070676_1000028020 457
435 3300005329 Ga0070683_100001003 Ga0070683_10000100317 457
436 3300005330 Ga0070690_100001092 Ga0070690_1000010923 457
437 3300005331 Ga0070670_100005274 Ga0070670_1000052744 457
438 3300005333 Ga0070677_10002172 Ga0070677_100021722 457
439 3300005334 Ga0068869_100004295 Ga0068869_1000042954 457
440 3300005335 Ga0070666_10003606 Ga0070666_100036063 457
441 3300005338 Ga0068868_100053608 Ga0068868_1000536082 457
442 3300005339 Ga0070660_100003198 Ga0070660_1000031985 457
443 3300005340 Ga0070689_100000505 Ga0070689_1000005054 457
444 3300005343 Ga0070687_100000384 Ga0070687_1000003845 457
445 3300005344 Ga0070661_100011847 Ga0070661_1000118473 457
446 3300005347 Ga0070668_100000287 Ga0070668_1000002874 457
447 3300005353 Ga0070669_100003878 Ga0070669_1000038784 457
448 3300005355 Ga0070671_100033213 Ga0070671_1000332133 457
449 3300005356 Ga0070674_100003288 Ga0070674_1000032884 457
450 3300005364 Ga0070673_100001873 Ga0070673_1000018735 457
451 3300005365 Ga0070688_100000091 Ga0070688_1000000914 457
452 3300005366 Ga0070659_100004822 Ga0070659_1000048224 457
453 3300005367 Ga0070667_100061588 Ga0070667_1000615883 457
454 3300005438 Ga0070701_10023768 Ga0070701_100237682 457
455 3300005440 Ga0070705_100009749 Ga0070705_1000097493 457
456 3300005441 Ga0070700_100011671 Ga0070700_1000116713 457
457 3300005456 Ga0070678_100002671 Ga0070678_1000026714 457
458 3300005457 Ga0070662_100001146 Ga0070662_10000114610 457
459 3300005459 Ga0068867_100038613 Ga0068867_1000386133 457
460 3300005466 Ga0070685_10000854 Ga0070685_100008544 457
461 3300005530 Ga0070679_100086515 Ga0070679_1000865152 457
462 3300005535 Ga0070684_100031272 Ga0070684_1000312722 457
463 3300005539 Ga0068853_100003745 Ga0068853_1000037453 457
464 3300005543 Ga0070672_100007581 Ga0070672_1000075814 457
465 3300005544 Ga0070686_100001694 Ga0070686_1000016945 457
466 3300005545 Ga0070695_100025378 Ga0070695_1000253782 457
467 3300005549 Ga0070704_100018124 Ga0070704_1000181242 457
468 3300005563 Ga0068855_100001311 Ga0068855_1000013113 457
469 3300005564 Ga0070664_100024123 Ga0070664_1000241233 457
470 3300005577 Ga0068857_100004925 Ga0068857_10000492510 457
471 3300005614 Ga0068856_100011570 Ga0068856_1000115702 457
472 3300005616 Ga0068852_100007906 Ga0068852_1000079063 457
473 3300005617 Ga0068859_100010967 Ga0068859_1000109674 457
474 3300005618 Ga0068864_100004901 Ga0068864_1000049014 457
475 3300005718 Ga0068866_10005676 Ga0068866_100056762 457
476 3300005719 Ga0068861_100013794 Ga0068861_1000137942 457
477 3300005719 Ga0068861_100050707 Ga0068861_1000507072 457
478 3300005834 Ga0068851_10000674 Ga0068851_100006743 457
479 3300005840 Ga0068870_10001116 Ga0068870_1000111610 457
480 3300005841 Ga0068863_100000798 Ga0068863_1000007986 457
481 3300005842 Ga0068858_100027299 Ga0068858_1000272994 457
482 3300005843 Ga0068860_100010806 Ga0068860_1000108063 457
483 3300005844 Ga0068862_100003018 Ga0068862_1000030183 457
484 3300005937 Ga0081455_10007153 Ga0081455_1000715312 457
485 3300006186 Ga0075369_10002639 Ga0075369_100026396 457
486 3300006237 Ga0097621_100001573 Ga0097621_1000015733 457
487 3300006844 Ga0075428_100005816 Ga0075428_1000058165 457
488 3300006846 Ga0075430_100014165 Ga0075430_1000141657 457
489 3300006847 Ga0075431_100004021 Ga0075431_10000402114 457
490 3300006871 Ga0075434_100034195 Ga0075434_1000341955 457
491 3300006880 Ga0075429_100005180 Ga0075429_1000051804 457
492 3300006880 Ga0075429_100010182 Ga0075429_1000101824 457
493 3300006881 Ga0068865_100000181 Ga0068865_1000001814 457
494 3300006931 Ga0097620_100010968 Ga0097620_1000109683 457
495 3300006948 Ga0099826_10006295 Ga0099826_100062952 457
496 3300009094 Ga0111539_10004562 Ga0111539_1000456212 457
497 3300009094 Ga0111539_10052538 Ga0111539_100525383 457
498 3300009094 Ga0111539_10289165 Ga0111539_102891652 457
499 3300009098 Ga0105245_10001569 Ga0105245_100015695 457
500 3300009101 Ga0105247_10000414 Ga0105247_1000041416 457
501 3300009147 Ga0114129_10000938 Ga0114129_1000093811 457
502 3300009147 Ga0114129_10265092 Ga0114129_102650922 457
503 3300009148 Ga0105243_10012884 Ga0105243_100128843 457
504 3300009174 Ga0105241_10005118 Ga0105241_100051184 457
505 3300009176 Ga0105242_10005737 Ga0105242_100057373 457
506 3300009177 Ga0105248_10045137 Ga0105248_100451373 457
507 3300009545 Ga0105237_10000336 Ga0105237_1000033642 457
508 3300009551 Ga0105238_10000424 Ga0105238_1000042430 457
509 3300009553 Ga0105249_10000352 Ga0105249_100003524 457
510 3300010375 Ga0105239_10046542 Ga0105239_100465422 457
511 3300011119 Ga0105246_10002039 Ga0105246_100020394 457
512 3300013100 Ga0157373_10003226 Ga0157373_100032265 457
513 3300013102 Ga0157371_10005222 Ga0157371_100052224 457
514 3300013105 Ga0157369_10009161 Ga0157369_100091613 457
515 3300013296 Ga0157374_10010885 Ga0157374_100108857 457
516 3300013297 Ga0157378_10005291 Ga0157378_100052914 457
517 3300013306 Ga0163162_10060083 Ga0163162_100600833 457
518 3300013308 Ga0157375_10025194 Ga0157375_100251942 457
519 3300014325 Ga0163163_10038070 Ga0163163_100380703 457
520 3300014745 Ga0157377_10000560 Ga0157377_100005604 457
521 3300014968 Ga0157379_10004705 Ga0157379_100047054 457
522 3300014969 Ga0157376_10006959 Ga0157376_100069593 457
523 3300025294 Ga0209025_1004076 Ga0209025_10040769 457
524 3300025297 Ga0209758_1000532 Ga0209758_10005324 457
525 3300025321 Ga0207656_10002946 Ga0207656_100029463 457
526 3300025893 Ga0207682_10000204 Ga0207682_1000020423 457
527 3300025900 Ga0207710_10002070 Ga0207710_100020703 457
528 3300025901 Ga0207688_10000201 Ga0207688_1000020118 457
529 3300025903 Ga0207680_10000671 Ga0207680_100006717 457
530 3300025904 Ga0207647_10003890 Ga0207647_100038903 457
531 3300025907 Ga0207645_10000133 Ga0207645_100001334 457
532 3300025908 Ga0207643_10000073 Ga0207643_100000734 457
533 3300025909 Ga0207705_10014657 Ga0207705_100146573 457
534 3300025911 Ga0207654_10017466 Ga0207654_100174663 457
535 3300025913 Ga0207695_10006360 Ga0207695_100063604 457
536 3300025914 Ga0207671_10010690 Ga0207671_100106903 457
537 3300025918 Ga0207662_10000810 Ga0207662_100008105 457
538 3300025919 Ga0207657_10000369 Ga0207657_1000036931 457
539 3300025920 Ga0207649_10001117 Ga0207649_100011172 457
540 3300025921 Ga0207652_10103014 Ga0207652_101030142 457
541 3300025923 Ga0207681_10000454 Ga0207681_100004543 457
542 3300025924 Ga0207694_10006184 Ga0207694_100061843 457
543 3300025925 Ga0207650_10000343 Ga0207650_1000034331 457
544 3300025926 Ga0207659_10000458 Ga0207659_1000045814 457
545 3300025927 Ga0207687_10004378 Ga0207687_100043784 457
546 3300025931 Ga0207644_10003498 Ga0207644_100034985 457
547 3300025933 Ga0207706_10006992 Ga0207706_100069924 457
548 3300025934 Ga0207686_10010811 Ga0207686_100108113 457
549 3300025935 Ga0207709_10021662 Ga0207709_100216623 457
550 3300025936 Ga0207670_10002350 Ga0207670_100023504 457
551 3300025937 Ga0207669_10001051 Ga0207669_100010516 457
552 3300025940 Ga0207691_10000325 Ga0207691_100003254 457
553 3300025941 Ga0207711_10005164 Ga0207711_100051644 457
554 3300025942 Ga0207689_10000265 Ga0207689_1000026531 457
555 3300025944 Ga0207661_10024475 Ga0207661_100244753 457
556 3300025945 Ga0207679_10000560 Ga0207679_100005604 457
557 3300025960 Ga0207651_10000109 Ga0207651_1000010924 457
558 3300025961 Ga0207712_10000490 Ga0207712_1000049023 457
559 3300025981 Ga0207640_10008040 Ga0207640_100080405 457
560 3300025986 Ga0207658_10000380 Ga0207658_100003804 457
561 3300026023 Ga0207677_10000355 Ga0207677_100003554 457
562 3300026035 Ga0207703_10000416 Ga0207703_100004165 457
563 3300026041 Ga0207639_10000472 Ga0207639_100004727 457
564 3300026067 Ga0207678_10000200 Ga0207678_1000020036 457
565 3300026075 Ga0207708_10013122 Ga0207708_100131223 457
566 3300026078 Ga0207702_10076109 Ga0207702_100761092 457
567 3300026088 Ga0207641_10005681 Ga0207641_100056815 457
568 3300026089 Ga0207648_10007749 Ga0207648_100077494 457
569 3300026095 Ga0207676_10001815 Ga0207676_1000181510 457
570 3300026116 Ga0207674_10000691 Ga0207674_100006913 457
571 3300026118 Ga0207675_100000010 Ga0207675_10000001048 457
572 3300026118 Ga0207675_100004507 Ga0207675_1000045074 457
573 3300026121 Ga0207683_10000116 Ga0207683_1000011646 457
574 3300026142 Ga0207698_10000880 Ga0207698_100008802 457
575 3300027312 Ga0209371_1000534 Ga0209371_10005344 457
576 3300027866 Ga0209813_10010243 Ga0209813_100102433 457
577 3300028379 Ga0268266_10006791 Ga0268266_100067914 457
578 3300028380 Ga0268265_10006012 Ga0268265_100060123 457
579 3300028381 Ga0268264_10000090 Ga0268264_1000009023 457
580 3300030500 Ga0268256_1001706 Ga0268256_100170612 457
581 3300031903 Ga0307407_10030589 Ga0307407_100305892 457
582 3300037068 Ga0373925_0051878 Ga0373925_0051878_734_2236 457
583 3300037471 Ga0395905_0010207 Ga0395905_0010207_6174_7679 457
584 3300038443 Ga0395901_0150393 Ga0395901_0150393_248_1750 457
585 3300044673 Ga0453683_0025337 Ga0453683_0025337_444_1946 457
586 3300044673 Ga0453683_0043708 Ga0453683_0043708_1067_2569 457
587 3300044712 Ga0453684_0000605 Ga0453684_0000605_35983_37485 457
588 3300044712 Ga0453684_0001202 Ga0453684_0001202_71659_73161 457
589 3300044712 Ga0453684_0034338 Ga0453684_0034338_2108_3610 457
590 3300044712 Ga0453684_0094873 Ga0453684_0094873_1316_2818 457
591 3300044712 Ga0453684_0177504 Ga0453684_0177504_717_2231 457
592 3300045051 Ga0451576_0038171 Ga0451576_0038171_1332_2834 457
593 3300048905 Ga0496102_0018936 Ga0496102_0018936_3548_5053 457
594 3300048906 Ga0496103_0012984 Ga0496103_0012984_437_1942 457
595 3300048909 Ga0496106_0034124 Ga0496106_0034124_1210_2715 457
596 3300048912 Ga0496109_0042608 Ga0496109_0042608_1471_2976 457
597 3300048915 Ga0496112_0008682 Ga0496112_0008682_5689_7194 457
598 3300048916 Ga0496113_0070155 Ga0496113_0070155_100_1605 457
599 3300048925 Ga0496122_0067011 Ga0496122_0067011_432_1934 457
600 3300048929 Ga0496126_0074572 Ga0496126_0074572_103_1614 457
601 3300050507 nmdc:mga05p37_20594_c1 nmdc:mga05p37_20594_c1_767_2269 457
602 3300050508 nmdc:mga09592_52730_c1 nmdc:mga09592_52730_c1_364_1869 457
603 3300050508 nmdc:mga09592_8848_c1 nmdc:mga09592_8848_c1_2269_3771 457
604 3300050509 nmdc:mga0qj67_41716_c1 nmdc:mga0qj67_41716_c1_1026_2531 457
605 3300050511 nmdc:mga08y16_163743_c1 nmdc:mga08y16_163743_c1_749_2290 457
606 3300050511 nmdc:mga08y16_2230_c1 nmdc:mga08y16_2230_c1_12618_14120 457
607 3300050511 nmdc:mga08y16_37848_c1 nmdc:mga08y16_37848_c1_1164_2666 457
608 3300050513 nmdc:mga0rr50_130231_c1 nmdc:mga0rr50_130231_c1_180_1682 457
609 3300061734 Ga0530510_0019010 Ga0530510_0019010_741_2243 457

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01970

TctA

Tripartite tricarboxylate transporter TctA family

34

452

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tsa-assembly1.cif.gz_A crystal structure of the zrt-/irt-like protein from bordetella bronchiseptica with bound zn2+ 0.2649 66 406
5tsa-assembly1.cif.gz_A crystal structure of the zrt-/irt-like protein from bordetella bronchiseptica with bound zn2+ 0.2608 66 406
5tsb-assembly1.cif.gz_A crystal structure of the zrt-/irt-like protein from bordetella bronchiseptica with bound cd2+ 0.2496 67 407
7z6n-assembly1.cif.gz_A crystal structure of zn2+-transporter bbzip in a metal-stripped state 0.244 23 448
7z6n-assembly1.cif.gz_A crystal structure of zn2+-transporter bbzip in a metal-stripped state 0.2429 23 448
ID Description Score Start End Superfamily
af_A0A1D8PLY7_278_479_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3698 128 380 1.20.1250.20
af_P0AE16_220_412_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3672 164 409 1.20.1250.20
af_P0AE16_220_412_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3512 164 409 1.20.1250.20
af_Q54IX9_285_503_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3364 127 412 1.20.1250.20
af_A0A1D8PLY7_278_479_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3274 128 380 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3N5WJC7-F1-model_v4 Tripartite tricarboxylate transporter permease 0.9712 49 449 GO:0016020
AF-A0A4Q5P4G1-F1-model_v4 Tripartite tricarboxylate transporter permease 0.9692 38 443 GO:0016020
AF-A0A316N295-F1-model_v4 Tricarboxylate transporter family protein 0.9652 6 449 GO:0016020
AF-A0A2G4JAS5-F1-model_v4 Transporter 0.9636 41 457 GO:0016020
AF-A0A4U0R884-F1-model_v4 Tripartite tricarboxylate transporter permease 0.9628 58 451 GO:0016020

Feature Viewer

pLDDT pTM Quality
83.28 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map