F468841

General Info

Members Datasets Scaffolds Average Seq Length
609 263 1218 219

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10136486|Ga0070676_101364862
Length 247
Sequence MLSVDGLHVAIESVQVLRGLSLTVAEGTMVGLVGRNGAGKTTLMRSVMGHLPVAQGKVAFDGRDLASVPRQGRAALGIGYMPEDRGLVPSLSVEENILIPIWASRTLQAAERLDFVYGVLPELKAMRDRRALLLSGGQQKMVALARALAIGTRLLLLDEPFEGLAPALSSRLAEVIGGLRGGRLSVLIAQSDLNHSRSLVDVEVVIERGANVGGTDGHAAPIGAAGQASRSSTSTHANGSPRPSRAE

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
172 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
182 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
183 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
184 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
185 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
186 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
187 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
188 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
189 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
190 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
191 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
247 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
248 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
249 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
250 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
251 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
252 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
253 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
254 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
255 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
256 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
259 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
260 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
261 2842733646 Variovorax sp. R-72446 Isolate Unclassified
262 2842747753 Variovorax sp. R-72060 Isolate Unclassified
263 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.75
Nodule 0
Rhizoplane 4.27
Rhizosphere 85.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10136486 3300005328 Bacteria 1557
2 Ga0065707_10129034 3300005295 Bacteria 1954
3 Ga0070658_10054027 3300005327 Bacteria 3261
4 Ga0070658_10117321 3300005327 Bacteria 2210
5 Ga0070658_10600442 3300005327 Bacteria 954
6 Ga0070676_10006340 3300005328 Bacteria 6320
7 Ga0070676_10007040 3300005328 Bacteria 6020
8 Ga0070676_10097154 3300005328 Bacteria 1814
9 Ga0070676_10157357 3300005328 Bacteria 1459
10 Ga0070683_100010663 3300005329 Bacteria 7901
11 Ga0070683_100176102 3300005329 Bacteria 2030
12 Ga0070690_100123560 3300005330 Bacteria 1740
13 Ga0070690_100187373 3300005330 Bacteria 1433
14 Ga0070670_100000922 3300005331 Bacteria 23101
15 Ga0070670_100020914 3300005331 Bacteria 5628
16 Ga0070670_100021864 3300005331 Bacteria 5502
17 Ga0070670_100030097 3300005331 Bacteria 4675
18 Ga0070670_100095973 3300005331 Bacteria 2550
19 Ga0070670_100099822 3300005331 Bacteria 2498
20 Ga0070670_100418805 3300005331 Bacteria 1184
21 Ga0070677_10015858 3300005333 Bacteria 2674
22 Ga0070677_10076875 3300005333 Bacteria 1418
23 Ga0070677_10231593 3300005333 Bacteria 908
24 Ga0068869_100000584 3300005334 Bacteria 20486
25 Ga0068869_100077563 3300005334 Bacteria 2472
26 Ga0068869_100176474 3300005334 Bacteria 1672
27 Ga0070666_10002465 3300005335 Bacteria 11194
28 Ga0070666_10225068 3300005335 Bacteria 1324
29 Ga0070680_100134502 3300005336 Bacteria 2070
30 Ga0070682_100664956 3300005337 Bacteria 831
31 Ga0068868_100000189 3300005338 Bacteria 41014
32 Ga0068868_100007199 3300005338 Bacteria 7906
33 Ga0068868_100042463 3300005338 Bacteria 3549
34 Ga0068868_100064005 3300005338 Bacteria 2918
35 Ga0068868_100570367 3300005338 Bacteria 999
36 Ga0070660_100003956 3300005339 Bacteria 10238
37 Ga0070660_100017086 3300005339 Bacteria 5282
38 Ga0070660_100853479 3300005339 Bacteria 767
39 Ga0070691_10223407 3300005341 Bacteria 999
40 Ga0070687_100072899 3300005343 Bacteria 1849
41 Ga0070687_100254757 3300005343 Bacteria 1092
42 Ga0070661_100016900 3300005344 Bacteria 5165
43 Ga0070661_100145342 3300005344 Bacteria 1790
44 Ga0070661_100151460 3300005344 Bacteria 1753
45 Ga0070661_100333041 3300005344 Bacteria 1188
46 Ga0070668_100023686 3300005347 Bacteria 4646
47 Ga0070668_100025239 3300005347 Bacteria 4504
48 Ga0070668_100083682 3300005347 Bacteria 2505
49 Ga0070668_100091935 3300005347 Bacteria 2393
50 Ga0070668_100585113 3300005347 Bacteria 975
51 Ga0070669_100112000 3300005353 Bacteria 2072
52 Ga0070669_100381525 3300005353 Bacteria 1149
53 Ga0070675_100000563 3300005354 Bacteria 25564
54 Ga0070675_100009566 3300005354 Bacteria 7542
55 Ga0070675_100041355 3300005354 Bacteria 3765
56 Ga0070675_100187285 3300005354 Bacteria 1792
57 Ga0070675_100303744 3300005354 Bacteria 1406
58 Ga0070675_100376153 3300005354 Bacteria 1263
59 Ga0070671_100005126 3300005355 Bacteria 10437
60 Ga0070671_100012832 3300005355 Bacteria 6756
61 Ga0070671_100021121 3300005355 Bacteria 5316
62 Ga0070671_100047550 3300005355 Bacteria 3567
63 Ga0070671_100048034 3300005355 Bacteria 3548
64 Ga0070671_100075407 3300005355 Bacteria 2817
65 Ga0070671_100092962 3300005355 Bacteria 2528
66 Ga0070671_100259406 3300005355 Bacteria 1477
67 Ga0070671_100283762 3300005355 Bacteria 1409
68 Ga0070674_100017879 3300005356 Bacteria 4469
69 Ga0070674_100035252 3300005356 Bacteria 3350
70 Ga0070674_100137009 3300005356 Bacteria 1832
71 Ga0070674_100486988 3300005356 Bacteria 1025
72 Ga0070673_100001225 3300005364 Bacteria 14841
73 Ga0070673_100015796 3300005364 Bacteria 5317
74 Ga0070673_100023302 3300005364 Bacteria 4522
75 Ga0070673_100281972 3300005364 Bacteria 1457
76 Ga0070688_100036433 3300005365 Bacteria 2992
77 Ga0070688_100157216 3300005365 Bacteria 1559
78 Ga0070688_100430097 3300005365 Bacteria 983
79 Ga0070659_100153375 3300005366 Bacteria 1880
80 Ga0070659_100355076 3300005366 Bacteria 1230
81 Ga0070667_100001024 3300005367 Bacteria 25540
82 Ga0070667_100015983 3300005367 Bacteria 6209
83 Ga0070667_100076439 3300005367 Bacteria 2859
84 Ga0070667_100250027 3300005367 Bacteria 1585
85 Ga0070667_100359748 3300005367 Bacteria 1319
86 Ga0070714_100344151 3300005435 Bacteria 1399
87 Ga0070700_100035879 3300005441 Bacteria 3004
88 Ga0070663_100005928 3300005455 Bacteria 7311
89 Ga0070663_100064832 3300005455 Bacteria 2641
90 Ga0070663_100160396 3300005455 Bacteria 1730
91 Ga0070663_100375493 3300005455 Bacteria 1157
92 Ga0070678_100041248 3300005456 Bacteria 3270
93 Ga0070678_100085619 3300005456 Bacteria 2402
94 Ga0070678_100095484 3300005456 Bacteria 2291
95 Ga0070678_100224277 3300005456 Bacteria 1563
96 Ga0070678_100736623 3300005456 Bacteria 891
97 Ga0070662_100003633 3300005457 Bacteria 9627
98 Ga0070662_100308043 3300005457 Bacteria 1288
99 Ga0070662_100333865 3300005457 Bacteria 1239
100 Ga0070681_10812781 3300005458 Bacteria 852
101 Ga0068867_100006149 3300005459 Bacteria 8500
102 Ga0068867_100025911 3300005459 Bacteria 4206
103 Ga0068867_100044392 3300005459 Bacteria 3256
104 Ga0068867_100154413 3300005459 Bacteria 1805
105 Ga0068867_100198049 3300005459 Bacteria 1607
106 Ga0070679_100035499 3300005530 Bacteria 4947
107 Ga0070684_100217342 3300005535 Bacteria 1743
108 Ga0068853_100027650 3300005539 Bacteria 4766
109 Ga0068853_100247199 3300005539 Bacteria 1636
110 Ga0070672_100055012 3300005543 Bacteria 3117
111 Ga0070672_100056905 3300005543 Bacteria 3068
112 Ga0070672_100115208 3300005543 Bacteria 2195
113 Ga0070672_100124135 3300005543 Bacteria 2116
114 Ga0070672_100135373 3300005543 Bacteria 2029
115 Ga0070672_100241505 3300005543 Bacteria 1519
116 Ga0070672_100329636 3300005543 Bacteria 1298
117 Ga0070686_100095159 3300005544 Bacteria 2001
118 Ga0070695_100374246 3300005545 Bacteria 1073
119 Ga0070693_100062796 3300005547 Bacteria 2163
120 Ga0070693_100077412 3300005547 Bacteria 1974
121 Ga0070693_100215229 3300005547 Bacteria 1256
122 Ga0070665_100227175 3300005548 Bacteria 1866
123 Ga0070665_100250487 3300005548 Bacteria 1772
124 Ga0068855_100012729 3300005563 Bacteria 10146
125 Ga0068855_100650703 3300005563 Bacteria 1132
126 Ga0070664_100238320 3300005564 Bacteria 1632
127 Ga0070664_100322281 3300005564 Bacteria 1400
128 Ga0070664_100421847 3300005564 Bacteria 1222
129 Ga0070664_100422607 3300005564 Bacteria 1221
130 Ga0068854_100015853 3300005578 Bacteria 5008
131 Ga0068854_100035169 3300005578 Bacteria 3504
132 Ga0068854_100188495 3300005578 Bacteria 1615
133 Ga0068854_100763470 3300005578 Bacteria 840
134 Ga0068856_100034459 3300005614 Bacteria 4958
135 Ga0068856_100227777 3300005614 Bacteria 1879
136 Ga0070702_100063253 3300005615 Bacteria 2160
137 Ga0070702_100122841 3300005615 Bacteria 1628
138 Ga0068852_100011475 3300005616 Bacteria 6672
139 Ga0068852_100020789 3300005616 Bacteria 5223
140 Ga0068852_100105296 3300005616 Bacteria 2555
141 Ga0068852_100135594 3300005616 Bacteria 2272
142 Ga0068852_100188825 3300005616 Bacteria 1943
143 Ga0068852_100581674 3300005616 Bacteria 1123
144 Ga0068859_100028658 3300005617 Bacteria 5583
145 Ga0068859_100031452 3300005617 Bacteria 5331
146 Ga0068859_100052149 3300005617 Bacteria 4112
147 Ga0068859_100132350 3300005617 Bacteria 2566
148 Ga0068859_100413672 3300005617 Bacteria 1444
149 Ga0068864_100002453 3300005618 Bacteria 15310
150 Ga0068864_100006881 3300005618 Bacteria 9318
151 Ga0068864_100085288 3300005618 Bacteria 2777
152 Ga0068864_100094372 3300005618 Bacteria 2644
153 Ga0068864_100112605 3300005618 Bacteria 2425
154 Ga0068864_100113243 3300005618 Bacteria 2418
155 Ga0068861_100005129 3300005719 Bacteria 8829
156 Ga0068861_100012814 3300005719 Bacteria 5855
157 Ga0068861_100071047 3300005719 Bacteria 2697
158 Ga0068861_100261064 3300005719 Bacteria 1483
159 Ga0068851_10027330 3300005834 Bacteria 2812
160 Ga0068851_10031985 3300005834 Bacteria 2616
161 Ga0068851_10041492 3300005834 Bacteria 2313
162 Ga0068851_10069633 3300005834 Bacteria 1817
163 Ga0068870_10090584 3300005840 Bacteria 1709
164 Ga0068863_100002502 3300005841 Bacteria 18271
165 Ga0068863_100071401 3300005841 Bacteria 3284
166 Ga0068863_100162916 3300005841 Bacteria 2137
167 Ga0068863_100292645 3300005841 Bacteria 1578
168 Ga0068863_100492543 3300005841 Bacteria 1206
169 Ga0068858_100000882 3300005842 Bacteria 31130
170 Ga0068858_100070707 3300005842 Bacteria 3235
171 Ga0068858_100107231 3300005842 Bacteria 2607
172 Ga0068858_100145979 3300005842 Bacteria 2222
173 Ga0068858_100388373 3300005842 Bacteria 1340
174 Ga0068860_100003206 3300005843 Bacteria 16886
175 Ga0068860_100007353 3300005843 Bacteria 11010
176 Ga0068860_100016639 3300005843 Bacteria 7173
177 Ga0068860_100515849 3300005843 Bacteria 1195
178 Ga0068862_100007694 3300005844 Bacteria 8914
179 Ga0068862_100021668 3300005844 Bacteria 5373
180 Ga0068862_100029672 3300005844 Bacteria 4609
181 Ga0068862_100037497 3300005844 Bacteria 4108
182 Ga0068862_101181817 3300005844 Bacteria 763
183 Ga0081455_10341467 3300005937 Bacteria 1059
184 Ga0075365_10113101 3300006038 Bacteria 1867
185 Ga0075368_10001270 3300006042 Bacteria 7999
186 Ga0075363_100000768 3300006048 Bacteria 11015
187 Ga0070715_10095973 3300006163 Bacteria 1374
188 Ga0075362_10009917 3300006177 Bacteria 3701
189 Ga0075367_10089883 3300006178 Bacteria 1867
190 Ga0075366_10010651 3300006195 Bacteria 5167
191 Ga0075366_10020528 3300006195 Bacteria 3834
192 Ga0075366_10100708 3300006195 Bacteria 1734
193 Ga0075366_10114193 3300006195 Bacteria 1626
194 Ga0097621_100040699 3300006237 Bacteria 3738
195 Ga0097621_100174147 3300006237 Bacteria 1857
196 Ga0097621_100374562 3300006237 Bacteria 1271
197 Ga0068871_100005268 3300006358 Bacteria 9054
198 Ga0068871_100619438 3300006358 Bacteria 985
199 Ga0068871_100758125 3300006358 Bacteria 892
200 Ga0075430_100651851 3300006846 Bacteria 868
201 Ga0075429_100148261 3300006880 Bacteria 2054
202 Ga0068865_100008577 3300006881 Bacteria 6319
203 Ga0068865_100009177 3300006881 Bacteria 6121
204 Ga0097620_100028657 3300006931 Bacteria 5583
205 Ga0097620_100031452 3300006931 Bacteria 5331
206 Ga0097620_100052151 3300006931 Bacteria 4112
207 Ga0097620_100132358 3300006931 Bacteria 2566
208 Ga0097620_100413655 3300006931 Bacteria 1444
209 Ga0105240_10036890 3300009093 Bacteria 6285
210 Ga0105240_10775652 3300009093 Bacteria 1040
211 Ga0111539_11742699 3300009094 Bacteria 722
212 Ga0105245_10003302 3300009098 Bacteria 14483
213 Ga0105247_10226048 3300009101 Bacteria 1269
214 Ga0105243_10055054 3300009148 Bacteria 3160
215 Ga0105243_10140823 3300009148 Bacteria 2058
216 Ga0105243_11253634 3300009148 Bacteria 757
217 Ga0105241_10480750 3300009174 Bacteria 1104
218 Ga0105242_10012976 3300009176 Bacteria 6424
219 Ga0105248_10019714 3300009177 Bacteria 7467
220 Ga0105248_10064873 3300009177 Bacteria 4100
221 Ga0105248_10171918 3300009177 Bacteria 2442
222 Ga0105248_10414040 3300009177 Bacteria 1518
223 Ga0105248_10436620 3300009177 Bacteria 1475
224 Ga0105248_10869965 3300009177 Bacteria 1017
225 Ga0105238_10050623 3300009551 Bacteria 4181
226 Ga0105238_10120453 3300009551 Bacteria 2603
227 Ga0105238_10720744 3300009551 Bacteria 1010
228 Ga0105249_10040727 3300009553 Bacteria 4221
229 Ga0105249_10062859 3300009553 Bacteria 3409
230 Ga0157373_10017384 3300013100 Bacteria 5239
231 Ga0157371_10044292 3300013102 Bacteria 3169
232 Ga0157371_10096247 3300013102 Bacteria 2098
233 Ga0157370_10126808 3300013104 Bacteria 2382
234 Ga0157369_10360379 3300013105 Bacteria 1510
235 Ga0157374_10022298 3300013296 Bacteria 5647
236 Ga0157378_10063356 3300013297 Bacteria 3304
237 Ga0163162_10001712 3300013306 Bacteria 20568
238 Ga0163162_10001724 3300013306 Bacteria 20482
239 Ga0163162_10041717 3300013306 Bacteria 4592
240 Ga0163162_10090800 3300013306 Bacteria 3136
241 Ga0163162_10235782 3300013306 Bacteria 1960
242 Ga0157372_10077106 3300013307 Bacteria 3764
243 Ga0157372_10096628 3300013307 Bacteria 3367
244 Ga0157372_10481745 3300013307 Bacteria 1446
245 Ga0157375_10014793 3300013308 Bacteria 6971
246 Ga0157375_10017915 3300013308 Bacteria 6408
247 Ga0157375_10044003 3300013308 Bacteria 4333
248 Ga0157375_10112038 3300013308 Bacteria 2828
249 Ga0157375_10127181 3300013308 Bacteria 2664
250 Ga0157375_10349246 3300013308 Bacteria 1645
251 Ga0163163_10001152 3300014325 Bacteria 22458
252 Ga0163163_10214177 3300014325 Bacteria 1975
253 Ga0163163_10652803 3300014325 Bacteria 1115
254 Ga0157380_10018256 3300014326 Bacteria 5205
255 Ga0157380_10091790 3300014326 Bacteria 2508
256 Ga0157380_10120068 3300014326 Bacteria 2225
257 Ga0157380_10166571 3300014326 Bacteria 1921
258 Ga0157377_10002714 3300014745 Bacteria 7869
259 Ga0157379_10001364 3300014968 Bacteria 19986
260 Ga0157379_10013256 3300014968 Bacteria 7220
261 Ga0157379_10040483 3300014968 Bacteria 4159
262 Ga0157379_10142820 3300014968 Bacteria 2158
263 Ga0157379_10171601 3300014968 Bacteria 1958
264 Ga0157376_10008670 3300014969 Bacteria 7351
265 Ga0157376_10010081 3300014969 Bacteria 6898
266 Ga0157376_10170681 3300014969 Bacteria 1980
267 Ga0157376_10253837 3300014969 Bacteria 1644
268 Ga0157376_11229161 3300014969 Bacteria 778
269 Ga0163161_10017226 3300017792 Bacteria 5054
270 Ga0163161_10020321 3300017792 Bacteria 4659
271 Ga0163161_10081575 3300017792 Bacteria 2382
272 Ga0163161_10307799 3300017792 Bacteria 1249
273 Ga0207656_10064166 3300025321 Bacteria 1618
274 Ga0207656_10144660 3300025321 Bacteria 1122
275 Ga0207656_10148749 3300025321 Bacteria 1108
276 Ga0207682_10013956 3300025893 Bacteria 3129
277 Ga0207682_10019505 3300025893 Bacteria 2655
278 Ga0207682_10026234 3300025893 Bacteria 2315
279 Ga0207642_10007762 3300025899 Bacteria 3638
280 Ga0207642_10126822 3300025899 Bacteria 1325
281 Ga0207710_10211943 3300025900 Bacteria 959
282 Ga0207688_10161992 3300025901 Bacteria 1326
283 Ga0207680_10000661 3300025903 Bacteria 16296
284 Ga0207680_10087512 3300025903 Bacteria 1973
285 Ga0207680_10206442 3300025903 Bacteria 1341
286 Ga0207685_10065703 3300025905 Bacteria 1453
287 Ga0207645_10005151 3300025907 Bacteria 9557
288 Ga0207645_10033325 3300025907 Bacteria 3311
289 Ga0207645_10105044 3300025907 Bacteria 1824
290 Ga0207645_10286179 3300025907 Bacteria 1095
291 Ga0207645_10317982 3300025907 Bacteria 1038
292 Ga0207645_10581157 3300025907 Bacteria 760
293 Ga0207643_10044623 3300025908 Bacteria 2503
294 Ga0207643_10096180 3300025908 Bacteria 1732
295 Ga0207705_10077307 3300025909 Bacteria 2421
296 Ga0207705_10278114 3300025909 Bacteria 1281
297 Ga0207705_10338156 3300025909 Bacteria 1158
298 Ga0207705_10542563 3300025909 Bacteria 904
299 Ga0207707_10174640 3300025912 Bacteria 1877
300 Ga0207707_10318289 3300025912 Bacteria 1344
301 Ga0207695_10210150 3300025913 Bacteria 1857
302 Ga0207671_10092523 3300025914 Bacteria 2280
303 Ga0207663_10095653 3300025916 Bacteria 1982
304 Ga0207662_10051159 3300025918 Bacteria 2457
305 Ga0207662_10064890 3300025918 Bacteria 2198
306 Ga0207657_10031162 3300025919 Bacteria 4833
307 Ga0207657_10037637 3300025919 Bacteria 4317
308 Ga0207657_10085632 3300025919 Bacteria 2640
309 Ga0207657_10142399 3300025919 Bacteria 1958
310 Ga0207649_10055468 3300025920 Bacteria 2470
311 Ga0207649_10124835 3300025920 Bacteria 1740
312 Ga0207649_10237879 3300025920 Bacteria 1306
313 Ga0207649_10295046 3300025920 Bacteria 1183
314 Ga0207652_10113926 3300025921 Bacteria 2400
315 Ga0207681_10007269 3300025923 Bacteria 6787
316 Ga0207681_10016094 3300025923 Bacteria 4672
317 Ga0207681_10019750 3300025923 Bacteria 4262
318 Ga0207681_10159387 3300025923 Bacteria 1699
319 Ga0207694_10116300 3300025924 Bacteria 2131
320 Ga0207694_10298954 3300025924 Bacteria 1325
321 Ga0207650_10003058 3300025925 Bacteria 11527
322 Ga0207650_10013978 3300025925 Bacteria 5573
323 Ga0207650_10038346 3300025925 Bacteria 3498
324 Ga0207650_10100281 3300025925 Bacteria 2227
325 Ga0207659_10000474 3300025926 Bacteria 24112
326 Ga0207659_10006781 3300025926 Bacteria 7038
327 Ga0207659_10009792 3300025926 Bacteria 5996
328 Ga0207659_10274497 3300025926 Bacteria 1376
329 Ga0207687_10080782 3300025927 Bacteria 2348
330 Ga0207687_10087628 3300025927 Bacteria 2263
331 Ga0207664_10196020 3300025929 Bacteria 1741
332 Ga0207644_10001390 3300025931 Bacteria 15619
333 Ga0207644_10004154 3300025931 Bacteria 9392
334 Ga0207644_10020806 3300025931 Bacteria 4463
335 Ga0207644_10063015 3300025931 Bacteria 2691
336 Ga0207690_10062156 3300025932 Bacteria 2541
337 Ga0207690_10086751 3300025932 Bacteria 2200
338 Ga0207706_10007325 3300025933 Bacteria 10203
339 Ga0207706_10126409 3300025933 Bacteria 2249
340 Ga0207706_10246024 3300025933 Bacteria 1563
341 Ga0207686_10034220 3300025934 Bacteria 3039
342 Ga0207709_10104123 3300025935 Bacteria 1883
343 Ga0207670_10297664 3300025936 Bacteria 1262
344 Ga0207670_10789311 3300025936 Bacteria 791
345 Ga0207669_10224782 3300025937 Bacteria 1380
346 Ga0207704_10016098 3300025938 Bacteria 3833
347 Ga0207704_10172723 3300025938 Bacteria 1552
348 Ga0207691_10006056 3300025940 Bacteria 11682
349 Ga0207691_10015369 3300025940 Bacteria 7283
350 Ga0207691_10022164 3300025940 Bacteria 5993
351 Ga0207691_10039125 3300025940 Bacteria 4388
352 Ga0207691_10042550 3300025940 Bacteria 4187
353 Ga0207691_10078021 3300025940 Bacteria 2982
354 Ga0207691_10121578 3300025940 Bacteria 2313
355 Ga0207691_10202484 3300025940 Bacteria 1727
356 Ga0207711_10036602 3300025941 Bacteria 4165
357 Ga0207711_10037245 3300025941 Bacteria 4130
358 Ga0207711_10041956 3300025941 Bacteria 3897
359 Ga0207711_10073616 3300025941 Bacteria 2969
360 Ga0207711_10388116 3300025941 Bacteria 1296
361 Ga0207689_10000313 3300025942 Bacteria 44828
362 Ga0207689_10037244 3300025942 Bacteria 4035
363 Ga0207661_10154744 3300025944 Bacteria 1984
364 Ga0207661_10174834 3300025944 Bacteria 1871
365 Ga0207679_10043465 3300025945 Bacteria 3235
366 Ga0207679_10599790 3300025945 Bacteria 992
367 Ga0207667_10048820 3300025949 Bacteria 4474
368 Ga0207667_10076657 3300025949 Bacteria 3469
369 Ga0207667_10544681 3300025949 Bacteria 1174
370 Ga0207651_10000495 3300025960 Bacteria 16517
371 Ga0207651_10167233 3300025960 Bacteria 1730
372 Ga0207712_10053887 3300025961 Bacteria 2824
373 Ga0207668_10013343 3300025972 Bacteria 5056
374 Ga0207668_10048041 3300025972 Bacteria 2926
375 Ga0207668_10048786 3300025972 Bacteria 2907
376 Ga0207668_10344345 3300025972 Bacteria 1244
377 Ga0207668_10555430 3300025972 Bacteria 995
378 Ga0207640_10171787 3300025981 Bacteria 1616
379 Ga0207640_10313001 3300025981 Bacteria 1247
380 Ga0207658_10000692 3300025986 Bacteria 29298
381 Ga0207658_10021202 3300025986 Bacteria 4507
382 Ga0207658_10030521 3300025986 Bacteria 3817
383 Ga0207658_10223563 3300025986 Bacteria 1585
384 Ga0207658_10226879 3300025986 Bacteria 1574
385 Ga0207658_10244452 3300025986 Bacteria 1522
386 Ga0207658_10421975 3300025986 Bacteria 1176
387 Ga0207677_10022680 3300026023 Bacteria 3863
388 Ga0207677_10063019 3300026023 Bacteria 2575
389 Ga0207677_10081720 3300026023 Bacteria 2319
390 Ga0207703_10000795 3300026035 Bacteria 31096
391 Ga0207703_10011304 3300026035 Bacteria 6942
392 Ga0207703_10050840 3300026035 Bacteria 3356
393 Ga0207703_10099621 3300026035 Bacteria 2460
394 Ga0207639_10008478 3300026041 Bacteria 7044
395 Ga0207639_10187309 3300026041 Bacteria 1765
396 Ga0207639_10297386 3300026041 Bacteria 1426
397 Ga0207639_10391927 3300026041 Bacteria 1249
398 Ga0207678_10012377 3300026067 Bacteria 7488
399 Ga0207678_10024211 3300026067 Bacteria 5303
400 Ga0207678_10079784 3300026067 Bacteria 2802
401 Ga0207708_10011614 3300026075 Bacteria 6564
402 Ga0207708_10017645 3300026075 Bacteria 5374
403 Ga0207702_10023090 3300026078 Bacteria 5158
404 Ga0207641_10001123 3300026088 Bacteria 26895
405 Ga0207641_10013187 3300026088 Bacteria 6776
406 Ga0207641_10029577 3300026088 Bacteria 4532
407 Ga0207648_10016527 3300026089 Bacteria 6739
408 Ga0207648_10050953 3300026089 Bacteria 3619
409 Ga0207648_10067923 3300026089 Bacteria 3107
410 Ga0207648_10068244 3300026089 Bacteria 3098
411 Ga0207648_10080995 3300026089 Bacteria 2832
412 Ga0207648_10122135 3300026089 Bacteria 2290
413 Ga0207648_10341019 3300026089 Bacteria 1349
414 Ga0207676_10000841 3300026095 Bacteria 23813
415 Ga0207676_10096919 3300026095 Bacteria 2435
416 Ga0207676_10122791 3300026095 Bacteria 2193
417 Ga0207676_10147100 3300026095 Bacteria 2024
418 Ga0207676_10433489 3300026095 Bacteria 1235
419 Ga0207674_10097127 3300026116 Bacteria 2930
420 Ga0207674_10133339 3300026116 Bacteria 2447
421 Ga0207675_100001252 3300026118 Bacteria 25329
422 Ga0207675_100008238 3300026118 Bacteria 9821
423 Ga0207675_100008626 3300026118 Bacteria 9586
424 Ga0207675_100063402 3300026118 Bacteria 3453
425 Ga0207675_100466043 3300026118 Bacteria 1254
426 Ga0207683_10002091 3300026121 Bacteria 17588
427 Ga0207683_10022914 3300026121 Bacteria 5366
428 Ga0207683_10034679 3300026121 Bacteria 4386
429 Ga0207683_10052481 3300026121 Bacteria 3573
430 Ga0207683_10060777 3300026121 Bacteria 3322
431 Ga0207683_10404691 3300026121 Bacteria 1256
432 Ga0207683_10429277 3300026121 Bacteria 1217
433 Ga0207683_10588477 3300026121 Bacteria 1029
434 Ga0207683_10829742 3300026121 Bacteria 858
435 Ga0207683_10927170 3300026121 Bacteria 809
436 Ga0207698_10043712 3300026142 Bacteria 3359
437 Ga0207698_10050298 3300026142 Bacteria 3178
438 Ga0209813_10004449 3300027866 Bacteria 3349
439 Ga0268266_10184256 3300028379 Bacteria 1903
440 Ga0268266_10186504 3300028379 Bacteria 1892
441 Ga0268266_10308893 3300028379 Bacteria 1477
442 Ga0268265_10042486 3300028380 Bacteria 3374
443 Ga0268265_10218318 3300028380 Bacteria 1666
444 Ga0268265_10577596 3300028380 Bacteria 1071
445 Ga0268264_10016355 3300028381 Bacteria 6074
446 Ga0268264_10018865 3300028381 Bacteria 5640
447 Ga0268264_10023588 3300028381 Bacteria 5016
448 Ga0268264_10093367 3300028381 Bacteria 2599
449 Ga0268264_10140656 3300028381 Bacteria 2152
450 Ga0307515_10220955 3300028794 Bacteria 1713
451 Ga0307515_10235965 3300028794 Bacteria 1610
452 Ga0307515_10328085 3300028794 Bacteria 1191
453 Ga0307511_10000499 3300030521 Bacteria 42317
454 Ga0265320_10184888 3300031240 Bacteria 933
455 Ga0307513_10094333 3300031456 Bacteria 3038
456 Ga0307513_10122014 3300031456 Bacteria 2571
457 Ga0307408_100017923 3300031548 Bacteria 4748
458 Ga0307516_10309291 3300031730 Bacteria 1254
459 Ga0307405_10007368 3300031731 Bacteria 5495
460 Ga0307405_10108739 3300031731 Bacteria 1874
461 Ga0307413_10009345 3300031824 Bacteria 4688
462 Ga0307410_10028480 3300031852 Bacteria 3544
463 Ga0307410_10168033 3300031852 Bacteria 1650
464 Ga0307410_10186855 3300031852 Bacteria 1573
465 Ga0307406_10003267 3300031901 Bacteria 8834
466 Ga0307406_10192695 3300031901 Bacteria 1493
467 Ga0307412_10037254 3300031911 Bacteria 3123
468 Ga0307409_100003569 3300031995 Bacteria 8487
469 Ga0307416_100261260 3300032002 Bacteria 1692
470 Ga0307416_100316774 3300032002 Bacteria 1560
471 Ga0307414_10022393 3300032004 Bacteria 3984
472 Ga0307414_10026404 3300032004 Bacteria 3737
473 Ga0307411_10000547 3300032005 Bacteria 13327
474 Ga0307411_10218778 3300032005 Bacteria 1476
475 Ga0307411_10231647 3300032005 Bacteria 1440
476 Ga0307411_10344543 3300032005 Bacteria 1212
477 Ga0307415_100001658 3300032126 Bacteria 10804
478 Ga0373938_0051429 3300034957 Bacteria 942
479 Ga0373940_0017355 3300035088 Bacteria 1794
480 Ga0373944_0021020 3300035089 Bacteria 1886
481 Ga0373932_0076748 3300035112 Bacteria 1047
482 Ga0373941_0019737 3300035115 Bacteria 1881
483 Ga0373943_0108025 3300035170 Bacteria 1464
484 Ga0373931_0001232 3300035691 Bacteria 10934
485 Ga0373937_0126602 3300036401 Bacteria 2384
486 Ga0373937_0165940 3300036401 Bacteria 2071
487 Ga0373925_0002569 3300037068 Bacteria 14454
488 Ga0436363_1668221 3300039450 Bacteria 1079
489 Ga0439436_0001548 3300041404 Bacteria 6692
490 Ga0439447_017935 3300041407 Bacteria 1919
491 Ga0439465_0000774 3300041413 Bacteria 9959
492 Ga0439465_0088336 3300041413 Bacteria 1058
493 Ga0451839_1029217 3300041496 Bacteria 939
494 Ga0439431_0000394 3300041997 Bacteria 9201
495 Ga0439433_0000762 3300041999 Bacteria 6341
496 Ga0439432_001228 3300042006 Bacteria 9682
497 Ga0439449_0004724 3300042007 Bacteria 5255
498 Ga0439449_0015673 3300042007 Bacteria 2849
499 Ga0439457_007734 3300042014 Bacteria 2569
500 Ga0450911_000712 3300042115 Bacteria 9689
501 Ga0450909_002481 3300042185 Bacteria 2613
502 Ga0439434_0000875 3300042435 Bacteria 8694
503 Ga0439464_0015982 3300042439 Bacteria 2028
504 Ga0451577_0018003 3300042876 Bacteria 6513
505 Ga0453683_0002262 3300044673 Bacteria 15209
506 Ga0453683_0276658 3300044673 Bacteria 1072
507 Ga0453684_0161255 3300044712 Bacteria 2653
508 Ga0453684_0197573 3300044712 Bacteria 2347
509 Ga0451576_0014155 3300045051 Bacteria 8888
510 Ga0451576_0035371 3300045051 Bacteria 5300
511 Ga0451576_0048819 3300045051 Bacteria 4444
512 Ga0451576_0432361 3300045051 Bacteria 1381
513 Ga0495580_0148077 3300046472 Bacteria 1627
514 Ga0495639_0294168 3300046475 Bacteria 809
515 Ga0495664_0233112 3300046477 Bacteria 1114
516 Ga0495643_0011139 3300046522 Bacteria 5494
517 Ga0495642_0023583 3300046528 Bacteria 2429
518 Ga0495642_0205276 3300046528 Bacteria 859
519 Ga0495586_0166811 3300046535 Bacteria 1243
520 Ga0495621_0056869 3300046539 Bacteria 1411
521 Ga0495621_0091420 3300046539 Bacteria 1147
522 Ga0495597_0007214 3300046542 Bacteria 5664
523 Ga0495645_0132145 3300046543 Bacteria 1748
524 Ga0495668_0036669 3300046616 Bacteria 2747
525 Ga0495661_0018224 3300046665 Bacteria 4621
526 Ga0495647_0008396 3300046681 Bacteria 3472
527 Ga0495670_0163023 3300046691 Bacteria 1172
528 Ga0495672_0121703 3300047320 Bacteria 1386
529 Ga0495687_010886 3300047443 Bacteria 4941
530 Ga0495687_044667 3300047443 Bacteria 1923
531 Ga0495686_0021904 3300047472 Bacteria 4234
532 Ga0495615_0005600 3300048090 Bacteria 2269
533 Ga0496100_0007604 3300048903 Bacteria 5992
534 Ga0496101_0023723 3300048904 Bacteria 4241
535 Ga0496101_0105662 3300048904 Bacteria 2113
536 Ga0496102_0030362 3300048905 Bacteria 4837
537 Ga0496102_0416779 3300048905 Bacteria 1261
538 Ga0496103_0146646 3300048906 Bacteria 1511
539 Ga0496104_0149191 3300048907 Bacteria 2245
540 Ga0496105_0203108 3300048908 Bacteria 1617
541 Ga0496105_0415299 3300048908 Bacteria 1066
542 Ga0496105_0476351 3300048908 Bacteria 983
543 Ga0496105_0570064 3300048908 Bacteria 882
544 Ga0496106_0010427 3300048909 Bacteria 6862
545 Ga0496106_0254981 3300048909 Bacteria 1403
546 Ga0496108_0009386 3300048911 Bacteria 7921
547 Ga0496108_0039969 3300048911 Bacteria 3909
548 Ga0496108_0086445 3300048911 Bacteria 2662
549 Ga0496108_0197053 3300048911 Bacteria 1747
550 Ga0496108_0433875 3300048911 Bacteria 1147
551 Ga0496109_0453337 3300048912 Bacteria 1211
552 Ga0496109_0520217 3300048912 Bacteria 1123
553 Ga0496110_0024349 3300048913 Bacteria 5159
554 Ga0496110_0715236 3300048913 Bacteria 903
555 Ga0496111_0036291 3300048914 Bacteria 3524
556 Ga0496114_0092815 3300048917 Bacteria 2565
557 Ga0496114_0340303 3300048917 Bacteria 1326
558 Ga0496115_0006951 3300048918 Bacteria 8316
559 Ga0496117_0144935 3300048920 Bacteria 1416
560 Ga0496121_0015380 3300048924 Bacteria 8022
561 Ga0496121_0249322 3300048924 Bacteria 1232
562 Ga0496122_0000039 3300048925 Bacteria 295352
563 Ga0496122_0219982 3300048925 Bacteria 1091
564 Ga0496123_0000026 3300048926 Bacteria 318040
565 Ga0496124_0063623 3300048927 Bacteria 3081
566 Ga0496124_0105598 3300048927 Bacteria 2275
567 Ga0496124_0177772 3300048927 Bacteria 1641
568 Ga0496124_0502908 3300048927 Bacteria 812
569 Ga0496125_0014317 3300048928 Bacteria 7729
570 Ga0496125_0040084 3300048928 Bacteria 4022
571 Ga0496125_0045942 3300048928 Bacteria 3669
572 Ga0496126_0012024 3300048929 Bacteria 8895
573 Ga0496126_0088790 3300048929 Bacteria 2722
574 Ga0496126_0690542 3300048929 Bacteria 794
575 Ga0501068_0607343 3300049584 Bacteria 713
576 nmdc:mga03683_44504_c1 3300050489 Bacteria 1835
577 nmdc:mga03n38_11318_c1 3300050490 Bacteria 3319
578 nmdc:mga00v17_135088_c1 3300050491 Bacteria 1579
579 nmdc:mga0k408_104479_c1 3300050493 Bacteria 1672
580 nmdc:mga0k408_263345_c1 3300050493 Bacteria 1029
581 nmdc:mga04h51_2605_c1 3300050495 Bacteria 4291
582 nmdc:mga07m45_73322_c1 3300050496 Bacteria 1949
583 nmdc:mga05p37_351472_c1 3300050507 Bacteria 1735
584 nmdc:mga09592_141787_c1 3300050508 Bacteria 2072
585 nmdc:mga0qj67_107891_c1 3300050509 Bacteria 2246
586 nmdc:mga0qj67_22457_c1 3300050509 Bacteria 4846
587 Ga0495601_0514468 3300053077 Bacteria 772
588 Ga0500646_0000464 3300053090 Bacteria 11970
589 Ga0500583_0016170 3300053092 Bacteria 2972
590 Ga0500583_0242114 3300053092 Bacteria 891
591 Ga0500651_0224077 3300053093 Bacteria 1102
592 Ga0500648_168151 3300053097 Bacteria 1145
593 Ga0500594_0012011 3300053118 Bacteria 2032
594 Ga0500595_002224 3300053119 Bacteria 9855
595 Ga0500628_073642 3300053129 Bacteria 861
596 Ga0500655_007900 3300053133 Bacteria 1916
597 Ga0500559_0003935 3300053136 Bacteria 7173
598 Ga0500559_0021375 3300053136 Bacteria 2742
599 Ga0500559_0125383 3300053136 Bacteria 1196
600 Ga0500573_0008795 3300053140 Bacteria 5575
601 Ga0500573_0102443 3300053140 Bacteria 1609
602 Ga0500604_0000243 3300053151 Bacteria 15638
603 Ga0500616_0064234 3300053153 Bacteria 1891
604 Ga0500637_0100903 3300053178 Bacteria 1674
605 Ga0500567_060127 3300053723 Bacteria 1705
606 2644029196 2643221603 Bacteria 6147767
607 2842737132 2842733646 Bacteria 5716726
608 2842750380 2842747753 Bacteria 5578255
609 2885193351 2885192300 Bacteria 5882526
610 Ga0070676_10136486
611 Ga0065707_10129034
612 Ga0070658_10054027
613 Ga0070658_10117321
614 Ga0070658_10600442
615 Ga0070676_10006340
616 Ga0070676_10007040
617 Ga0070676_10097154
618 Ga0070676_10157357
619 Ga0070683_100010663
620 Ga0070683_100176102
621 Ga0070690_100123560
622 Ga0070690_100187373
623 Ga0070670_100000922
624 Ga0070670_100020914
625 Ga0070670_100021864
626 Ga0070670_100030097
627 Ga0070670_100095973
628 Ga0070670_100099822
629 Ga0070670_100418805
630 Ga0070677_10015858
631 Ga0070677_10076875
632 Ga0070677_10231593
633 Ga0068869_100000584
634 Ga0068869_100077563
635 Ga0068869_100176474
636 Ga0070666_10002465
637 Ga0070666_10225068
638 Ga0070680_100134502
639 Ga0070682_100664956
640 Ga0068868_100000189
641 Ga0068868_100007199
642 Ga0068868_100042463
643 Ga0068868_100064005
644 Ga0068868_100570367
645 Ga0070660_100003956
646 Ga0070660_100017086
647 Ga0070660_100853479
648 Ga0070691_10223407
649 Ga0070687_100072899
650 Ga0070687_100254757
651 Ga0070661_100016900
652 Ga0070661_100145342
653 Ga0070661_100151460
654 Ga0070661_100333041
655 Ga0070668_100023686
656 Ga0070668_100025239
657 Ga0070668_100083682
658 Ga0070668_100091935
659 Ga0070668_100585113
660 Ga0070669_100112000
661 Ga0070669_100381525
662 Ga0070675_100000563
663 Ga0070675_100009566
664 Ga0070675_100041355
665 Ga0070675_100187285
666 Ga0070675_100303744
667 Ga0070675_100376153
668 Ga0070671_100005126
669 Ga0070671_100012832
670 Ga0070671_100021121
671 Ga0070671_100047550
672 Ga0070671_100048034
673 Ga0070671_100075407
674 Ga0070671_100092962
675 Ga0070671_100259406
676 Ga0070671_100283762
677 Ga0070674_100017879
678 Ga0070674_100035252
679 Ga0070674_100137009
680 Ga0070674_100486988
681 Ga0070673_100001225
682 Ga0070673_100015796
683 Ga0070673_100023302
684 Ga0070673_100281972
685 Ga0070688_100036433
686 Ga0070688_100157216
687 Ga0070688_100430097
688 Ga0070659_100153375
689 Ga0070659_100355076
690 Ga0070667_100001024
691 Ga0070667_100015983
692 Ga0070667_100076439
693 Ga0070667_100250027
694 Ga0070667_100359748
695 Ga0070714_100344151
696 Ga0070700_100035879
697 Ga0070663_100005928
698 Ga0070663_100064832
699 Ga0070663_100160396
700 Ga0070663_100375493
701 Ga0070678_100041248
702 Ga0070678_100085619
703 Ga0070678_100095484
704 Ga0070678_100224277
705 Ga0070678_100736623
706 Ga0070662_100003633
707 Ga0070662_100308043
708 Ga0070662_100333865
709 Ga0070681_10812781
710 Ga0068867_100006149
711 Ga0068867_100025911
712 Ga0068867_100044392
713 Ga0068867_100154413
714 Ga0068867_100198049
715 Ga0070679_100035499
716 Ga0070684_100217342
717 Ga0068853_100027650
718 Ga0068853_100247199
719 Ga0070672_100055012
720 Ga0070672_100056905
721 Ga0070672_100115208
722 Ga0070672_100124135
723 Ga0070672_100135373
724 Ga0070672_100241505
725 Ga0070672_100329636
726 Ga0070686_100095159
727 Ga0070695_100374246
728 Ga0070693_100062796
729 Ga0070693_100077412
730 Ga0070693_100215229
731 Ga0070665_100227175
732 Ga0070665_100250487
733 Ga0068855_100012729
734 Ga0068855_100650703
735 Ga0070664_100238320
736 Ga0070664_100322281
737 Ga0070664_100421847
738 Ga0070664_100422607
739 Ga0068854_100015853
740 Ga0068854_100035169
741 Ga0068854_100188495
742 Ga0068854_100763470
743 Ga0068856_100034459
744 Ga0068856_100227777
745 Ga0070702_100063253
746 Ga0070702_100122841
747 Ga0068852_100011475
748 Ga0068852_100020789
749 Ga0068852_100105296
750 Ga0068852_100135594
751 Ga0068852_100188825
752 Ga0068852_100581674
753 Ga0068859_100028658
754 Ga0068859_100031452
755 Ga0068859_100052149
756 Ga0068859_100132350
757 Ga0068859_100413672
758 Ga0068864_100002453
759 Ga0068864_100006881
760 Ga0068864_100085288
761 Ga0068864_100094372
762 Ga0068864_100112605
763 Ga0068864_100113243
764 Ga0068861_100005129
765 Ga0068861_100012814
766 Ga0068861_100071047
767 Ga0068861_100261064
768 Ga0068851_10027330
769 Ga0068851_10031985
770 Ga0068851_10041492
771 Ga0068851_10069633
772 Ga0068870_10090584
773 Ga0068863_100002502
774 Ga0068863_100071401
775 Ga0068863_100162916
776 Ga0068863_100292645
777 Ga0068863_100492543
778 Ga0068858_100000882
779 Ga0068858_100070707
780 Ga0068858_100107231
781 Ga0068858_100145979
782 Ga0068858_100388373
783 Ga0068860_100003206
784 Ga0068860_100007353
785 Ga0068860_100016639
786 Ga0068860_100515849
787 Ga0068862_100007694
788 Ga0068862_100021668
789 Ga0068862_100029672
790 Ga0068862_100037497
791 Ga0068862_101181817
792 Ga0081455_10341467
793 Ga0075365_10113101
794 Ga0075368_10001270
795 Ga0075363_100000768
796 Ga0070715_10095973
797 Ga0075362_10009917
798 Ga0075367_10089883
799 Ga0075366_10010651
800 Ga0075366_10020528
801 Ga0075366_10100708
802 Ga0075366_10114193
803 Ga0097621_100040699
804 Ga0097621_100174147
805 Ga0097621_100374562
806 Ga0068871_100005268
807 Ga0068871_100619438
808 Ga0068871_100758125
809 Ga0075430_100651851
810 Ga0075429_100148261
811 Ga0068865_100008577
812 Ga0068865_100009177
813 Ga0097620_100028657
814 Ga0097620_100031452
815 Ga0097620_100052151
816 Ga0097620_100132358
817 Ga0097620_100413655
818 Ga0105240_10036890
819 Ga0105240_10775652
820 Ga0111539_11742699
821 Ga0105245_10003302
822 Ga0105247_10226048
823 Ga0105243_10055054
824 Ga0105243_10140823
825 Ga0105243_11253634
826 Ga0105241_10480750
827 Ga0105242_10012976
828 Ga0105248_10019714
829 Ga0105248_10064873
830 Ga0105248_10171918
831 Ga0105248_10414040
832 Ga0105248_10436620
833 Ga0105248_10869965
834 Ga0105238_10050623
835 Ga0105238_10120453
836 Ga0105238_10720744
837 Ga0105249_10040727
838 Ga0105249_10062859
839 Ga0157373_10017384
840 Ga0157371_10044292
841 Ga0157371_10096247
842 Ga0157370_10126808
843 Ga0157369_10360379
844 Ga0157374_10022298
845 Ga0157378_10063356
846 Ga0163162_10001712
847 Ga0163162_10001724
848 Ga0163162_10041717
849 Ga0163162_10090800
850 Ga0163162_10235782
851 Ga0157372_10077106
852 Ga0157372_10096628
853 Ga0157372_10481745
854 Ga0157375_10014793
855 Ga0157375_10017915
856 Ga0157375_10044003
857 Ga0157375_10112038
858 Ga0157375_10127181
859 Ga0157375_10349246
860 Ga0163163_10001152
861 Ga0163163_10214177
862 Ga0163163_10652803
863 Ga0157380_10018256
864 Ga0157380_10091790
865 Ga0157380_10120068
866 Ga0157380_10166571
867 Ga0157377_10002714
868 Ga0157379_10001364
869 Ga0157379_10013256
870 Ga0157379_10040483
871 Ga0157379_10142820
872 Ga0157379_10171601
873 Ga0157376_10008670
874 Ga0157376_10010081
875 Ga0157376_10170681
876 Ga0157376_10253837
877 Ga0157376_11229161
878 Ga0163161_10017226
879 Ga0163161_10020321
880 Ga0163161_10081575
881 Ga0163161_10307799
882 Ga0207656_10064166
883 Ga0207656_10144660
884 Ga0207656_10148749
885 Ga0207682_10013956
886 Ga0207682_10019505
887 Ga0207682_10026234
888 Ga0207642_10007762
889 Ga0207642_10126822
890 Ga0207710_10211943
891 Ga0207688_10161992
892 Ga0207680_10000661
893 Ga0207680_10087512
894 Ga0207680_10206442
895 Ga0207685_10065703
896 Ga0207645_10005151
897 Ga0207645_10033325
898 Ga0207645_10105044
899 Ga0207645_10286179
900 Ga0207645_10317982
901 Ga0207645_10581157
902 Ga0207643_10044623
903 Ga0207643_10096180
904 Ga0207705_10077307
905 Ga0207705_10278114
906 Ga0207705_10338156
907 Ga0207705_10542563
908 Ga0207707_10174640
909 Ga0207707_10318289
910 Ga0207695_10210150
911 Ga0207671_10092523
912 Ga0207663_10095653
913 Ga0207662_10051159
914 Ga0207662_10064890
915 Ga0207657_10031162
916 Ga0207657_10037637
917 Ga0207657_10085632
918 Ga0207657_10142399
919 Ga0207649_10055468
920 Ga0207649_10124835
921 Ga0207649_10237879
922 Ga0207649_10295046
923 Ga0207652_10113926
924 Ga0207681_10007269
925 Ga0207681_10016094
926 Ga0207681_10019750
927 Ga0207681_10159387
928 Ga0207694_10116300
929 Ga0207694_10298954
930 Ga0207650_10003058
931 Ga0207650_10013978
932 Ga0207650_10038346
933 Ga0207650_10100281
934 Ga0207659_10000474
935 Ga0207659_10006781
936 Ga0207659_10009792
937 Ga0207659_10274497
938 Ga0207687_10080782
939 Ga0207687_10087628
940 Ga0207664_10196020
941 Ga0207644_10001390
942 Ga0207644_10004154
943 Ga0207644_10020806
944 Ga0207644_10063015
945 Ga0207690_10062156
946 Ga0207690_10086751
947 Ga0207706_10007325
948 Ga0207706_10126409
949 Ga0207706_10246024
950 Ga0207686_10034220
951 Ga0207709_10104123
952 Ga0207670_10297664
953 Ga0207670_10789311
954 Ga0207669_10224782
955 Ga0207704_10016098
956 Ga0207704_10172723
957 Ga0207691_10006056
958 Ga0207691_10015369
959 Ga0207691_10022164
960 Ga0207691_10039125
961 Ga0207691_10042550
962 Ga0207691_10078021
963 Ga0207691_10121578
964 Ga0207691_10202484
965 Ga0207711_10036602
966 Ga0207711_10037245
967 Ga0207711_10041956
968 Ga0207711_10073616
969 Ga0207711_10388116
970 Ga0207689_10000313
971 Ga0207689_10037244
972 Ga0207661_10154744
973 Ga0207661_10174834
974 Ga0207679_10043465
975 Ga0207679_10599790
976 Ga0207667_10048820
977 Ga0207667_10076657
978 Ga0207667_10544681
979 Ga0207651_10000495
980 Ga0207651_10167233
981 Ga0207712_10053887
982 Ga0207668_10013343
983 Ga0207668_10048041
984 Ga0207668_10048786
985 Ga0207668_10344345
986 Ga0207668_10555430
987 Ga0207640_10171787
988 Ga0207640_10313001
989 Ga0207658_10000692
990 Ga0207658_10021202
991 Ga0207658_10030521
992 Ga0207658_10223563
993 Ga0207658_10226879
994 Ga0207658_10244452
995 Ga0207658_10421975
996 Ga0207677_10022680
997 Ga0207677_10063019
998 Ga0207677_10081720
999 Ga0207703_10000795
1000 Ga0207703_10011304
1001 Ga0207703_10050840
1002 Ga0207703_10099621
1003 Ga0207639_10008478
1004 Ga0207639_10187309
1005 Ga0207639_10297386
1006 Ga0207639_10391927
1007 Ga0207678_10012377
1008 Ga0207678_10024211
1009 Ga0207678_10079784
1010 Ga0207708_10011614
1011 Ga0207708_10017645
1012 Ga0207702_10023090
1013 Ga0207641_10001123
1014 Ga0207641_10013187
1015 Ga0207641_10029577
1016 Ga0207648_10016527
1017 Ga0207648_10050953
1018 Ga0207648_10067923
1019 Ga0207648_10068244
1020 Ga0207648_10080995
1021 Ga0207648_10122135
1022 Ga0207648_10341019
1023 Ga0207676_10000841
1024 Ga0207676_10096919
1025 Ga0207676_10122791
1026 Ga0207676_10147100
1027 Ga0207676_10433489
1028 Ga0207674_10097127
1029 Ga0207674_10133339
1030 Ga0207675_100001252
1031 Ga0207675_100008238
1032 Ga0207675_100008626
1033 Ga0207675_100063402
1034 Ga0207675_100466043
1035 Ga0207683_10002091
1036 Ga0207683_10022914
1037 Ga0207683_10034679
1038 Ga0207683_10052481
1039 Ga0207683_10060777
1040 Ga0207683_10404691
1041 Ga0207683_10429277
1042 Ga0207683_10588477
1043 Ga0207683_10829742
1044 Ga0207683_10927170
1045 Ga0207698_10043712
1046 Ga0207698_10050298
1047 Ga0209813_10004449
1048 Ga0268266_10184256
1049 Ga0268266_10186504
1050 Ga0268266_10308893
1051 Ga0268265_10042486
1052 Ga0268265_10218318
1053 Ga0268265_10577596
1054 Ga0268264_10016355
1055 Ga0268264_10018865
1056 Ga0268264_10023588
1057 Ga0268264_10093367
1058 Ga0268264_10140656
1059 Ga0307515_10220955
1060 Ga0307515_10235965
1061 Ga0307515_10328085
1062 Ga0307511_10000499
1063 Ga0265320_10184888
1064 Ga0307513_10094333
1065 Ga0307513_10122014
1066 Ga0307408_100017923
1067 Ga0307516_10309291
1068 Ga0307405_10007368
1069 Ga0307405_10108739
1070 Ga0307413_10009345
1071 Ga0307410_10028480
1072 Ga0307410_10168033
1073 Ga0307410_10186855
1074 Ga0307406_10003267
1075 Ga0307406_10192695
1076 Ga0307412_10037254
1077 Ga0307409_100003569
1078 Ga0307416_100261260
1079 Ga0307416_100316774
1080 Ga0307414_10022393
1081 Ga0307414_10026404
1082 Ga0307411_10000547
1083 Ga0307411_10218778
1084 Ga0307411_10231647
1085 Ga0307411_10344543
1086 Ga0307415_100001658
1087 Ga0373938_0051429
1088 Ga0373940_0017355
1089 Ga0373944_0021020
1090 Ga0373932_0076748
1091 Ga0373941_0019737
1092 Ga0373943_0108025
1093 Ga0373931_0001232
1094 Ga0373937_0126602
1095 Ga0373937_0165940
1096 Ga0373925_0002569
1097 Ga0436363_1668221
1098 Ga0439436_0001548
1099 Ga0439447_017935
1100 Ga0439465_0000774
1101 Ga0439465_0088336
1102 Ga0451839_1029217
1103 Ga0439431_0000394
1104 Ga0439433_0000762
1105 Ga0439432_001228
1106 Ga0439449_0004724
1107 Ga0439449_0015673
1108 Ga0439457_007734
1109 Ga0450911_000712
1110 Ga0450909_002481
1111 Ga0439434_0000875
1112 Ga0439464_0015982
1113 Ga0451577_0018003
1114 Ga0453683_0002262
1115 Ga0453683_0276658
1116 Ga0453684_0161255
1117 Ga0453684_0197573
1118 Ga0451576_0014155
1119 Ga0451576_0035371
1120 Ga0451576_0048819
1121 Ga0451576_0432361
1122 Ga0495580_0148077
1123 Ga0495639_0294168
1124 Ga0495664_0233112
1125 Ga0495643_0011139
1126 Ga0495642_0023583
1127 Ga0495642_0205276
1128 Ga0495586_0166811
1129 Ga0495621_0056869
1130 Ga0495621_0091420
1131 Ga0495597_0007214
1132 Ga0495645_0132145
1133 Ga0495668_0036669
1134 Ga0495661_0018224
1135 Ga0495647_0008396
1136 Ga0495670_0163023
1137 Ga0495672_0121703
1138 Ga0495687_010886
1139 Ga0495687_044667
1140 Ga0495686_0021904
1141 Ga0495615_0005600
1142 Ga0496100_0007604
1143 Ga0496101_0023723
1144 Ga0496101_0105662
1145 Ga0496102_0030362
1146 Ga0496102_0416779
1147 Ga0496103_0146646
1148 Ga0496104_0149191
1149 Ga0496105_0203108
1150 Ga0496105_0415299
1151 Ga0496105_0476351
1152 Ga0496105_0570064
1153 Ga0496106_0010427
1154 Ga0496106_0254981
1155 Ga0496108_0009386
1156 Ga0496108_0039969
1157 Ga0496108_0086445
1158 Ga0496108_0197053
1159 Ga0496108_0433875
1160 Ga0496109_0453337
1161 Ga0496109_0520217
1162 Ga0496110_0024349
1163 Ga0496110_0715236
1164 Ga0496111_0036291
1165 Ga0496114_0092815
1166 Ga0496114_0340303
1167 Ga0496115_0006951
1168 Ga0496117_0144935
1169 Ga0496121_0015380
1170 Ga0496121_0249322
1171 Ga0496122_0000039
1172 Ga0496122_0219982
1173 Ga0496123_0000026
1174 Ga0496124_0063623
1175 Ga0496124_0105598
1176 Ga0496124_0177772
1177 Ga0496124_0502908
1178 Ga0496125_0014317
1179 Ga0496125_0040084
1180 Ga0496125_0045942
1181 Ga0496126_0012024
1182 Ga0496126_0088790
1183 Ga0496126_0690542
1184 Ga0501068_0607343
1185 nmdc:mga03683_44504_c1
1186 nmdc:mga03n38_11318_c1
1187 nmdc:mga00v17_135088_c1
1188 nmdc:mga0k408_104479_c1
1189 nmdc:mga0k408_263345_c1
1190 nmdc:mga04h51_2605_c1
1191 nmdc:mga07m45_73322_c1
1192 nmdc:mga05p37_351472_c1
1193 nmdc:mga09592_141787_c1
1194 nmdc:mga0qj67_107891_c1
1195 nmdc:mga0qj67_22457_c1
1196 Ga0495601_0514468
1197 Ga0500646_0000464
1198 Ga0500583_0016170
1199 Ga0500583_0242114
1200 Ga0500651_0224077
1201 Ga0500648_168151
1202 Ga0500594_0012011
1203 Ga0500595_002224
1204 Ga0500628_073642
1205 Ga0500655_007900
1206 Ga0500559_0003935
1207 Ga0500559_0021375
1208 Ga0500559_0125383
1209 Ga0500573_0008795
1210 Ga0500573_0102443
1211 Ga0500604_0000243
1212 Ga0500616_0064234
1213 Ga0500637_0100903
1214 Ga0500567_060127
1215 2644029196
1216 2842737132
1217 2842750380
1218 2885193351

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

17

162

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9142 2 213
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9087 2 212
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9037 2 213
5x40-assembly1.cif.gz_B structure of a cbio dimer bound with amppcp 0.8982 2 213
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.8973 2 211
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9369 1 212 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9352 1 212 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9308 2 70 3.40.50.300
af_A0A0P0VBQ7_902_1031_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9222 2 71 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9122 1 212 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A537XP74-F1-model_v4 ATP-binding cassette domain-containing protein 0.9774 2 178 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A4R0BG06-F1-model_v4 deleted 0.9645 1 212
AF-A0A1Q7D514-F1-model_v4 ABC transporter ATP-binding protein 0.9642 1 212 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A426VCW3-F1-model_v4 ATP-binding cassette domain-containing protein 0.9615 1 212 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A7C2FUK1-F1-model_v4 ATP-binding cassette domain-containing protein 0.9614 1 212 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map