F468903

General Info

Members Datasets Scaffolds Average Seq Length
609 319 1218 196

Family's Representative Sequence

Representative Sequence 3300046642|Ga0495634_0028189|Ga0495634_0028189_890_1522
Length 210
Sequence MGHPLSTPQPLPGASQPGRRFALGLRLGAASLVVGLVLMLWALGGLRNVAAPAAIGGPFQLTDQTGQTVTDKNMQGHPTLIFFGFTHCPDVCPTTLFEISEVLRAMGKDADRVNAYYISVDPDRDTAAAMKDYLSSFDPRLKGLTGNPDQIAKVLSEYRVYARKVPLKDGDYTMDHTALVYLMDRDGKFVAPFNLNRKPEEAAADLKRFL

Samples

Sample ID Description Type Environment
1 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
127 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
130 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
132 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
147 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
225 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
243 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
248 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
271 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
275 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
276 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
277 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
278 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
279 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
280 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
281 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
282 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
283 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
284 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
285 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
286 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
287 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
288 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
289 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
290 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
291 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
292 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
293 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
294 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
295 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
296 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
297 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
298 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
299 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
300 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
301 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
302 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
303 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
304 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
305 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
306 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
307 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
308 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
309 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
310 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
311 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
312 2904699407
313 2906610324
314 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
315 2922425934
316 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
317 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
318 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
319 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.7
Metatranscriptomes 1.16
Isolates 2.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.03
Nodule 1.81
Rhizoplane 5.42
Rhizosphere 74.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495634_0028189 3300046642 Bacteria 3900
2 LJQas_1013150 3300000549 Bacteria 975
3 JGI25406J46586_10000059 3300003203 Bacteria 50077
4 JGI25404J52841_10006835 3300003659 Bacteria 2396
5 Ga0070658_10128022 3300005327 Bacteria 2115
6 Ga0070658_10392483 3300005327 Bacteria 1191
7 Ga0070658_11043491 3300005327 Bacteria 711
8 Ga0070683_100021895 3300005329 Bacteria 5707
9 Ga0070683_100110311 3300005329 Bacteria 2595
10 Ga0070683_100139001 3300005329 Bacteria 2301
11 Ga0070690_100060120 3300005330 Bacteria 2445
12 Ga0070680_100083549 3300005336 Bacteria 2637
13 Ga0070680_100107160 3300005336 Bacteria 2324
14 Ga0070680_100130834 3300005336 Bacteria 2100
15 Ga0070680_100179182 3300005336 Bacteria 1785
16 Ga0068868_100572423 3300005338 Bacteria 998
17 Ga0070660_100437475 3300005339 Bacteria 1084
18 Ga0070689_100127677 3300005340 Bacteria 2036
19 Ga0070689_100359200 3300005340 Bacteria 1223
20 Ga0070691_10202767 3300005341 Bacteria 1043
21 Ga0070669_100442026 3300005353 Bacteria 1070
22 Ga0070675_100479974 3300005354 Bacteria 1118
23 Ga0070673_100720968 3300005364 Bacteria 917
24 Ga0070688_100326689 3300005365 Bacteria 1116
25 Ga0070659_100506060 3300005366 Bacteria 1030
26 Ga0070659_100572182 3300005366 Bacteria 969
27 Ga0070667_100867940 3300005367 Bacteria 839
28 Ga0070709_10032724 3300005434 Bacteria 3137
29 Ga0070714_100034869 3300005435 Bacteria 4214
30 Ga0070714_100067025 3300005435 Bacteria 3094
31 Ga0070714_100074727 3300005435 Bacteria 2939
32 Ga0070714_100101993 3300005435 Bacteria 2529
33 Ga0070714_100279728 3300005435 Bacteria 1550
34 Ga0070714_100388563 3300005435 Bacteria 1317
35 Ga0070713_100009337 3300005436 Bacteria 7014
36 Ga0070713_100013028 3300005436 Bacteria 6124
37 Ga0070713_100038376 3300005436 Bacteria 3881
38 Ga0070713_100106876 3300005436 Bacteria 2433
39 Ga0070713_100150849 3300005436 Bacteria 2067
40 Ga0070710_10001588 3300005437 Bacteria 10728
41 Ga0070710_10006913 3300005437 Bacteria 5472
42 Ga0070710_10648178 3300005437 Bacteria 740
43 Ga0070711_100006452 3300005439 Bacteria 7072
44 Ga0070711_100045705 3300005439 Bacteria 2980
45 Ga0070711_100400549 3300005439 Bacteria 1114
46 Ga0070708_101015592 3300005445 Bacteria 778
47 Ga0070663_100049490 3300005455 Bacteria 2985
48 Ga0070678_100193374 3300005456 Bacteria 1674
49 Ga0070681_10057710 3300005458 Bacteria 3862
50 Ga0070681_10083465 3300005458 Bacteria 3148
51 Ga0070681_10114740 3300005458 Bacteria 2632
52 Ga0070681_10198351 3300005458 Bacteria 1925
53 Ga0070681_10274704 3300005458 Bacteria 1596
54 Ga0070681_10493762 3300005458 Bacteria 1137
55 Ga0070681_10990870 3300005458 Bacteria 760
56 Ga0070706_100170199 3300005467 Bacteria 2034
57 Ga0070706_100461371 3300005467 Bacteria 1182
58 Ga0070679_100038088 3300005530 Bacteria 4780
59 Ga0070679_100075535 3300005530 Bacteria 3359
60 Ga0070679_100118484 3300005530 Bacteria 2632
61 Ga0070679_100153831 3300005530 Bacteria 2276
62 Ga0070679_100297637 3300005530 Bacteria 1564
63 Ga0070679_100565119 3300005530 Bacteria 1081
64 Ga0070684_100009693 3300005535 Bacteria 7599
65 Ga0070684_100013580 3300005535 Bacteria 6571
66 Ga0070684_100033646 3300005535 Bacteria 4378
67 Ga0070684_100044676 3300005535 Bacteria 3833
68 Ga0070684_100047638 3300005535 Bacteria 3715
69 Ga0070684_100519458 3300005535 Bacteria 1104
70 Ga0070684_100591788 3300005535 Bacteria 1031
71 Ga0070697_100182291 3300005536 Bacteria 1780
72 Ga0068853_100038890 3300005539 Bacteria 4054
73 Ga0068853_100044964 3300005539 Bacteria 3781
74 Ga0068853_100422221 3300005539 Bacteria 1250
75 Ga0068853_100439302 3300005539 Bacteria 1226
76 Ga0068855_100063709 3300005563 Bacteria 4302
77 Ga0068855_100098947 3300005563 Bacteria 3359
78 Ga0068855_100121719 3300005563 Bacteria 2986
79 Ga0068857_100118620 3300005577 Bacteria 2381
80 Ga0068857_101286293 3300005577 Bacteria 709
81 Ga0068856_100000511 3300005614 Bacteria 42929
82 Ga0068856_100025232 3300005614 Bacteria 5792
83 Ga0068856_100155647 3300005614 Bacteria 2296
84 Ga0068856_100259486 3300005614 Bacteria 1753
85 Ga0068852_100161322 3300005616 Bacteria 2094
86 Ga0068852_100891837 3300005616 Bacteria 906
87 Ga0068859_100164488 3300005617 Bacteria 2298
88 Ga0068859_101366592 3300005617 Bacteria 781
89 Ga0068864_101080909 3300005618 Bacteria 798
90 Ga0068851_10011542 3300005834 Bacteria 4145
91 Ga0068870_10419838 3300005840 Bacteria 875
92 Ga0068858_100064530 3300005842 Bacteria 3390
93 Ga0068858_101106862 3300005842 Bacteria 778
94 Ga0081455_10016722 3300005937 Bacteria 7065
95 Ga0081540_1001905 3300005983 Bacteria 17467
96 Ga0081540_1088387 3300005983 Bacteria 1370
97 Ga0081540_1089213 3300005983 Bacteria 1361
98 Ga0081540_1152230 3300005983 Bacteria 911
99 Ga0081539_10000324 3300005985 Bacteria 106549
100 Ga0070717_10029915 3300006028 Bacteria 4374
101 Ga0070717_10066807 3300006028 Bacteria 2991
102 Ga0070717_10118049 3300006028 Bacteria 2269
103 Ga0070717_10132173 3300006028 Bacteria 2147
104 Ga0070717_10545296 3300006028 Bacteria 1050
105 Ga0070717_10586426 3300006028 Bacteria 1011
106 Ga0070717_10876971 3300006028 Bacteria 817
107 Ga0075364_10257309 3300006051 Bacteria 1187
108 Ga0070716_100020251 3300006173 Bacteria 3490
109 Ga0070716_100153386 3300006173 Bacteria 1484
110 Ga0070716_100191518 3300006173 Bacteria 1352
111 Ga0070712_100072704 3300006175 Bacteria 2464
112 Ga0070712_100251722 3300006175 Bacteria 1412
113 Ga0070712_100333610 3300006175 Bacteria 1236
114 Ga0070712_100440996 3300006175 Bacteria 1083
115 Ga0097621_100146055 3300006237 Bacteria 2025
116 Ga0068871_100363809 3300006358 Bacteria 1282
117 Ga0075434_100789353 3300006871 Bacteria 966
118 Ga0075436_100027331 3300006914 Bacteria 3928
119 Ga0097620_100164502 3300006931 Bacteria 2298
120 Ga0097620_101367160 3300006931 Bacteria 781
121 Ga0099822_1007293 3300006943 Bacteria 14305
122 Ga0075435_100084144 3300007076 Bacteria 2617
123 Ga0099794_10008882 3300007265 Bacteria 4189
124 Ga0099794_10083649 3300007265 Bacteria 1577
125 Ga0099795_10008818 3300007788 Bacteria 2898
126 Ga0105240_10052711 3300009093 Bacteria 5112
127 Ga0105240_10065784 3300009093 Bacteria 4499
128 Ga0105240_10180561 3300009093 Bacteria 2491
129 Ga0105240_10337968 3300009093 Bacteria 1711
130 Ga0105240_10809796 3300009093 Bacteria 1014
131 Ga0105245_10197912 3300009098 Bacteria 1928
132 Ga0105247_10007024 3300009101 Bacteria 6927
133 Ga0105247_10038401 3300009101 Bacteria 2923
134 Ga0105241_10096954 3300009174 Bacteria 2337
135 Ga0105242_10662061 3300009176 Bacteria 1017
136 Ga0105237_10012827 3300009545 Bacteria 8812
137 Ga0105237_10013881 3300009545 Bacteria 8429
138 Ga0105237_10015184 3300009545 Bacteria 8025
139 Ga0105237_10056019 3300009545 Bacteria 3947
140 Ga0105237_10325127 3300009545 Bacteria 1542
141 Ga0105237_10523862 3300009545 Bacteria 1192
142 Ga0105238_10091082 3300009551 Bacteria 3037
143 Ga0105238_10231236 3300009551 Bacteria 1826
144 Ga0105238_10661698 3300009551 Bacteria 1055
145 Ga0099796_10075032 3300010159 Bacteria 1229
146 Ga0105239_10039299 3300010375 Bacteria 5184
147 Ga0105239_10040041 3300010375 Bacteria 5133
148 Ga0105239_10071493 3300010375 Bacteria 3812
149 Ga0105239_10132878 3300010375 Bacteria 2769
150 Ga0105246_10590629 3300011119 Bacteria 958
151 Ga0157373_10043941 3300013100 Bacteria 3190
152 Ga0157370_10127286 3300013104 Bacteria 2377
153 Ga0157370_10157389 3300013104 Bacteria 2114
154 Ga0157370_10411590 3300013104 Bacteria 1244
155 Ga0157370_10460898 3300013104 Bacteria 1168
156 Ga0157369_10022176 3300013105 Bacteria 7093
157 Ga0157369_10022356 3300013105 Bacteria 7058
158 Ga0157369_10072583 3300013105 Bacteria 3694
159 Ga0157369_10201921 3300013105 Bacteria 2086
160 Ga0157369_10740860 3300013105 Bacteria 1011
161 Ga0157374_10408879 3300013296 Bacteria 1355
162 Ga0157378_10113891 3300013297 Bacteria 2484
163 Ga0163162_10432351 3300013306 Bacteria 1448
164 Ga0157372_10056594 3300013307 Bacteria 4382
165 Ga0157372_10257756 3300013307 Bacteria 2025
166 Ga0157372_10504600 3300013307 Bacteria 1410
167 Ga0157375_10161628 3300013308 Bacteria 2382
168 Ga0163163_10074085 3300014325 Bacteria 3396
169 Ga0163163_10914136 3300014325 Bacteria 941
170 Ga0157380_10168922 3300014326 Bacteria 1909
171 Ga0157379_10077582 3300014968 Bacteria 2975
172 Ga0197907_11460350 3300020069 Bacteria 821
173 Ga0206351_10958503 3300020077 Bacteria 1039
174 Ga0206350_10389794 3300020080 Bacteria 991
175 Ga0206350_10979421 3300020080 Bacteria 938
176 Ga0213873_10067416 3300021358 Bacteria 980
177 Ga0213874_10022152 3300021377 Bacteria 1760
178 Ga0213876_10000614 3300021384 Bacteria 26254
179 Ga0213876_10051423 3300021384 Bacteria 2178
180 Ga0213876_10091278 3300021384 Bacteria 1613
181 Ga0224712_10082829 3300022467 Bacteria 1328
182 Ga0209677_100341 3300025253 Bacteria 29761
183 Ga0209233_1002291 3300025261 Bacteria 7136
184 Ga0209233_1002401 3300025261 Bacteria 6916
185 Ga0209758_1000979 3300025297 Bacteria 38423
186 Ga0207692_10002421 3300025898 Bacteria 7158
187 Ga0207692_10003733 3300025898 Bacteria 5982
188 Ga0207710_10186888 3300025900 Bacteria 1019
189 Ga0207647_10049169 3300025904 Bacteria 2616
190 Ga0207685_10043787 3300025905 Bacteria 1689
191 Ga0207699_10008082 3300025906 Bacteria 5172
192 Ga0207699_10054967 3300025906 Bacteria 2367
193 Ga0207705_10061402 3300025909 Bacteria 2715
194 Ga0207705_10351406 3300025909 Bacteria 1136
195 Ga0207684_10361795 3300025910 Bacteria 1248
196 Ga0207684_10519158 3300025910 Bacteria 1020
197 Ga0207654_10170096 3300025911 Bacteria 1414
198 Ga0207707_10001012 3300025912 Bacteria 26958
199 Ga0207707_10018301 3300025912 Bacteria 6107
200 Ga0207707_10021914 3300025912 Bacteria 5584
201 Ga0207707_10434492 3300025912 Bacteria 1124
202 Ga0207707_10438483 3300025912 Bacteria 1118
203 Ga0207695_10252510 3300025913 Bacteria 1662
204 Ga0207695_10421343 3300025913 Bacteria 1219
205 Ga0207671_10159934 3300025914 Bacteria 1744
206 Ga0207671_10179369 3300025914 Bacteria 1648
207 Ga0207693_10030735 3300025915 Bacteria 4243
208 Ga0207693_10037736 3300025915 Bacteria 3807
209 Ga0207693_10055079 3300025915 Bacteria 3120
210 Ga0207693_10157939 3300025915 Bacteria 1784
211 Ga0207663_10002092 3300025916 Bacteria 9516
212 Ga0207663_10081209 3300025916 Bacteria 2122
213 Ga0207663_10169897 3300025916 Bacteria 1548
214 Ga0207660_10411998 3300025917 Bacteria 1089
215 Ga0207662_10073765 3300025918 Bacteria 2070
216 Ga0207657_10015188 3300025919 Bacteria 7472
217 Ga0207657_10686923 3300025919 Bacteria 795
218 Ga0207649_10414509 3300025920 Bacteria 1010
219 Ga0207652_10002667 3300025921 Bacteria 14973
220 Ga0207652_10008411 3300025921 Bacteria 8304
221 Ga0207652_10108844 3300025921 Bacteria 2456
222 Ga0207694_10044302 3300025924 Bacteria 3436
223 Ga0207694_10393093 3300025924 Bacteria 1152
224 Ga0207700_10026002 3300025928 Bacteria 4075
225 Ga0207700_10042579 3300025928 Bacteria 3330
226 Ga0207700_10073078 3300025928 Bacteria 2647
227 Ga0207700_10097799 3300025928 Bacteria 2333
228 Ga0207700_10540590 3300025928 Bacteria 1033
229 Ga0207664_10012527 3300025929 Bacteria 6069
230 Ga0207664_10066648 3300025929 Bacteria 2887
231 Ga0207664_10170745 3300025929 Bacteria 1861
232 Ga0207644_10893252 3300025931 Bacteria 745
233 Ga0207690_10592446 3300025932 Bacteria 904
234 Ga0207670_10310794 3300025936 Bacteria 1237
235 Ga0207670_10760458 3300025936 Bacteria 805
236 Ga0207665_10028217 3300025939 Bacteria 3707
237 Ga0207665_10082919 3300025939 Bacteria 2210
238 Ga0207665_10463613 3300025939 Bacteria 974
239 Ga0207665_10479428 3300025939 Bacteria 958
240 Ga0207689_10405963 3300025942 Bacteria 1136
241 Ga0207661_10000462 3300025944 Bacteria 26255
242 Ga0207661_10040022 3300025944 Bacteria 3683
243 Ga0207667_10109824 3300025949 Bacteria 2845
244 Ga0207667_10167374 3300025949 Bacteria 2259
245 Ga0207667_10208444 3300025949 Bacteria 2004
246 Ga0207667_10257677 3300025949 Bacteria 1784
247 Ga0207667_10819999 3300025949 Bacteria 926
248 Ga0207677_10548423 3300026023 Bacteria 1007
249 Ga0207703_10085752 3300026035 Bacteria 2636
250 Ga0207639_10091537 3300026041 Bacteria 2435
251 Ga0207678_10041245 3300026067 Bacteria 4002
252 Ga0207702_10001649 3300026078 Bacteria 22030
253 Ga0207702_10021596 3300026078 Bacteria 5330
254 Ga0207702_10192365 3300026078 Bacteria 1886
255 Ga0207641_10160776 3300026088 Bacteria 2042
256 Ga0207676_10987435 3300026095 Bacteria 829
257 Ga0207674_10023544 3300026116 Bacteria 6593
258 Ga0207674_10334610 3300026116 Bacteria 1464
259 Ga0209588_1023131 3300027671 Bacteria 1958
260 Ga0265323_10007192 3300028653 Bacteria 4641
261 Ga0265336_10000380 3300028666 Bacteria 28330
262 Ga0265338_10000024 3300028800 Bacteria 297778
263 Ga0307511_10139567 3300030521 Bacteria 1430
264 Ga0307511_10192978 3300030521 Bacteria 1072
265 Ga0265762_1041053 3300030760 Bacteria 906
266 Ga0265330_10021984 3300031235 Bacteria 2907
267 Ga0265330_10044505 3300031235 Bacteria 1959
268 Ga0265330_10061625 3300031235 Bacteria 1632
269 Ga0265332_10018842 3300031238 Bacteria 3048
270 Ga0265332_10064153 3300031238 Bacteria 1569
271 Ga0265325_10018556 3300031241 Bacteria 3858
272 Ga0265340_10005205 3300031247 Bacteria 7224
273 Ga0265339_10005036 3300031249 Bacteria 8884
274 Ga0265339_10046598 3300031249 Bacteria 2382
275 Ga0265339_10102586 3300031249 Bacteria 1487
276 Ga0265331_10102942 3300031250 Bacteria 1313
277 Ga0265316_10081664 3300031344 Bacteria 2478
278 Ga0307509_10109344 3300031507 Bacteria 2775
279 Ga0307408_100175656 3300031548 Bacteria 1714
280 Ga0307508_10115455 3300031616 Bacteria 2286
281 Ga0307508_10165669 3300031616 Bacteria 1813
282 Ga0307508_10234727 3300031616 Bacteria 1432
283 Ga0265314_10055117 3300031711 Bacteria 2747
284 Ga0265342_10257772 3300031712 Bacteria 929
285 Ga0307516_10019573 3300031730 Bacteria 7009
286 Ga0307516_10272620 3300031730 Bacteria 1377
287 Ga0307507_10030395 3300033179 Bacteria 5699
288 Ga0307510_10348419 3300033180 Bacteria 932
289 Ga0316215_1001695 3300033544 Bacteria 2094
290 Ga0373930_0104579 3300034816 Bacteria 676
291 Ga0373926_0006321 3300035083 Bacteria 3932
292 Ga0373944_0054307 3300035089 Bacteria 1270
293 Ga0373923_0002137 3300035111 Bacteria 5988
294 Ga0373923_0014102 3300035111 Bacteria 2995
295 Ga0373923_0021726 3300035111 Bacteria 2509
296 Ga0373936_0151697 3300035113 Bacteria 1005
297 Ga0373945_0005773 3300035116 Bacteria 3972
298 Ga0373945_0491835 3300035116 Bacteria 546
299 Ga0373953_0004729 3300035117 Bacteria 4364
300 Ga0373953_0007421 3300035117 Bacteria 3671
301 Ga0373954_0010176 3300035118 Bacteria 4146
302 Ga0373954_0027087 3300035118 Bacteria 2629
303 Ga0373954_0100590 3300035118 Bacteria 1394
304 Ga0373956_0004899 3300035119 Bacteria 5360
305 Ga0373956_0007583 3300035119 Bacteria 4371
306 Ga0373956_0012528 3300035119 Bacteria 3517
307 Ga0373957_0012043 3300035120 Bacteria 2902
308 Ga0373943_0042825 3300035170 Bacteria 2196
309 Ga0373946_0049764 3300035171 Bacteria 1748
310 Ga0373955_0014155 3300035172 Bacteria 3874
311 Ga0373931_0218339 3300035691 Bacteria 1147
312 Ga0373935_0062863 3300035692 Bacteria 2378
313 Ga0373935_0173672 3300035692 Bacteria 1475
314 Ga0373927_0002813 3300035695 Bacteria 12703
315 Ga0373927_0008714 3300035695 Bacteria 6815
316 Ga0373927_0057254 3300035695 Bacteria 2520
317 Ga0373927_0086031 3300035695 Bacteria 2040
318 Ga0373927_0143783 3300035695 Bacteria 1561
319 Ga0373933_0000498 3300035724 Bacteria 24445
320 Ga0373933_0008210 3300035724 Bacteria 5700
321 Ga0373933_0150506 3300035724 Bacteria 1473
322 Ga0373933_0174877 3300035724 Bacteria 1367
323 Ga0373947_0054234 3300035725 Bacteria 2419
324 Ga0373947_0072004 3300035725 Bacteria 2121
325 Ga0373947_0172480 3300035725 Bacteria 1404
326 Ga0310104_07667 3300036242 Bacteria 906
327 Ga0373937_0015871 3300036401 Bacteria 6677
328 Ga0373937_0021015 3300036401 Bacteria 5855
329 Ga0373937_0259224 3300036401 Bacteria 1639
330 Ga0373937_0704520 3300036401 Bacteria 956
331 Ga0373937_0715952 3300036401 Bacteria 948
332 Ga0373925_0070429 3300037068 Bacteria 2643
333 Ga0373925_0479480 3300037068 Bacteria 1020
334 Ga0373925_0666559 3300037068 Bacteria 857
335 Ga0395900_0086636 3300037418 Bacteria 3219
336 Ga0395900_0226549 3300037418 Bacteria 1882
337 Ga0395900_0231711 3300037418 Bacteria 1857
338 Ga0395898_0028268 3300037466 Bacteria 5623
339 Ga0395898_0073234 3300037466 Bacteria 3309
340 Ga0395898_0203141 3300037466 Bacteria 1891
341 Ga0395898_0354151 3300037466 Bacteria 1400
342 Ga0436364_0166094 3300037853 Bacteria 657
343 Ga0436364_0937071 3300037853 Bacteria 1476
344 Ga0436364_1519480 3300037853 Bacteria 987
345 Ga0395901_0101254 3300038443 Bacteria 3023
346 Ga0395901_0123398 3300038443 Bacteria 2722
347 Ga0395901_0959729 3300038443 Bacteria 833
348 Ga0395901_1010945 3300038443 Bacteria 807
349 Ga0436365_0133064 3300039437 Bacteria 19710
350 Ga0436365_0368251 3300039437 Bacteria 1072
351 Ga0436365_0686974 3300039437 Bacteria 2898
352 Ga0436365_0798134 3300039437 Bacteria 1359
353 Ga0436365_1161115 3300039437 Bacteria 3210
354 Ga0436365_1191666 3300039437 Bacteria 910
355 Ga0436365_1197293 3300039437 Bacteria 2238
356 Ga0436363_0010691 3300039450 Bacteria 2081
357 Ga0436363_1070258 3300039450 Bacteria 901
358 Ga0436362_0550362 3300039453 Bacteria 8946
359 Ga0451855_1123399 3300041511 Bacteria 676
360 Ga0466969_0114478 3300044656 Bacteria 1260
361 Ga0466965_0076631 3300044683 Bacteria 1688
362 Ga0466964_0259585 3300044706 Bacteria 860
363 Ga0466971_0132353 3300044719 Bacteria 1158
364 Ga0466957_0014321 3300044842 Bacteria 4618
365 Ga0466957_0393481 3300044842 Bacteria 947
366 Ga0466959_0137393 3300045049 Bacteria 1729
367 Ga0466967_0030257 3300045976 Bacteria 4542
368 Ga0466967_0233114 3300045976 Bacteria 1753
369 Ga0466967_0321818 3300045976 Bacteria 1491
370 Ga0495592_0053593 3300046454 Bacteria 2991
371 Ga0495592_0087465 3300046454 Bacteria 2241
372 Ga0495592_0089173 3300046454 Bacteria 2215
373 Ga0495591_136125 3300046458 Bacteria 594
374 Ga0495629_0000131 3300046459 Bacteria 65274
375 Ga0495629_0738757 3300046459 Bacteria 652
376 Ga0495651_0013282 3300046462 Bacteria 6369
377 Ga0495651_0416741 3300046462 Bacteria 874
378 Ga0495653_0026613 3300046463 Bacteria 4635
379 Ga0495653_0053924 3300046463 Bacteria 3074
380 Ga0495580_0019327 3300046472 Bacteria 5062
381 Ga0495580_0276098 3300046472 Bacteria 1147
382 Ga0495582_0054052 3300046473 Bacteria 2215
383 Ga0495662_0121878 3300046476 Bacteria 1280
384 Ga0495664_0020837 3300046477 Bacteria 3785
385 Ga0495664_0037601 3300046477 Bacteria 2857
386 Ga0495664_0107830 3300046477 Bacteria 1680
387 Ga0495664_0337216 3300046477 Bacteria 909
388 Ga0495606_0000244 3300046507 Bacteria 95942
389 Ga0495608_0015134 3300046511 Bacteria 5351
390 Ga0495608_0418270 3300046511 Bacteria 818
391 Ga0495618_0209134 3300046514 Bacteria 1233
392 Ga0495628_0015325 3300046516 Bacteria 6403
393 Ga0495628_0064465 3300046516 Bacteria 2868
394 Ga0495628_0239283 3300046516 Bacteria 1358
395 Ga0495630_0039324 3300046517 Bacteria 3537
396 Ga0495652_0091621 3300046529 Bacteria 2484
397 Ga0495652_0172939 3300046529 Bacteria 1665
398 Ga0495652_0197544 3300046529 Bacteria 1529
399 Ga0495665_0019044 3300046531 Bacteria 3690
400 Ga0495665_0406486 3300046531 Bacteria 690
401 Ga0495640_0001250 3300046533 Bacteria 19944
402 Ga0495586_0432692 3300046535 Bacteria 758
403 Ga0495587_0030797 3300046536 Bacteria 3252
404 Ga0495587_0181424 3300046536 Bacteria 1193
405 Ga0495645_0006824 3300046543 Bacteria 7931
406 Ga0495645_0011580 3300046543 Bacteria 6211
407 Ga0495645_0019270 3300046543 Bacteria 4912
408 Ga0495622_0018324 3300046557 Bacteria 3261
409 Ga0495667_0013101 3300046559 Bacteria 5616
410 Ga0495667_0019122 3300046559 Bacteria 4623
411 Ga0495667_0617353 3300046559 Bacteria 675
412 Ga0495668_0499839 3300046616 Bacteria 670
413 Ga0495634_0182298 3300046642 Bacteria 1314
414 Ga0495634_0257477 3300046642 Bacteria 1066
415 Ga0495634_0294652 3300046642 Bacteria 982
416 Ga0495635_0000278 3300046663 Bacteria 32846
417 Ga0495635_0022268 3300046663 Bacteria 4412
418 Ga0495588_0497511 3300046674 Bacteria 639
419 Ga0495657_0018786 3300046675 Bacteria 4996
420 Ga0495657_0043252 3300046675 Bacteria 3072
421 Ga0495599_0001288 3300046678 Bacteria 14233
422 Ga0495599_0027894 3300046678 Bacteria 3537
423 Ga0495599_0458886 3300046678 Bacteria 754
424 Ga0495623_0022987 3300046679 Bacteria 4025
425 Ga0495623_0187954 3300046679 Bacteria 1195
426 Ga0495646_0007213 3300046680 Bacteria 7058
427 Ga0495646_0019287 3300046680 Bacteria 4319
428 Ga0495646_0035603 3300046680 Bacteria 3087
429 Ga0495647_0143519 3300046681 Bacteria 1019
430 Ga0495647_0284688 3300046681 Bacteria 742
431 Ga0495658_0019221 3300046683 Bacteria 3563
432 Ga0495669_0242967 3300046684 Bacteria 864
433 Ga0495613_0098856 3300046689 Bacteria 2109
434 Ga0495613_0157680 3300046689 Bacteria 1616
435 Ga0495624_0273161 3300046690 Bacteria 1021
436 Ga0495670_0151188 3300046691 Bacteria 1217
437 Ga0495600_0001303 3300046809 Bacteria 13764
438 Ga0495600_0023708 3300046809 Bacteria 3947
439 Ga0495581_0069019 3300047315 Bacteria 2044
440 Ga0495604_0024482 3300047317 Bacteria 4816
441 Ga0495604_0025676 3300047317 Bacteria 4692
442 Ga0495674_0015555 3300047319 Bacteria 7109
443 Ga0495674_0032239 3300047319 Bacteria 4754
444 Ga0495674_0069142 3300047319 Bacteria 3054
445 Ga0495674_0232278 3300047319 Bacteria 1522
446 Ga0495680_0014139 3300047322 Bacteria 6932
447 Ga0495680_0034277 3300047322 Bacteria 4102
448 Ga0495675_0012656 3300047444 Bacteria 5309
449 Ga0495675_0021396 3300047444 Bacteria 4117
450 Ga0495673_0299696 3300047469 Bacteria 576
451 Ga0495681_0175375 3300047470 Bacteria 884
452 Ga0495684_0015637 3300047471 Bacteria 5840
453 Ga0495684_0020006 3300047471 Bacteria 5156
454 Ga0495593_0001699 3300047673 Bacteria 13052
455 Ga0495593_0029054 3300047673 Bacteria 3034
456 Ga0495602_0026038 3300048088 Bacteria 5650
457 Ga0495602_0120878 3300048088 Bacteria 2107
458 Ga0496100_0125036 3300048903 Bacteria 1804
459 Ga0496100_0366095 3300048903 Bacteria 1092
460 Ga0496100_0428950 3300048903 Bacteria 1011
461 Ga0496102_0215713 3300048905 Bacteria 1809
462 Ga0496104_0421147 3300048907 Bacteria 1247
463 Ga0496106_0001095 3300048909 Bacteria 20014
464 Ga0496106_0002422 3300048909 Bacteria 13908
465 Ga0496106_0211913 3300048909 Bacteria 1543
466 Ga0496106_0649436 3300048909 Bacteria 843
467 Ga0496106_0732317 3300048909 Bacteria 787
468 Ga0496107_0009954 3300048910 Bacteria 6596
469 Ga0496108_0000792 3300048911 Bacteria 24615
470 Ga0496108_0093801 3300048911 Bacteria 2554
471 Ga0496108_0482281 3300048911 Bacteria 1083
472 Ga0496109_0001512 3300048912 Bacteria 19340
473 Ga0496109_0118415 3300048912 Bacteria 2465
474 Ga0496110_0157449 3300048913 Bacteria 2058
475 Ga0496110_0183638 3300048913 Bacteria 1899
476 Ga0496110_0315177 3300048913 Bacteria 1424
477 Ga0496111_0031473 3300048914 Bacteria 3779
478 Ga0496111_0083004 3300048914 Bacteria 2341
479 Ga0496111_0543650 3300048914 Bacteria 853
480 Ga0496112_0000019 3300048915 Bacteria 185531
481 Ga0496112_0045318 3300048915 Bacteria 4311
482 Ga0496112_0241409 3300048915 Bacteria 1759
483 Ga0496112_0401543 3300048915 Bacteria 1310
484 Ga0496113_0091663 3300048916 Bacteria 2343
485 Ga0496113_0517661 3300048916 Bacteria 957
486 Ga0496114_0162771 3300048917 Bacteria 1941
487 Ga0496114_0197269 3300048917 Bacteria 1762
488 Ga0496115_0085289 3300048918 Bacteria 2576
489 Ga0496115_0110933 3300048918 Bacteria 2254
490 Ga0496116_0234593 3300048919 Bacteria 927
491 Ga0496117_0007296 3300048920 Bacteria 10861
492 Ga0496118_0009814 3300048921 Bacteria 9594
493 Ga0496118_0023306 3300048921 Bacteria 5381
494 Ga0496118_0076652 3300048921 Bacteria 2376
495 Ga0496118_0225958 3300048921 Bacteria 1085
496 Ga0496119_0030933 3300048922 Bacteria 3600
497 Ga0496119_0176657 3300048922 Bacteria 1123
498 Ga0496121_0000261 3300048924 Bacteria 110085
499 Ga0496121_0000416 3300048924 Bacteria 84469
500 Ga0496121_0009794 3300048924 Bacteria 10947
501 Ga0496121_0085903 3300048924 Bacteria 2474
502 Ga0496121_0107232 3300048924 Bacteria 2140
503 Ga0496121_0159765 3300048924 Bacteria 1649
504 Ga0496121_0222174 3300048924 Bacteria 1330
505 Ga0496124_0002237 3300048927 Bacteria 25740
506 Ga0496124_0041035 3300048927 Bacteria 3997
507 Ga0496125_0004225 3300048928 Bacteria 16728
508 Ga0496125_0236671 3300048928 Bacteria 1163
509 Ga0496126_0013178 3300048929 Bacteria 8432
510 Ga0496126_0029553 3300048929 Bacteria 5204
511 Ga0496126_0071746 3300048929 Bacteria 3082
512 Ga0496126_0283373 3300048929 Bacteria 1372
513 Ga0496126_0342148 3300048929 Bacteria 1225
514 Ga0496126_0944374 3300048929 Bacteria 651
515 Ga0501033_0043810 3300049570 Bacteria 3331
516 Ga0501034_0161771 3300049571 Bacteria 2209
517 Ga0501043_0270912 3300049579 Bacteria 1303
518 Ga0501046_0071498 3300049580 Bacteria 2696
519 Ga0501046_0171283 3300049580 Bacteria 1629
520 Ga0501047_0703885 3300049581 Bacteria 827
521 Ga0501067_0009637 3300049583 Bacteria 5348
522 Ga0501067_0243362 3300049583 Bacteria 1001
523 Ga0501067_0285666 3300049583 Bacteria 919
524 Ga0501068_0306315 3300049584 Bacteria 1017
525 Ga0501069_0122121 3300049585 Bacteria 1488
526 Ga0501070_0312786 3300049586 Bacteria 1278
527 Ga0501075_0470459 3300049591 Bacteria 959
528 Ga0501076_0371459 3300049592 Bacteria 1175
529 Ga0501083_0102705 3300049744 Bacteria 1885
530 Ga0501035_0235130 3300049822 Bacteria 1560
531 Ga0501044_0422699 3300049823 Bacteria 1242
532 nmdc:mga03683_129212_c1 3300050489 Bacteria 1129
533 nmdc:mga00v17_110275_c1 3300050491 Bacteria 1340
534 nmdc:mga0n895_1519817_c1 3300050512 Bacteria 635
535 nmdc:mga0n895_15260_c1 3300050512 Bacteria 6999
536 nmdc:mga0rr50_236554_c1 3300050513 Bacteria 1513
537 nmdc:mga08x19_227849_c1 3300050514 Bacteria 1282
538 Ga0495601_0046111 3300053077 Bacteria 2743
539 Ga0495601_0256282 3300053077 Bacteria 1142
540 Ga0495612_0018959 3300053078 Bacteria 2754
541 Ga0495612_0127210 3300053078 Bacteria 1099
542 Ga0500635_0027948 3300053080 Bacteria 1797
543 Ga0500635_0028157 3300053080 Bacteria 1792
544 Ga0495595_0091015 3300053084 Bacteria 1463
545 Ga0495595_0292518 3300053084 Bacteria 819
546 Ga0495619_0005485 3300053085 Bacteria 8043
547 Ga0495619_0022740 3300053085 Bacteria 4014
548 Ga0500578_0205011 3300053086 Bacteria 1205
549 Ga0500644_0000635 3300053088 Bacteria 13110
550 Ga0500651_0520543 3300053093 Bacteria 654
551 Ga0500566_0003115 3300053094 Bacteria 9914
552 Ga0500640_037593 3300053095 Bacteria 2127
553 Ga0500650_0108251 3300053098 Bacteria 1298
554 Ga0500554_001749 3300053102 Bacteria 4182
555 Ga0500572_002868 3300053111 Bacteria 4050
556 Ga0500591_017962 3300053115 Bacteria 3418
557 Ga0500594_0098130 3300053118 Bacteria 898
558 Ga0500595_000006 3300053119 Bacteria 300857
559 Ga0500595_000653 3300053119 Bacteria 20857
560 Ga0500595_004962 3300053119 Bacteria 5876
561 Ga0500595_008555 3300053119 Bacteria 4176
562 Ga0500595_009982 3300053119 Bacteria 3797
563 Ga0500597_220352 3300053120 Bacteria 789
564 Ga0500597_269572 3300053120 Bacteria 690
565 Ga0500608_134105 3300053122 Bacteria 1107
566 Ga0500608_149502 3300053122 Bacteria 1025
567 Ga0500614_004079 3300053123 Bacteria 3109
568 Ga0500642_0002153 3300053130 Bacteria 5721
569 Ga0500642_0194713 3300053130 Bacteria 945
570 Ga0500652_005724 3300053131 Bacteria 3942
571 Ga0500655_066816 3300053133 Bacteria 729
572 Ga0500559_0113892 3300053136 Bacteria 1254
573 Ga0500568_0001507 3300053139 Bacteria 14866
574 Ga0500573_0132117 3300053140 Bacteria 1381
575 Ga0500590_126042 3300053148 Bacteria 1192
576 Ga0500603_000727 3300053150 Bacteria 8020
577 Ga0500603_010339 3300053150 Bacteria 2105
578 Ga0500603_056815 3300053150 Bacteria 1085
579 Ga0500616_0000001 3300053153 Bacteria 1986011
580 Ga0500616_0052649 3300053153 Bacteria 2140
581 Ga0500639_024881 3300053163 Bacteria 3165
582 Ga0500639_171355 3300053163 Bacteria 973
583 Ga0500636_0037272 3300053177 Bacteria 2877
584 Ga0500636_0059957 3300053177 Bacteria 2222
585 Ga0500637_0004097 3300053178 Bacteria 6858
586 Ga0500637_0049741 3300053178 Bacteria 2386
587 Ga0500637_0122043 3300053178 Bacteria 1511
588 Ga0500645_000650 3300053730 Bacteria 21950
589 Ga0500552_007688 3300053733 Bacteria 1252
590 Ga0500596_005247 3300053735 Bacteria 2304
591 Ga0500596_005807 3300053735 Bacteria 2135
592 Ga0500601_003184 3300053737 Bacteria 1775
593 Ga0500601_031101 3300053737 Bacteria 634
594 2513657394 2513237096 Bacteria 8722461
595 2513916647 2513237145 Bacteria 8979722
596 2517888120 2517572143 Bacteria 9484767
597 2524533300 2524023228 Bacteria 10118060
598 2671119413 2667528175 Bacteria 7532676
599 2793073500 2791355197 Bacteria 8420563
600 2885379968 2885374607 Bacteria 8927485
601 2903755904 2903748898 Bacteria 9972761
602 2904710082
603 2906614531
604 2908746648 2908739725 Bacteria 8628932
605 2922426394
606 3005475733 3005474847 Bacteria 9259049
607 8006937057 8006933436 Bacteria 10410654
608 8006977022 8006973647 Bacteria 10679141
609 8019561617 8019555841 Bacteria 9642137
610 Ga0495634_0028189
611 LJQas_1013150
612 JGI25406J46586_10000059
613 JGI25404J52841_10006835
614 Ga0070658_10128022
615 Ga0070658_10392483
616 Ga0070658_11043491
617 Ga0070683_100021895
618 Ga0070683_100110311
619 Ga0070683_100139001
620 Ga0070690_100060120
621 Ga0070680_100083549
622 Ga0070680_100107160
623 Ga0070680_100130834
624 Ga0070680_100179182
625 Ga0068868_100572423
626 Ga0070660_100437475
627 Ga0070689_100127677
628 Ga0070689_100359200
629 Ga0070691_10202767
630 Ga0070669_100442026
631 Ga0070675_100479974
632 Ga0070673_100720968
633 Ga0070688_100326689
634 Ga0070659_100506060
635 Ga0070659_100572182
636 Ga0070667_100867940
637 Ga0070709_10032724
638 Ga0070714_100034869
639 Ga0070714_100067025
640 Ga0070714_100074727
641 Ga0070714_100101993
642 Ga0070714_100279728
643 Ga0070714_100388563
644 Ga0070713_100009337
645 Ga0070713_100013028
646 Ga0070713_100038376
647 Ga0070713_100106876
648 Ga0070713_100150849
649 Ga0070710_10001588
650 Ga0070710_10006913
651 Ga0070710_10648178
652 Ga0070711_100006452
653 Ga0070711_100045705
654 Ga0070711_100400549
655 Ga0070708_101015592
656 Ga0070663_100049490
657 Ga0070678_100193374
658 Ga0070681_10057710
659 Ga0070681_10083465
660 Ga0070681_10114740
661 Ga0070681_10198351
662 Ga0070681_10274704
663 Ga0070681_10493762
664 Ga0070681_10990870
665 Ga0070706_100170199
666 Ga0070706_100461371
667 Ga0070679_100038088
668 Ga0070679_100075535
669 Ga0070679_100118484
670 Ga0070679_100153831
671 Ga0070679_100297637
672 Ga0070679_100565119
673 Ga0070684_100009693
674 Ga0070684_100013580
675 Ga0070684_100033646
676 Ga0070684_100044676
677 Ga0070684_100047638
678 Ga0070684_100519458
679 Ga0070684_100591788
680 Ga0070697_100182291
681 Ga0068853_100038890
682 Ga0068853_100044964
683 Ga0068853_100422221
684 Ga0068853_100439302
685 Ga0068855_100063709
686 Ga0068855_100098947
687 Ga0068855_100121719
688 Ga0068857_100118620
689 Ga0068857_101286293
690 Ga0068856_100000511
691 Ga0068856_100025232
692 Ga0068856_100155647
693 Ga0068856_100259486
694 Ga0068852_100161322
695 Ga0068852_100891837
696 Ga0068859_100164488
697 Ga0068859_101366592
698 Ga0068864_101080909
699 Ga0068851_10011542
700 Ga0068870_10419838
701 Ga0068858_100064530
702 Ga0068858_101106862
703 Ga0081455_10016722
704 Ga0081540_1001905
705 Ga0081540_1088387
706 Ga0081540_1089213
707 Ga0081540_1152230
708 Ga0081539_10000324
709 Ga0070717_10029915
710 Ga0070717_10066807
711 Ga0070717_10118049
712 Ga0070717_10132173
713 Ga0070717_10545296
714 Ga0070717_10586426
715 Ga0070717_10876971
716 Ga0075364_10257309
717 Ga0070716_100020251
718 Ga0070716_100153386
719 Ga0070716_100191518
720 Ga0070712_100072704
721 Ga0070712_100251722
722 Ga0070712_100333610
723 Ga0070712_100440996
724 Ga0097621_100146055
725 Ga0068871_100363809
726 Ga0075434_100789353
727 Ga0075436_100027331
728 Ga0097620_100164502
729 Ga0097620_101367160
730 Ga0099822_1007293
731 Ga0075435_100084144
732 Ga0099794_10008882
733 Ga0099794_10083649
734 Ga0099795_10008818
735 Ga0105240_10052711
736 Ga0105240_10065784
737 Ga0105240_10180561
738 Ga0105240_10337968
739 Ga0105240_10809796
740 Ga0105245_10197912
741 Ga0105247_10007024
742 Ga0105247_10038401
743 Ga0105241_10096954
744 Ga0105242_10662061
745 Ga0105237_10012827
746 Ga0105237_10013881
747 Ga0105237_10015184
748 Ga0105237_10056019
749 Ga0105237_10325127
750 Ga0105237_10523862
751 Ga0105238_10091082
752 Ga0105238_10231236
753 Ga0105238_10661698
754 Ga0099796_10075032
755 Ga0105239_10039299
756 Ga0105239_10040041
757 Ga0105239_10071493
758 Ga0105239_10132878
759 Ga0105246_10590629
760 Ga0157373_10043941
761 Ga0157370_10127286
762 Ga0157370_10157389
763 Ga0157370_10411590
764 Ga0157370_10460898
765 Ga0157369_10022176
766 Ga0157369_10022356
767 Ga0157369_10072583
768 Ga0157369_10201921
769 Ga0157369_10740860
770 Ga0157374_10408879
771 Ga0157378_10113891
772 Ga0163162_10432351
773 Ga0157372_10056594
774 Ga0157372_10257756
775 Ga0157372_10504600
776 Ga0157375_10161628
777 Ga0163163_10074085
778 Ga0163163_10914136
779 Ga0157380_10168922
780 Ga0157379_10077582
781 Ga0197907_11460350
782 Ga0206351_10958503
783 Ga0206350_10389794
784 Ga0206350_10979421
785 Ga0213873_10067416
786 Ga0213874_10022152
787 Ga0213876_10000614
788 Ga0213876_10051423
789 Ga0213876_10091278
790 Ga0224712_10082829
791 Ga0209677_100341
792 Ga0209233_1002291
793 Ga0209233_1002401
794 Ga0209758_1000979
795 Ga0207692_10002421
796 Ga0207692_10003733
797 Ga0207710_10186888
798 Ga0207647_10049169
799 Ga0207685_10043787
800 Ga0207699_10008082
801 Ga0207699_10054967
802 Ga0207705_10061402
803 Ga0207705_10351406
804 Ga0207684_10361795
805 Ga0207684_10519158
806 Ga0207654_10170096
807 Ga0207707_10001012
808 Ga0207707_10018301
809 Ga0207707_10021914
810 Ga0207707_10434492
811 Ga0207707_10438483
812 Ga0207695_10252510
813 Ga0207695_10421343
814 Ga0207671_10159934
815 Ga0207671_10179369
816 Ga0207693_10030735
817 Ga0207693_10037736
818 Ga0207693_10055079
819 Ga0207693_10157939
820 Ga0207663_10002092
821 Ga0207663_10081209
822 Ga0207663_10169897
823 Ga0207660_10411998
824 Ga0207662_10073765
825 Ga0207657_10015188
826 Ga0207657_10686923
827 Ga0207649_10414509
828 Ga0207652_10002667
829 Ga0207652_10008411
830 Ga0207652_10108844
831 Ga0207694_10044302
832 Ga0207694_10393093
833 Ga0207700_10026002
834 Ga0207700_10042579
835 Ga0207700_10073078
836 Ga0207700_10097799
837 Ga0207700_10540590
838 Ga0207664_10012527
839 Ga0207664_10066648
840 Ga0207664_10170745
841 Ga0207644_10893252
842 Ga0207690_10592446
843 Ga0207670_10310794
844 Ga0207670_10760458
845 Ga0207665_10028217
846 Ga0207665_10082919
847 Ga0207665_10463613
848 Ga0207665_10479428
849 Ga0207689_10405963
850 Ga0207661_10000462
851 Ga0207661_10040022
852 Ga0207667_10109824
853 Ga0207667_10167374
854 Ga0207667_10208444
855 Ga0207667_10257677
856 Ga0207667_10819999
857 Ga0207677_10548423
858 Ga0207703_10085752
859 Ga0207639_10091537
860 Ga0207678_10041245
861 Ga0207702_10001649
862 Ga0207702_10021596
863 Ga0207702_10192365
864 Ga0207641_10160776
865 Ga0207676_10987435
866 Ga0207674_10023544
867 Ga0207674_10334610
868 Ga0209588_1023131
869 Ga0265323_10007192
870 Ga0265336_10000380
871 Ga0265338_10000024
872 Ga0307511_10139567
873 Ga0307511_10192978
874 Ga0265762_1041053
875 Ga0265330_10021984
876 Ga0265330_10044505
877 Ga0265330_10061625
878 Ga0265332_10018842
879 Ga0265332_10064153
880 Ga0265325_10018556
881 Ga0265340_10005205
882 Ga0265339_10005036
883 Ga0265339_10046598
884 Ga0265339_10102586
885 Ga0265331_10102942
886 Ga0265316_10081664
887 Ga0307509_10109344
888 Ga0307408_100175656
889 Ga0307508_10115455
890 Ga0307508_10165669
891 Ga0307508_10234727
892 Ga0265314_10055117
893 Ga0265342_10257772
894 Ga0307516_10019573
895 Ga0307516_10272620
896 Ga0307507_10030395
897 Ga0307510_10348419
898 Ga0316215_1001695
899 Ga0373930_0104579
900 Ga0373926_0006321
901 Ga0373944_0054307
902 Ga0373923_0002137
903 Ga0373923_0014102
904 Ga0373923_0021726
905 Ga0373936_0151697
906 Ga0373945_0005773
907 Ga0373945_0491835
908 Ga0373953_0004729
909 Ga0373953_0007421
910 Ga0373954_0010176
911 Ga0373954_0027087
912 Ga0373954_0100590
913 Ga0373956_0004899
914 Ga0373956_0007583
915 Ga0373956_0012528
916 Ga0373957_0012043
917 Ga0373943_0042825
918 Ga0373946_0049764
919 Ga0373955_0014155
920 Ga0373931_0218339
921 Ga0373935_0062863
922 Ga0373935_0173672
923 Ga0373927_0002813
924 Ga0373927_0008714
925 Ga0373927_0057254
926 Ga0373927_0086031
927 Ga0373927_0143783
928 Ga0373933_0000498
929 Ga0373933_0008210
930 Ga0373933_0150506
931 Ga0373933_0174877
932 Ga0373947_0054234
933 Ga0373947_0072004
934 Ga0373947_0172480
935 Ga0310104_07667
936 Ga0373937_0015871
937 Ga0373937_0021015
938 Ga0373937_0259224
939 Ga0373937_0704520
940 Ga0373937_0715952
941 Ga0373925_0070429
942 Ga0373925_0479480
943 Ga0373925_0666559
944 Ga0395900_0086636
945 Ga0395900_0226549
946 Ga0395900_0231711
947 Ga0395898_0028268
948 Ga0395898_0073234
949 Ga0395898_0203141
950 Ga0395898_0354151
951 Ga0436364_0166094
952 Ga0436364_0937071
953 Ga0436364_1519480
954 Ga0395901_0101254
955 Ga0395901_0123398
956 Ga0395901_0959729
957 Ga0395901_1010945
958 Ga0436365_0133064
959 Ga0436365_0368251
960 Ga0436365_0686974
961 Ga0436365_0798134
962 Ga0436365_1161115
963 Ga0436365_1191666
964 Ga0436365_1197293
965 Ga0436363_0010691
966 Ga0436363_1070258
967 Ga0436362_0550362
968 Ga0451855_1123399
969 Ga0466969_0114478
970 Ga0466965_0076631
971 Ga0466964_0259585
972 Ga0466971_0132353
973 Ga0466957_0014321
974 Ga0466957_0393481
975 Ga0466959_0137393
976 Ga0466967_0030257
977 Ga0466967_0233114
978 Ga0466967_0321818
979 Ga0495592_0053593
980 Ga0495592_0087465
981 Ga0495592_0089173
982 Ga0495591_136125
983 Ga0495629_0000131
984 Ga0495629_0738757
985 Ga0495651_0013282
986 Ga0495651_0416741
987 Ga0495653_0026613
988 Ga0495653_0053924
989 Ga0495580_0019327
990 Ga0495580_0276098
991 Ga0495582_0054052
992 Ga0495662_0121878
993 Ga0495664_0020837
994 Ga0495664_0037601
995 Ga0495664_0107830
996 Ga0495664_0337216
997 Ga0495606_0000244
998 Ga0495608_0015134
999 Ga0495608_0418270
1000 Ga0495618_0209134
1001 Ga0495628_0015325
1002 Ga0495628_0064465
1003 Ga0495628_0239283
1004 Ga0495630_0039324
1005 Ga0495652_0091621
1006 Ga0495652_0172939
1007 Ga0495652_0197544
1008 Ga0495665_0019044
1009 Ga0495665_0406486
1010 Ga0495640_0001250
1011 Ga0495586_0432692
1012 Ga0495587_0030797
1013 Ga0495587_0181424
1014 Ga0495645_0006824
1015 Ga0495645_0011580
1016 Ga0495645_0019270
1017 Ga0495622_0018324
1018 Ga0495667_0013101
1019 Ga0495667_0019122
1020 Ga0495667_0617353
1021 Ga0495668_0499839
1022 Ga0495634_0182298
1023 Ga0495634_0257477
1024 Ga0495634_0294652
1025 Ga0495635_0000278
1026 Ga0495635_0022268
1027 Ga0495588_0497511
1028 Ga0495657_0018786
1029 Ga0495657_0043252
1030 Ga0495599_0001288
1031 Ga0495599_0027894
1032 Ga0495599_0458886
1033 Ga0495623_0022987
1034 Ga0495623_0187954
1035 Ga0495646_0007213
1036 Ga0495646_0019287
1037 Ga0495646_0035603
1038 Ga0495647_0143519
1039 Ga0495647_0284688
1040 Ga0495658_0019221
1041 Ga0495669_0242967
1042 Ga0495613_0098856
1043 Ga0495613_0157680
1044 Ga0495624_0273161
1045 Ga0495670_0151188
1046 Ga0495600_0001303
1047 Ga0495600_0023708
1048 Ga0495581_0069019
1049 Ga0495604_0024482
1050 Ga0495604_0025676
1051 Ga0495674_0015555
1052 Ga0495674_0032239
1053 Ga0495674_0069142
1054 Ga0495674_0232278
1055 Ga0495680_0014139
1056 Ga0495680_0034277
1057 Ga0495675_0012656
1058 Ga0495675_0021396
1059 Ga0495673_0299696
1060 Ga0495681_0175375
1061 Ga0495684_0015637
1062 Ga0495684_0020006
1063 Ga0495593_0001699
1064 Ga0495593_0029054
1065 Ga0495602_0026038
1066 Ga0495602_0120878
1067 Ga0496100_0125036
1068 Ga0496100_0366095
1069 Ga0496100_0428950
1070 Ga0496102_0215713
1071 Ga0496104_0421147
1072 Ga0496106_0001095
1073 Ga0496106_0002422
1074 Ga0496106_0211913
1075 Ga0496106_0649436
1076 Ga0496106_0732317
1077 Ga0496107_0009954
1078 Ga0496108_0000792
1079 Ga0496108_0093801
1080 Ga0496108_0482281
1081 Ga0496109_0001512
1082 Ga0496109_0118415
1083 Ga0496110_0157449
1084 Ga0496110_0183638
1085 Ga0496110_0315177
1086 Ga0496111_0031473
1087 Ga0496111_0083004
1088 Ga0496111_0543650
1089 Ga0496112_0000019
1090 Ga0496112_0045318
1091 Ga0496112_0241409
1092 Ga0496112_0401543
1093 Ga0496113_0091663
1094 Ga0496113_0517661
1095 Ga0496114_0162771
1096 Ga0496114_0197269
1097 Ga0496115_0085289
1098 Ga0496115_0110933
1099 Ga0496116_0234593
1100 Ga0496117_0007296
1101 Ga0496118_0009814
1102 Ga0496118_0023306
1103 Ga0496118_0076652
1104 Ga0496118_0225958
1105 Ga0496119_0030933
1106 Ga0496119_0176657
1107 Ga0496121_0000261
1108 Ga0496121_0000416
1109 Ga0496121_0009794
1110 Ga0496121_0085903
1111 Ga0496121_0107232
1112 Ga0496121_0159765
1113 Ga0496121_0222174
1114 Ga0496124_0002237
1115 Ga0496124_0041035
1116 Ga0496125_0004225
1117 Ga0496125_0236671
1118 Ga0496126_0013178
1119 Ga0496126_0029553
1120 Ga0496126_0071746
1121 Ga0496126_0283373
1122 Ga0496126_0342148
1123 Ga0496126_0944374
1124 Ga0501033_0043810
1125 Ga0501034_0161771
1126 Ga0501043_0270912
1127 Ga0501046_0071498
1128 Ga0501046_0171283
1129 Ga0501047_0703885
1130 Ga0501067_0009637
1131 Ga0501067_0243362
1132 Ga0501067_0285666
1133 Ga0501068_0306315
1134 Ga0501069_0122121
1135 Ga0501070_0312786
1136 Ga0501075_0470459
1137 Ga0501076_0371459
1138 Ga0501083_0102705
1139 Ga0501035_0235130
1140 Ga0501044_0422699
1141 nmdc:mga03683_129212_c1
1142 nmdc:mga00v17_110275_c1
1143 nmdc:mga0n895_1519817_c1
1144 nmdc:mga0n895_15260_c1
1145 nmdc:mga0rr50_236554_c1
1146 nmdc:mga08x19_227849_c1
1147 Ga0495601_0046111
1148 Ga0495601_0256282
1149 Ga0495612_0018959
1150 Ga0495612_0127210
1151 Ga0500635_0027948
1152 Ga0500635_0028157
1153 Ga0495595_0091015
1154 Ga0495595_0292518
1155 Ga0495619_0005485
1156 Ga0495619_0022740
1157 Ga0500578_0205011
1158 Ga0500644_0000635
1159 Ga0500651_0520543
1160 Ga0500566_0003115
1161 Ga0500640_037593
1162 Ga0500650_0108251
1163 Ga0500554_001749
1164 Ga0500572_002868
1165 Ga0500591_017962
1166 Ga0500594_0098130
1167 Ga0500595_000006
1168 Ga0500595_000653
1169 Ga0500595_004962
1170 Ga0500595_008555
1171 Ga0500595_009982
1172 Ga0500597_220352
1173 Ga0500597_269572
1174 Ga0500608_134105
1175 Ga0500608_149502
1176 Ga0500614_004079
1177 Ga0500642_0002153
1178 Ga0500642_0194713
1179 Ga0500652_005724
1180 Ga0500655_066816
1181 Ga0500559_0113892
1182 Ga0500568_0001507
1183 Ga0500573_0132117
1184 Ga0500590_126042
1185 Ga0500603_000727
1186 Ga0500603_010339
1187 Ga0500603_056815
1188 Ga0500616_0000001
1189 Ga0500616_0052649
1190 Ga0500639_024881
1191 Ga0500639_171355
1192 Ga0500636_0037272
1193 Ga0500636_0059957
1194 Ga0500637_0004097
1195 Ga0500637_0049741
1196 Ga0500637_0122043
1197 Ga0500645_000650
1198 Ga0500552_007688
1199 Ga0500596_005247
1200 Ga0500596_005807
1201 Ga0500601_003184
1202 Ga0500601_031101
1203 2513657394
1204 2513916647
1205 2517888120
1206 2524533300
1207 2671119413
1208 2793073500
1209 2885379968
1210 2903755904
1211 2904710082
1212 2906614531
1213 2908746648
1214 2922426394
1215 3005475733
1216 8006937057
1217 8006977022
1218 8019561617

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02630

SCO1-SenC

SCO1/SenC

56

189

0.99

PF00578

AhpC-TSA

AhpC/TSA family

52

203

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wbr-assembly1.cif.gz_D structure of bradyrhizobium japonicum scoi with copper bound 0.9891 41 197
4wbr-assembly1.cif.gz_D structure of bradyrhizobium japonicum scoi with copper bound 0.9828 41 197
4txo-assembly4.cif.gz_H crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s) 0.9703 41 197
4txo-assembly4.cif.gz_H crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s) 0.9641 41 197
4txo-assembly1.cif.gz_D crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s) 0.952 39 197
ID Description Score Start End Superfamily
4txoH00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9703 41 197 3.40.30.10
4txoH00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9641 41 197 3.40.30.10
af_Q54TT7_154_312_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9296 43 195 3.40.30.10
af_Q4CYL4_166_345_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9093 40 196 3.40.30.10
af_P38072_102_285_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9002 41 196 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6I1K3T2-F1-model_v4 Electron transporter SCO1/SenC 0.9761 34 197 GO:0046872
AF-A0A519Y4N8-F1-model_v4 deleted 0.9666 48 197
AF-A0A519Y4N8-F1-model_v4 deleted 0.9604 48 197
AF-A0A522CL01-F1-model_v4 SCO family protein 0.9528 41 196 GO:0046872
AF-A0A3D1SU35-F1-model_v4 SCO family protein 0.9514 43 145 GO:0046872

Map