F468718

General Info

Members Datasets Scaffolds Average Seq Length
607 399 1214 187

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0347270|Ga0436361_0347270_78_740
Length 220
Sequence MQDLTPPYRHGCTAGTKLLGSAPVFSKPIRIIMKIDANLIRPGNILEHNNRQWAVLKIQIVQPGKGGAFIQVEMRDVRTGTKTQERWRTVDTVEKLQVEEKECTYLFGDGESITFMDQETYEQFTVSRELVGEPGAFLQDGMTCTIDMIEGSPVSVTLPDKVVMTVTEADPVVKGQTAASSYKPGLLENGVRVLIPPFVEAGTRIVVNTADATYVERAKD

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
141 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
214 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
217 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
218 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
219 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
220 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
221 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
222 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
223 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
224 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
225 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
226 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
231 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
232 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
233 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
234 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
235 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
240 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
241 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
242 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
245 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
246 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
247 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
254 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
260 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
263 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
264 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
265 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
266 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
267 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
268 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
269 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
270 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
278 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
279 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
280 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
281 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
282 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
285 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
286 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
287 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
292 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
293 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
294 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
298 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
299 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
331 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
332 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
333 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
334 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
335 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
336 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
337 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
338 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
339 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
340 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
341 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
344 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
345 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
346 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
347 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
348 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
351 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
352 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
353 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
354 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
355 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
356 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
357 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
358 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
359 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
360 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
363 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
364 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
365 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
366 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
367 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
368 2534681786 Brucella suis 92/29 Isolate Unclassified
369 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
370 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
371 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
372 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
373 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
374 2643221607 Rhizobium sp. Root73 Isolate Unclassified
375 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
376 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
377 2643221688 Rhizobium sp. Root482 Isolate Unclassified
378 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
379 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
380 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
381 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
382 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
383 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
384 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
385 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
386 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
387 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
388 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
389 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
390 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
391 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
392 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
393 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
394 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
395 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
396 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
397 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
398 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
399 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.25
Metatranscriptomes 0.82
Isolates 5.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.97
Nodule 0.33
Rhizoplane 7.25
Rhizosphere 85.34
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0347270 3300039447 Bacteria 907
2 SwRhRL2b_contig_345966 2162886007 Bacteria 931
3 SwRhRL2b_contig_3681263 2162886007 Bacteria 877
4 JGI24737J22298_10088585 3300001990 Bacteria 919
5 JGI24750J21931_1001475 3300002070 Bacteria 2918
6 JGI24748J21848_1010959 3300002074 Bacteria 1066
7 JGI24738J21930_10044430 3300002075 Bacteria 904
8 JGI24749J21850_1024409 3300002076 Bacteria 861
9 JGI24744J21845_10025792 3300002077 Bacteria 1143
10 JGI24034J26672_10026285 3300002239 Bacteria 933
11 JGI24742J22300_10033591 3300002244 Bacteria 901
12 JGI25406J46586_10031467 3300003203 Bacteria 1984
13 JGI25160J50197_1009123 3300003354 Bacteria 3709
14 Ga0055536_1005913 3300003781 Bacteria 5855
15 Ga0055530_10042377 3300003791 Bacteria 1105
16 Ga0055531_10006826 3300003794 Bacteria 6371
17 JGI25405J52794_10056826 3300003911 Bacteria 843
18 Ga0070658_10307996 3300005327 Bacteria 1351
19 Ga0070676_10000987 3300005328 Bacteria 14130
20 Ga0070676_10316975 3300005328 Bacteria 1062
21 Ga0070683_100066827 3300005329 Bacteria 3349
22 Ga0070683_100211128 3300005329 Bacteria 1844
23 Ga0070683_100468363 3300005329 Bacteria 1203
24 Ga0070690_100000506 3300005330 Bacteria 19537
25 Ga0070670_100001094 3300005331 Bacteria 21528
26 Ga0070670_100220958 3300005331 Bacteria 1648
27 Ga0070670_100732890 3300005331 Bacteria 890
28 Ga0068869_100084816 3300005334 Bacteria 2372
29 Ga0070666_10002984 3300005335 Bacteria 10257
30 Ga0070666_10442344 3300005335 Bacteria 938
31 Ga0070680_100021223 3300005336 Bacteria 5160
32 Ga0070682_100004821 3300005337 Bacteria 7489
33 Ga0068868_100000904 3300005338 Bacteria 20173
34 Ga0070660_100001178 3300005339 Bacteria 17696
35 Ga0070660_100032089 3300005339 Bacteria 3950
36 Ga0070689_100004127 3300005340 Bacteria 9782
37 Ga0070689_100779159 3300005340 Bacteria 840
38 Ga0070691_10000155 3300005341 Bacteria 22187
39 Ga0070687_100008938 3300005343 Bacteria 4266
40 Ga0070661_100001464 3300005344 Bacteria 16401
41 Ga0070692_10000912 3300005345 Bacteria 10006
42 Ga0070692_10624784 3300005345 Bacteria 716
43 Ga0070668_100000692 3300005347 Bacteria 22968
44 Ga0070668_100346596 3300005347 Bacteria 1256
45 Ga0070669_100000807 3300005353 Bacteria 22765
46 Ga0070675_100012884 3300005354 Bacteria 6563
47 Ga0070671_100001121 3300005355 Bacteria 19883
48 Ga0070674_100001386 3300005356 Bacteria 12805
49 Ga0070674_100029503 3300005356 Bacteria 3614
50 Ga0070673_100000626 3300005364 Bacteria 19353
51 Ga0070673_100219163 3300005364 Bacteria 1646
52 Ga0070673_100898474 3300005364 Bacteria 821
53 Ga0070688_100000139 3300005365 Bacteria 39353
54 Ga0070659_100015488 3300005366 Bacteria 5712
55 Ga0070667_100017103 3300005367 Bacteria 6008
56 Ga0070709_10001924 3300005434 Bacteria 11284
57 Ga0070714_100001275 3300005435 Bacteria 18217
58 Ga0070714_100002022 3300005435 Bacteria 14858
59 Ga0070713_100402886 3300005436 Bacteria 1278
60 Ga0070710_10013755 3300005437 Bacteria 4060
61 Ga0070701_10001747 3300005438 Bacteria 8179
62 Ga0070701_10057859 3300005438 Bacteria 2033
63 Ga0070711_100002491 3300005439 Bacteria 10512
64 Ga0070705_100000298 3300005440 Bacteria 29561
65 Ga0070705_100873241 3300005440 Bacteria 721
66 Ga0070700_100000648 3300005441 Bacteria 17205
67 Ga0070694_100004154 3300005444 Bacteria 8699
68 Ga0070694_100070603 3300005444 Bacteria 2405
69 Ga0070694_100106037 3300005444 Bacteria 1995
70 Ga0070708_100124794 3300005445 Bacteria 2378
71 Ga0070663_100003945 3300005455 Bacteria 8650
72 Ga0070678_100000734 3300005456 Bacteria 16335
73 Ga0070678_100313141 3300005456 Bacteria 1338
74 Ga0070662_100001979 3300005457 Bacteria 12572
75 Ga0070662_100728177 3300005457 Bacteria 840
76 Ga0070681_10001440 3300005458 Bacteria 20950
77 Ga0070681_10057357 3300005458 Bacteria 3874
78 Ga0070681_10156466 3300005458 Bacteria 2204
79 Ga0070681_10241360 3300005458 Bacteria 1720
80 Ga0070681_10639990 3300005458 Bacteria 978
81 Ga0070685_10002499 3300005466 Bacteria 9438
82 Ga0070706_100659371 3300005467 Unclassified 971
83 Ga0070707_100721244 3300005468 Bacteria 960
84 Ga0070698_101085203 3300005471 Bacteria 749
85 Ga0070699_100262442 3300005518 Bacteria 1545
86 Ga0070679_100020169 3300005530 Bacteria 6496
87 Ga0070679_100065459 3300005530 Bacteria 3623
88 Ga0070679_100075617 3300005530 Bacteria 3357
89 Ga0070679_100545952 3300005530 Bacteria 1103
90 Ga0070684_100092785 3300005535 Bacteria 2687
91 Ga0070684_100194552 3300005535 Bacteria 1846
92 Ga0070697_100023341 3300005536 Bacteria 4918
93 Ga0068853_100013838 3300005539 Bacteria 6595
94 Ga0070672_100001796 3300005543 Bacteria 13421
95 Ga0070686_100000266 3300005544 Bacteria 35675
96 Ga0070695_100000864 3300005545 Bacteria 16329
97 Ga0070695_100537000 3300005545 Bacteria 910
98 Ga0070696_100000333 3300005546 Bacteria 28647
99 Ga0070696_100474229 3300005546 Bacteria 991
100 Ga0070693_100000326 3300005547 Bacteria 21830
101 Ga0070704_100011313 3300005549 Bacteria 5467
102 Ga0070704_100212585 3300005549 Bacteria 1568
103 Ga0068855_100007108 3300005563 Bacteria 13578
104 Ga0068855_100151444 3300005563 Bacteria 2637
105 Ga0068855_100260651 3300005563 Bacteria 1931
106 Ga0068855_100281082 3300005563 Bacteria 1848
107 Ga0070664_100018030 3300005564 Bacteria 5795
108 Ga0068857_100007649 3300005577 Bacteria 9304
109 Ga0068857_100162482 3300005577 Bacteria 2027
110 Ga0068854_100000885 3300005578 Bacteria 18009
111 Ga0068854_100168990 3300005578 Bacteria 1700
112 Ga0068856_100002298 3300005614 Bacteria 19709
113 Ga0068856_100364984 3300005614 Bacteria 1463
114 Ga0070702_100000139 3300005615 Bacteria 22443
115 Ga0070702_100025937 3300005615 Bacteria 3145
116 Ga0068852_100001969 3300005616 Bacteria 13992
117 Ga0068859_100072515 3300005617 Bacteria 3480
118 Ga0068859_100540647 3300005617 Bacteria 1260
119 Ga0068859_100630765 3300005617 Bacteria 1164
120 Ga0068859_101015098 3300005617 Unclassified 911
121 Ga0068864_100011694 3300005618 Bacteria 7248
122 Ga0068866_10006115 3300005718 Bacteria 5009
123 Ga0068866_10074171 3300005718 Bacteria 1808
124 Ga0068861_100002618 3300005719 Bacteria 11760
125 Ga0068863_100000834 3300005841 Bacteria 30888
126 Ga0068858_100001979 3300005842 Bacteria 20923
127 Ga0068858_100056987 3300005842 Bacteria 3611
128 Ga0068860_100002133 3300005843 Bacteria 20873
129 Ga0068860_100321835 3300005843 Bacteria 1518
130 Ga0068862_100008752 3300005844 Bacteria 8380
131 Ga0068862_100030783 3300005844 Bacteria 4524
132 Ga0081455_10003421 3300005937 Bacteria 18246
133 Ga0081455_10103891 3300005937 Bacteria 2274
134 Ga0081455_10170377 3300005937 Bacteria 1659
135 Ga0081540_1050077 3300005983 Bacteria 2078
136 Ga0075432_10006309 3300006058 Bacteria 4031
137 Ga0070715_10003350 3300006163 Bacteria 5079
138 Ga0070715_10547431 3300006163 Bacteria 670
139 Ga0070716_100000665 3300006173 Bacteria 14606
140 Ga0070712_100000828 3300006175 Bacteria 18403
141 Ga0075369_10100426 3300006186 Bacteria 1298
142 Ga0097621_100052449 3300006237 Bacteria 3323
143 Ga0068871_100020391 3300006358 Bacteria 5077
144 Ga0075428_100011583 3300006844 Bacteria 9812
145 Ga0075430_100263289 3300006846 Bacteria 1428
146 Ga0075431_100006991 3300006847 Bacteria 11220
147 Ga0075433_10057597 3300006852 Bacteria 3397
148 Ga0075433_10091162 3300006852 Bacteria 2694
149 Ga0075434_100038910 3300006871 Bacteria 4712
150 Ga0075434_100658168 3300006871 Bacteria 1066
151 Ga0075429_100007710 3300006880 Bacteria 9344
152 Ga0068865_100010883 3300006881 Bacteria 5675
153 Ga0075436_100022707 3300006914 Bacteria 4310
154 Ga0097620_100072507 3300006931 Bacteria 3480
155 Ga0097620_100540652 3300006931 Bacteria 1260
156 Ga0097620_100630762 3300006931 Bacteria 1164
157 Ga0097620_101015247 3300006931 Unclassified 911
158 Ga0075435_100019751 3300007076 Bacteria 5153
159 Ga0075435_100207332 3300007076 Bacteria 1662
160 Ga0105251_10137375 3300009011 Bacteria 1106
161 Ga0105250_10010349 3300009092 Bacteria 3887
162 Ga0105240_10032679 3300009093 Bacteria 6734
163 Ga0105240_10044054 3300009093 Bacteria 5674
164 Ga0105240_11091264 3300009093 Bacteria 850
165 Ga0111539_10417778 3300009094 Bacteria 1562
166 Ga0105245_10000795 3300009098 Bacteria 28669
167 Ga0105247_10002881 3300009101 Bacteria 11450
168 Ga0114129_10123347 3300009147 Bacteria 3563
169 Ga0105243_10007413 3300009148 Bacteria 8435
170 Ga0105243_10097656 3300009148 Bacteria 2432
171 Ga0105241_10003139 3300009174 Bacteria 12289
172 Ga0105242_10239960 3300009176 Bacteria 1629
173 Ga0105248_10004961 3300009177 Bacteria 14704
174 Ga0105248_10995210 3300009177 Bacteria 947
175 Ga0105237_10002479 3300009545 Bacteria 22904
176 Ga0105237_10193875 3300009545 Bacteria 2031
177 Ga0105237_11316040 3300009545 Bacteria 729
178 Ga0105238_10000136 3300009551 Bacteria 80983
179 Ga0105238_10155349 3300009551 Bacteria 2263
180 Ga0105249_10007009 3300009553 Bacteria 9835
181 Ga0105249_10019431 3300009553 Bacteria 6062
182 Ga0105239_10015919 3300010375 Bacteria 8324
183 Ga0105246_10010014 3300011119 Bacteria 5847
184 Ga0157335_1012194 3300012492 Bacteria 716
185 Ga0157373_10060317 3300013100 Bacteria 2688
186 Ga0157371_10010729 3300013102 Bacteria 7115
187 Ga0157371_10013083 3300013102 Bacteria 6317
188 Ga0157370_10002838 3300013104 Bacteria 20711
189 Ga0157370_10030490 3300013104 Bacteria 5283
190 Ga0157370_10094453 3300013104 Bacteria 2805
191 Ga0157369_10006851 3300013105 Bacteria 13147
192 Ga0157369_10205998 3300013105 Bacteria 2063
193 Ga0157374_10092147 3300013296 Bacteria 2891
194 Ga0157378_11178527 3300013297 Bacteria 805
195 Ga0163162_10018703 3300013306 Bacteria 6789
196 Ga0163162_10455268 3300013306 Bacteria 1411
197 Ga0157372_10905216 3300013307 Bacteria 1023
198 Ga0157375_10006110 3300013308 Bacteria 10497
199 Ga0157375_10006188 3300013308 Bacteria 10430
200 Ga0157375_10302062 3300013308 Bacteria 1764
201 Ga0157375_11517202 3300013308 Unclassified 791
202 Ga0163163_10003201 3300014325 Bacteria 13874
203 Ga0157380_10001853 3300014326 Bacteria 13986
204 Ga0182008_10129940 3300014497 Bacteria 1255
205 Ga0157377_10005976 3300014745 Bacteria 5766
206 Ga0157377_10193963 3300014745 Bacteria 1285
207 Ga0157379_10008173 3300014968 Bacteria 9086
208 Ga0157379_10348792 3300014968 Bacteria 1355
209 Ga0157376_10000272 3300014969 Bacteria 35217
210 Ga0163161_10002256 3300017792 Bacteria 13831
211 Ga0163161_10008969 3300017792 Bacteria 6917
212 Ga0206354_10395558 3300020081 Bacteria 1153
213 Ga0213872_10000015 3300021361 Bacteria 180923
214 Ga0213872_10009790 3300021361 Bacteria 4581
215 Ga0213875_10009612 3300021388 Bacteria 4888
216 Ga0213875_10137166 3300021388 Bacteria 1144
217 Ga0209130_1000732 3300025284 Bacteria 29001
218 Ga0209676_1000019 3300025292 Bacteria 620012
219 Ga0209025_1000509 3300025294 Bacteria 74336
220 Ga0209758_1003243 3300025297 Bacteria 15094
221 Ga0209050_1002828 3300025298 Bacteria 13820
222 Ga0209050_1019231 3300025298 Bacteria 2605
223 Ga0207426_1000080 3300025302 Bacteria 304917
224 Ga0209257_1000407 3300025304 Bacteria 83438
225 Ga0209257_1050148 3300025304 Bacteria 1183
226 Ga0207697_10043250 3300025315 Bacteria 1852
227 Ga0207696_1010591 3300025711 Bacteria 3371
228 Ga0207692_10009314 3300025898 Bacteria 4095
229 Ga0207642_10014815 3300025899 Bacteria 2888
230 Ga0207642_10025853 3300025899 Bacteria 2381
231 Ga0207710_10007162 3300025900 Bacteria 4732
232 Ga0207688_10022493 3300025901 Bacteria 3450
233 Ga0207688_10111040 3300025901 Bacteria 1591
234 Ga0207680_10055367 3300025903 Bacteria 2390
235 Ga0207647_10009490 3300025904 Bacteria 6910
236 Ga0207647_10022158 3300025904 Bacteria 4225
237 Ga0207647_10301756 3300025904 Bacteria 912
238 Ga0207685_10011336 3300025905 Bacteria 2676
239 Ga0207699_10001015 3300025906 Bacteria 13296
240 Ga0207699_10012546 3300025906 Bacteria 4312
241 Ga0207645_10003182 3300025907 Bacteria 12568
242 Ga0207705_10011206 3300025909 Bacteria 6499
243 Ga0207705_10256260 3300025909 Bacteria 1335
244 Ga0207654_10002679 3300025911 Bacteria 9043
245 Ga0207707_10001919 3300025912 Bacteria 18897
246 Ga0207707_10151852 3300025912 Bacteria 2024
247 Ga0207707_10192226 3300025912 Bacteria 1780
248 Ga0207695_10134579 3300025913 Bacteria 2426
249 Ga0207695_10178461 3300025913 Bacteria 2045
250 Ga0207695_10749852 3300025913 Bacteria 857
251 Ga0207671_10093458 3300025914 Bacteria 2269
252 Ga0207693_10000607 3300025915 Bacteria 32076
253 Ga0207693_10117966 3300025915 Bacteria 2084
254 Ga0207663_10081631 3300025916 Bacteria 2118
255 Ga0207660_10024108 3300025917 Bacteria 4115
256 Ga0207662_10005337 3300025918 Bacteria 6840
257 Ga0207657_10000086 3300025919 Bacteria 88712
258 Ga0207657_10004302 3300025919 Bacteria 15090
259 Ga0207657_10082856 3300025919 Bacteria 2691
260 Ga0207649_10021335 3300025920 Bacteria 3727
261 Ga0207652_10002048 3300025921 Bacteria 17344
262 Ga0207652_10054764 3300025921 Bacteria 3430
263 Ga0207652_10071936 3300025921 Bacteria 3006
264 Ga0207652_10113144 3300025921 Bacteria 2409
265 Ga0207652_10263304 3300025921 Bacteria 1555
266 Ga0207681_10007570 3300025923 Bacteria 6653
267 Ga0207694_10024759 3300025924 Bacteria 4559
268 Ga0207694_10767247 3300025924 Bacteria 814
269 Ga0207650_10042782 3300025925 Bacteria 3323
270 Ga0207659_10008710 3300025926 Bacteria 6315
271 Ga0207687_10030461 3300025927 Bacteria 3638
272 Ga0207700_10782813 3300025928 Bacteria 853
273 Ga0207664_10000480 3300025929 Bacteria 28371
274 Ga0207644_10006653 3300025931 Bacteria 7533
275 Ga0207644_10817006 3300025931 Bacteria 780
276 Ga0207690_10002052 3300025932 Bacteria 12339
277 Ga0207706_10000234 3300025933 Bacteria 60759
278 Ga0207709_10029629 3300025935 Bacteria 3177
279 Ga0207709_10054159 3300025935 Bacteria 2472
280 Ga0207670_10006243 3300025936 Bacteria 6600
281 Ga0207669_10030459 3300025937 Bacteria 2998
282 Ga0207669_11036504 3300025937 Bacteria 690
283 Ga0207704_10020514 3300025938 Bacteria 3498
284 Ga0207665_10000120 3300025939 Bacteria 51773
285 Ga0207691_10000538 3300025940 Bacteria 37878
286 Ga0207711_10145492 3300025941 Bacteria 2135
287 Ga0207711_10326914 3300025941 Bacteria 1418
288 Ga0207689_10016336 3300025942 Bacteria 6288
289 Ga0207661_10016618 3300025944 Bacteria 5432
290 Ga0207679_10003216 3300025945 Bacteria 10074
291 Ga0207667_10026394 3300025949 Bacteria 6348
292 Ga0207667_10122957 3300025949 Bacteria 2674
293 Ga0207667_10126328 3300025949 Bacteria 2634
294 Ga0207651_10000671 3300025960 Bacteria 14621
295 Ga0207651_10498645 3300025960 Bacteria 1052
296 Ga0207651_10573495 3300025960 Bacteria 984
297 Ga0207712_10014439 3300025961 Bacteria 5083
298 Ga0207712_10370311 3300025961 Bacteria 1196
299 Ga0207668_10016635 3300025972 Bacteria 4594
300 Ga0207668_10019195 3300025972 Bacteria 4315
301 Ga0207640_10066766 3300025981 Bacteria 2404
302 Ga0207658_10014490 3300025986 Bacteria 5398
303 Ga0207677_10122179 3300026023 Bacteria 1961
304 Ga0207703_10032516 3300026035 Bacteria 4129
305 Ga0207703_10649488 3300026035 Bacteria 1001
306 Ga0207703_10729107 3300026035 Bacteria 944
307 Ga0207639_10079743 3300026041 Bacteria 2588
308 Ga0207678_10000048 3300026067 Bacteria 90920
309 Ga0207678_10638711 3300026067 Bacteria 935
310 Ga0207678_10746607 3300026067 Bacteria 863
311 Ga0207708_10000443 3300026075 Bacteria 32270
312 Ga0207702_10020692 3300026078 Bacteria 5443
313 Ga0207641_10042481 3300026088 Bacteria 3814
314 Ga0207648_10076143 3300026089 Bacteria 2925
315 Ga0207676_10010515 3300026095 Bacteria 6593
316 Ga0207674_10003550 3300026116 Bacteria 19032
317 Ga0207675_100000155 3300026118 Bacteria 60380
318 Ga0207675_100013005 3300026118 Bacteria 7769
319 Ga0207675_100751434 3300026118 Bacteria 986
320 Ga0207683_10001926 3300026121 Bacteria 18374
321 Ga0207683_10496668 3300026121 Bacteria 1127
322 Ga0207698_10006352 3300026142 Bacteria 7365
323 Ga0207428_10023841 3300027907 Bacteria 5140
324 Ga0268265_10028643 3300028380 Bacteria 3990
325 Ga0268265_10460763 3300028380 Bacteria 1189
326 Ga0268265_10562176 3300028380 Bacteria 1085
327 Ga0268264_10004457 3300028381 Bacteria 11942
328 Ga0268264_10084296 3300028381 Bacteria 2724
329 Ga0265337_1002083 3300028556 Bacteria 9458
330 Ga0265334_10000903 3300028573 Bacteria 14825
331 Ga0265338_10071781 3300028800 Bacteria 2959
332 Ga0265324_10001535 3300029957 Bacteria 12980
333 Ga0265328_10035084 3300031239 Bacteria 1855
334 Ga0265325_10001592 3300031241 Bacteria 15832
335 Ga0265340_10000404 3300031247 Bacteria 23202
336 Ga0265340_10091301 3300031247 Bacteria 1423
337 Ga0265340_10095259 3300031247 Bacteria 1388
338 Ga0265339_10005238 3300031249 Bacteria 8662
339 Ga0265339_10039465 3300031249 Bacteria 2628
340 Ga0265331_10000033 3300031250 Bacteria 203767
341 Ga0265331_10009695 3300031250 Bacteria 5385
342 Ga0265331_10016028 3300031250 Bacteria 3942
343 Ga0265331_10037631 3300031250 Bacteria 2368
344 Ga0265327_10000277 3300031251 Bacteria 101027
345 Ga0265327_10067351 3300031251 Bacteria 1804
346 Ga0265316_10174252 3300031344 Bacteria 1604
347 Ga0265316_10269362 3300031344 Bacteria 1247
348 Ga0265313_10000071 3300031595 Bacteria 99087
349 Ga0265313_10006761 3300031595 Bacteria 8021
350 Ga0265313_10007796 3300031595 Bacteria 7232
351 Ga0265313_10028685 3300031595 Bacteria 2889
352 Ga0316575_10058040 3300031665 Bacteria 1543
353 Ga0316579_10000697 3300031691 Bacteria 11453
354 Ga0316579_10177546 3300031691 Bacteria 1030
355 Ga0265314_10000193 3300031711 Bacteria 90595
356 Ga0265314_10089597 3300031711 Bacteria 2006
357 Ga0265314_10198510 3300031711 Bacteria 1188
358 Ga0265342_10034406 3300031712 Bacteria 3108
359 Ga0265342_10046507 3300031712 Bacteria 2608
360 Ga0307406_10044477 3300031901 Bacteria 2783
361 Ga0307409_100079519 3300031995 Bacteria 2643
362 Ga0307416_100233951 3300032002 Bacteria 1774
363 Ga0316583_10004109 3300032133 Bacteria 5171
364 Ga0316585_10018622 3300032137 Bacteria 2108
365 Ga0316580_10000948 3300032139 Bacteria 7207
366 Ga0316593_10071188 3300032168 Bacteria 1203
367 Ga0316596_1076105 3300033541 Bacteria 900
368 Ga0373940_0048669 3300035088 Bacteria 1185
369 Ga0373923_0216435 3300035111 Bacteria 889
370 Ga0373932_0002515 3300035112 Bacteria 4608
371 Ga0373939_0012760 3300035114 Bacteria 2148
372 Ga0373941_0012686 3300035115 Bacteria 2209
373 Ga0373960_0001594 3300035121 Bacteria 5066
374 Ga0373955_0075902 3300035172 Bacteria 1890
375 Ga0373942_0053559 3300035207 Bacteria 1138
376 Ga0373961_0014443 3300035241 Bacteria 2006
377 Ga0373962_0009326 3300035242 Bacteria 2430
378 Ga0316574_0454676 3300035398 Unclassified 802
379 Ga0373931_0029959 3300035691 Bacteria 2798
380 Ga0373931_0037937 3300035691 Bacteria 2518
381 Ga0373935_0034816 3300035692 Bacteria 3141
382 Ga0373927_0014460 3300035695 Bacteria 5223
383 Ga0373947_0019698 3300035725 Bacteria 3890
384 Ga0373947_0142400 3300035725 Bacteria 1539
385 Ga0373937_0089280 3300036401 Bacteria 2854
386 Ga0373937_1004422 3300036401 Bacteria 783
387 Ga0373937_1512019 3300036401 Bacteria 619
388 Ga0316582_0007422 3300036647 Bacteria 5833
389 Ga0316582_0105133 3300036647 Bacteria 1874
390 Ga0316584_0002253 3300036712 Bacteria 12117
391 Ga0373925_0014449 3300037068 Bacteria 5708
392 Ga0395899_0001286 3300037312 Bacteria 21730
393 Ga0395899_0036441 3300037312 Bacteria 3690
394 Ga0395899_0206041 3300037312 Bacteria 1369
395 Ga0395899_0392553 3300037312 Bacteria 920
396 Ga0395900_0001976 3300037418 Bacteria 23144
397 Ga0395900_0209592 3300037418 Bacteria 1968
398 Ga0395900_0447024 3300037418 Bacteria 1249
399 Ga0395900_0523011 3300037418 Bacteria 1134
400 Ga0395898_0001527 3300037466 Bacteria 31896
401 Ga0395898_0002650 3300037466 Bacteria 20816
402 Ga0395898_0507498 3300037466 Bacteria 1147
403 Ga0316581_0000324 3300037588 Bacteria 8599
404 Ga0436364_0642882 3300037853 Bacteria 2050
405 Ga0436364_1385597 3300037853 Bacteria 17706
406 Ga0395901_0002322 3300038443 Bacteria 19373
407 Ga0436361_0008912 3300039447 Bacteria 1750
408 Ga0436361_0081024 3300039447 Bacteria 11106
409 Ga0436361_0324429 3300039447 Bacteria 708
410 Ga0436361_0359530 3300039447 Bacteria 18918
411 Ga0436361_0378619 3300039447 Bacteria 1635
412 Ga0436361_0566426 3300039447 Bacteria 28880
413 Ga0436361_0753731 3300039447 Bacteria 1474
414 Ga0436361_0807183 3300039447 Bacteria 94852
415 Ga0436361_0878292 3300039447 Bacteria 7293
416 Ga0436361_0943087 3300039447 Bacteria 874
417 Ga0436361_1085848 3300039447 Bacteria 1229
418 Ga0436361_1137753 3300039447 Bacteria 3374
419 Ga0436362_1102833 3300039453 Bacteria 1317
420 Ga0451855_0192528 3300041511 Unclassified 705
421 Ga0439445_0083762 3300042004 Bacteria 893
422 Ga0451577_0018155 3300042876 Bacteria 6482
423 Ga0451577_0065784 3300042876 Bacteria 3233
424 Ga0453683_0028476 3300044673 Bacteria 3538
425 Ga0453683_0309658 3300044673 Bacteria 1011
426 Ga0453684_0000006 3300044712 Bacteria 1364191
427 Ga0453684_0000031 3300044712 Bacteria 752632
428 Ga0453684_0028599 3300044712 Bacteria 7947
429 Ga0453684_0037772 3300044712 Bacteria 6622
430 Ga0453684_0145377 3300044712 Bacteria 2825
431 Ga0453684_0156506 3300044712 Bacteria 2701
432 Ga0466957_0018994 3300044842 Bacteria 4041
433 Ga0466957_0372919 3300044842 Bacteria 972
434 Ga0466957_0780562 3300044842 Bacteria 678
435 Ga0451576_0000219 3300045051 Bacteria 141949
436 Ga0451576_0039568 3300045051 Bacteria 4991
437 Ga0451576_0090963 3300045051 Bacteria 3174
438 Ga0466958_0001224 3300045836 Bacteria 12009
439 Ga0466967_0023435 3300045976 Bacteria 5058
440 Ga0495603_0000028 3300046455 Bacteria 61042
441 Ga0495629_0002953 3300046459 Bacteria 12944
442 Ga0495641_0023733 3300046461 Bacteria 3040
443 Ga0495580_0018748 3300046472 Bacteria 5149
444 Ga0495580_0055120 3300046472 Bacteria 2802
445 Ga0495582_0005654 3300046473 Bacteria 6960
446 Ga0495639_0001421 3300046475 Bacteria 10701
447 Ga0495662_0028913 3300046476 Bacteria 2676
448 Ga0495584_0388941 3300046491 Bacteria 709
449 Ga0495594_0000227 3300046499 Bacteria 27180
450 Ga0495583_0106799 3300046506 Bacteria 1190
451 Ga0495610_0121287 3300046512 Bacteria 1145
452 Ga0495630_0282926 3300046517 Bacteria 1267
453 Ga0495666_0021467 3300046526 Bacteria 3196
454 Ga0495665_0021675 3300046531 Bacteria 3455
455 Ga0495587_0166112 3300046536 Bacteria 1255
456 Ga0495609_0128043 3300046538 Bacteria 1089
457 Ga0495622_0001287 3300046557 Bacteria 12870
458 Ga0495634_0058060 3300046642 Bacteria 2580
459 Ga0495635_0062418 3300046663 Bacteria 2559
460 Ga0495588_0005853 3300046674 Bacteria 5504
461 Ga0495647_0003365 3300046681 Bacteria 5125
462 Ga0495658_0120654 3300046683 Bacteria 1585
463 Ga0495613_0002754 3300046689 Bacteria 13202
464 Ga0495581_0006801 3300047315 Bacteria 6631
465 Ga0495581_0323019 3300047315 Bacteria 902
466 Ga0495674_0454860 3300047319 Bacteria 1028
467 Ga0495676_0109853 3300047321 Bacteria 2025
468 Ga0495680_0016438 3300047322 Bacteria 6355
469 Ga0495677_0115772 3300047445 Bacteria 1021
470 Ga0495684_0777419 3300047471 Bacteria 628
471 Ga0495593_0001079 3300047673 Bacteria 15934
472 Ga0495602_0133931 3300048088 Bacteria 1972
473 Ga0495614_0003079 3300048089 Bacteria 7427
474 Ga0496100_0039469 3300048903 Bacteria 2998
475 Ga0496100_0266634 3300048903 Bacteria 1272
476 Ga0496100_0508645 3300048903 Bacteria 929
477 Ga0496101_0005059 3300048904 Bacteria 8383
478 Ga0496101_0120240 3300048904 Bacteria 1985
479 Ga0496101_0284617 3300048904 Bacteria 1293
480 Ga0496102_0271125 3300048905 Bacteria 1600
481 Ga0496102_0347946 3300048905 Bacteria 1395
482 Ga0496103_0006682 3300048906 Bacteria 6883
483 Ga0496103_0157246 3300048906 Bacteria 1457
484 Ga0496104_0052024 3300048907 Bacteria 3868
485 Ga0496104_0070677 3300048907 Bacteria 3319
486 Ga0496104_0215736 3300048907 Bacteria 1830
487 Ga0496105_0151440 3300048908 Bacteria 1906
488 Ga0496105_0350286 3300048908 Bacteria 1179
489 Ga0496105_0796840 3300048908 Bacteria 719
490 Ga0496106_0120191 3300048909 Bacteria 2053
491 Ga0496106_0186155 3300048909 Bacteria 1649
492 Ga0496107_0005627 3300048910 Bacteria 8582
493 Ga0496107_0038472 3300048910 Bacteria 3431
494 Ga0496107_0223137 3300048910 Bacteria 1402
495 Ga0496108_0093532 3300048911 Bacteria 2557
496 Ga0496108_0220098 3300048911 Bacteria 1649
497 Ga0496108_0706036 3300048911 Bacteria 874
498 Ga0496109_0017174 3300048912 Bacteria 6337
499 Ga0496109_0039015 3300048912 Bacteria 4297
500 Ga0496109_0102716 3300048912 Bacteria 2653
501 Ga0496109_0201749 3300048912 Bacteria 1870
502 Ga0496110_0116475 3300048913 Bacteria 2405
503 Ga0496110_0158053 3300048913 Bacteria 2054
504 Ga0496110_0223466 3300048913 Bacteria 1713
505 Ga0496111_0016669 3300048914 Bacteria 5067
506 Ga0496112_0014551 3300048915 Bacteria 7308
507 Ga0496112_0083693 3300048915 Bacteria 3155
508 Ga0496113_0067441 3300048916 Bacteria 2713
509 Ga0496113_0096079 3300048916 Bacteria 2290
510 Ga0496114_0037773 3300048917 Bacteria 3995
511 Ga0496114_0145310 3300048917 Bacteria 2055
512 Ga0496114_0197020 3300048917 Bacteria 1763
513 Ga0496115_0042616 3300048918 Bacteria 3616
514 Ga0496115_0074962 3300048918 Bacteria 2748
515 Ga0496115_0257461 3300048918 Bacteria 1435
516 Ga0496115_0930724 3300048918 Bacteria 668
517 Ga0496122_0072505 3300048925 Bacteria 2448
518 Ga0501033_0023065 3300049570 Bacteria 4692
519 Ga0501034_0247154 3300049571 Bacteria 1729
520 Ga0501036_0134595 3300049572 Bacteria 2086
521 Ga0501037_0633472 3300049573 Bacteria 716
522 Ga0501039_0354427 3300049575 Bacteria 1153
523 Ga0501040_0192687 3300049576 Bacteria 1447
524 Ga0501041_0177286 3300049577 Bacteria 1334
525 Ga0501042_0905359 3300049578 Bacteria 642
526 Ga0501047_0038941 3300049581 Bacteria 4599
527 Ga0501047_0446549 3300049581 Bacteria 1123
528 Ga0501067_0205124 3300049583 Bacteria 1098
529 Ga0501067_0470740 3300049583 Bacteria 702
530 Ga0501070_0313491 3300049586 Bacteria 1277
531 Ga0501070_0520183 3300049586 Bacteria 955
532 Ga0501071_0183263 3300049587 Bacteria 1569
533 Ga0501072_0774397 3300049588 Bacteria 752
534 Ga0501073_0327372 3300049589 Bacteria 1058
535 Ga0501074_0300242 3300049590 Bacteria 1141
536 Ga0501074_0856905 3300049590 Bacteria 640
537 Ga0501075_0326766 3300049591 Bacteria 1169
538 Ga0501076_0206200 3300049592 Bacteria 1606
539 Ga0501079_0291718 3300049741 Bacteria 1276
540 Ga0501080_0129821 3300049742 Bacteria 2333
541 Ga0501080_0231071 3300049742 Bacteria 1691
542 Ga0501080_0274671 3300049742 Bacteria 1533
543 Ga0501080_0836058 3300049742 Bacteria 806
544 Ga0501081_0357212 3300049743 Bacteria 1077
545 Ga0501083_0006638 3300049744 Bacteria 8207
546 Ga0501083_0485877 3300049744 Bacteria 804
547 Ga0501044_0217822 3300049823 Bacteria 1861
548 Ga0501045_0994986 3300049824 Bacteria 615
549 nmdc:mga06z11_396493_c1 3300050494 Bacteria 830
550 nmdc:mga05p37_208929_c1 3300050507 Bacteria 2361
551 nmdc:mga09592_204320_c1 3300050508 Bacteria 1711
552 nmdc:mga0qj67_425802_c1 3300050509 Bacteria 1070
553 nmdc:mga06r32_34663_c1 3300050510 Bacteria 4761
554 nmdc:mga08y16_204024_c1 3300050511 Bacteria 2049
555 nmdc:mga0n895_225642_c1 3300050512 Bacteria 1902
556 nmdc:mga0rr50_224902_c1 3300050513 Bacteria 1551
557 nmdc:mga0rr50_5898_c1 3300050513 Bacteria 7371
558 nmdc:mga08x19_12927_c1 3300050514 Bacteria 5039
559 nmdc:mga08x19_20580_c1 3300050514 Bacteria 4063
560 Ga0495612_0256932 3300053078 Bacteria 778
561 Ga0495595_0038371 3300053084 Bacteria 2182
562 Ga0495619_0054425 3300053085 Bacteria 2648
563 Ga0495619_0095496 3300053085 Bacteria 2017
564 Ga0500652_002927 3300053131 Bacteria 5151
565 Ga0500559_0048073 3300053136 Bacteria 1875
566 Ga0500633_0001120 3300053160 Bacteria 4833
567 Ga0501084_1031861 3300054114 Bacteria 691
568 Ga0587101_007528 3300059623 Bacteria 1288
569 Ga0587111_0064896 3300060346 Bacteria 839
570 Ga0501082_0757286 3300060353 Bacteria 850
571 Ga0530510_0017122 3300061734 Bacteria 5133
572 2512032692 2511231221 Bacteria 6846400
573 2512645822 2512564014 Bacteria 4639632
574 2523102861 2522572158 Bacteria 6514390
575 2524610183 2524023250 Bacteria 5457705
576 2535485782 2534681786 Bacteria 3308809
577 2585167951 2582581283 Bacteria 6030556
578 2585265443 2582581306 Bacteria 6450535
579 2585388477 2582581865 Bacteria 6644329
580 2599102423 2597490356 Bacteria 7030811
581 2643949137 2643221588 Bacteria 3692460
582 2644051017 2643221607 Bacteria 6314006
583 2644205520 2643221636 Bacteria 6583769
584 2644483921 2643221686 Bacteria 6310811
585 2644496300 2643221688 Bacteria 5260751
586 2644500274 2643221689 Bacteria 6042950
587 2757570500 2757320392 Bacteria 3737298
588 2758642493 2758568016 Bacteria 5645291
589 2770198106 2767802442 Bacteria 5747986
590 2809062091 2808606401 Bacteria 4586670
591 2809078055 2808606404 Bacteria 4652788
592 2809082237 2808606405 Bacteria 4586632
593 2821449293 2821443989 Bacteria 7658172
594 2842777715 2842775625 Bacteria 5587290
595 2844538629 2844533157 Bacteria 7517899
596 2846954501 2846952575 Bacteria 6587527
597 2848859237 2848858292 Bacteria 7391279
598 2880519724 2880518877 Bacteria 5012590
599 2883296061 2883291878 Bacteria 5894118
600 2883358818 2883354860 Bacteria 5865246
601 2894654061 2894652903 Bacteria 4587256
602 2897804400 2897803580 Bacteria 7000062
603 2915654214 2915650412 Bacteria 4288180
604 2919710032 2919709256 Bacteria 4318106
605 3002141369 3002141150 Bacteria 5254435
606 8054006200 8054002106 Bacteria 7987183
607 8054558540 8054558443 Bacteria 5204801
608 Ga0436361_0347270
609 SwRhRL2b_contig_345966
610 SwRhRL2b_contig_3681263
611 JGI24737J22298_10088585
612 JGI24750J21931_1001475
613 JGI24748J21848_1010959
614 JGI24738J21930_10044430
615 JGI24749J21850_1024409
616 JGI24744J21845_10025792
617 JGI24034J26672_10026285
618 JGI24742J22300_10033591
619 JGI25406J46586_10031467
620 JGI25160J50197_1009123
621 Ga0055536_1005913
622 Ga0055530_10042377
623 Ga0055531_10006826
624 JGI25405J52794_10056826
625 Ga0070658_10307996
626 Ga0070676_10000987
627 Ga0070676_10316975
628 Ga0070683_100066827
629 Ga0070683_100211128
630 Ga0070683_100468363
631 Ga0070690_100000506
632 Ga0070670_100001094
633 Ga0070670_100220958
634 Ga0070670_100732890
635 Ga0068869_100084816
636 Ga0070666_10002984
637 Ga0070666_10442344
638 Ga0070680_100021223
639 Ga0070682_100004821
640 Ga0068868_100000904
641 Ga0070660_100001178
642 Ga0070660_100032089
643 Ga0070689_100004127
644 Ga0070689_100779159
645 Ga0070691_10000155
646 Ga0070687_100008938
647 Ga0070661_100001464
648 Ga0070692_10000912
649 Ga0070692_10624784
650 Ga0070668_100000692
651 Ga0070668_100346596
652 Ga0070669_100000807
653 Ga0070675_100012884
654 Ga0070671_100001121
655 Ga0070674_100001386
656 Ga0070674_100029503
657 Ga0070673_100000626
658 Ga0070673_100219163
659 Ga0070673_100898474
660 Ga0070688_100000139
661 Ga0070659_100015488
662 Ga0070667_100017103
663 Ga0070709_10001924
664 Ga0070714_100001275
665 Ga0070714_100002022
666 Ga0070713_100402886
667 Ga0070710_10013755
668 Ga0070701_10001747
669 Ga0070701_10057859
670 Ga0070711_100002491
671 Ga0070705_100000298
672 Ga0070705_100873241
673 Ga0070700_100000648
674 Ga0070694_100004154
675 Ga0070694_100070603
676 Ga0070694_100106037
677 Ga0070708_100124794
678 Ga0070663_100003945
679 Ga0070678_100000734
680 Ga0070678_100313141
681 Ga0070662_100001979
682 Ga0070662_100728177
683 Ga0070681_10001440
684 Ga0070681_10057357
685 Ga0070681_10156466
686 Ga0070681_10241360
687 Ga0070681_10639990
688 Ga0070685_10002499
689 Ga0070706_100659371
690 Ga0070707_100721244
691 Ga0070698_101085203
692 Ga0070699_100262442
693 Ga0070679_100020169
694 Ga0070679_100065459
695 Ga0070679_100075617
696 Ga0070679_100545952
697 Ga0070684_100092785
698 Ga0070684_100194552
699 Ga0070697_100023341
700 Ga0068853_100013838
701 Ga0070672_100001796
702 Ga0070686_100000266
703 Ga0070695_100000864
704 Ga0070695_100537000
705 Ga0070696_100000333
706 Ga0070696_100474229
707 Ga0070693_100000326
708 Ga0070704_100011313
709 Ga0070704_100212585
710 Ga0068855_100007108
711 Ga0068855_100151444
712 Ga0068855_100260651
713 Ga0068855_100281082
714 Ga0070664_100018030
715 Ga0068857_100007649
716 Ga0068857_100162482
717 Ga0068854_100000885
718 Ga0068854_100168990
719 Ga0068856_100002298
720 Ga0068856_100364984
721 Ga0070702_100000139
722 Ga0070702_100025937
723 Ga0068852_100001969
724 Ga0068859_100072515
725 Ga0068859_100540647
726 Ga0068859_100630765
727 Ga0068859_101015098
728 Ga0068864_100011694
729 Ga0068866_10006115
730 Ga0068866_10074171
731 Ga0068861_100002618
732 Ga0068863_100000834
733 Ga0068858_100001979
734 Ga0068858_100056987
735 Ga0068860_100002133
736 Ga0068860_100321835
737 Ga0068862_100008752
738 Ga0068862_100030783
739 Ga0081455_10003421
740 Ga0081455_10103891
741 Ga0081455_10170377
742 Ga0081540_1050077
743 Ga0075432_10006309
744 Ga0070715_10003350
745 Ga0070715_10547431
746 Ga0070716_100000665
747 Ga0070712_100000828
748 Ga0075369_10100426
749 Ga0097621_100052449
750 Ga0068871_100020391
751 Ga0075428_100011583
752 Ga0075430_100263289
753 Ga0075431_100006991
754 Ga0075433_10057597
755 Ga0075433_10091162
756 Ga0075434_100038910
757 Ga0075434_100658168
758 Ga0075429_100007710
759 Ga0068865_100010883
760 Ga0075436_100022707
761 Ga0097620_100072507
762 Ga0097620_100540652
763 Ga0097620_100630762
764 Ga0097620_101015247
765 Ga0075435_100019751
766 Ga0075435_100207332
767 Ga0105251_10137375
768 Ga0105250_10010349
769 Ga0105240_10032679
770 Ga0105240_10044054
771 Ga0105240_11091264
772 Ga0111539_10417778
773 Ga0105245_10000795
774 Ga0105247_10002881
775 Ga0114129_10123347
776 Ga0105243_10007413
777 Ga0105243_10097656
778 Ga0105241_10003139
779 Ga0105242_10239960
780 Ga0105248_10004961
781 Ga0105248_10995210
782 Ga0105237_10002479
783 Ga0105237_10193875
784 Ga0105237_11316040
785 Ga0105238_10000136
786 Ga0105238_10155349
787 Ga0105249_10007009
788 Ga0105249_10019431
789 Ga0105239_10015919
790 Ga0105246_10010014
791 Ga0157335_1012194
792 Ga0157373_10060317
793 Ga0157371_10010729
794 Ga0157371_10013083
795 Ga0157370_10002838
796 Ga0157370_10030490
797 Ga0157370_10094453
798 Ga0157369_10006851
799 Ga0157369_10205998
800 Ga0157374_10092147
801 Ga0157378_11178527
802 Ga0163162_10018703
803 Ga0163162_10455268
804 Ga0157372_10905216
805 Ga0157375_10006110
806 Ga0157375_10006188
807 Ga0157375_10302062
808 Ga0157375_11517202
809 Ga0163163_10003201
810 Ga0157380_10001853
811 Ga0182008_10129940
812 Ga0157377_10005976
813 Ga0157377_10193963
814 Ga0157379_10008173
815 Ga0157379_10348792
816 Ga0157376_10000272
817 Ga0163161_10002256
818 Ga0163161_10008969
819 Ga0206354_10395558
820 Ga0213872_10000015
821 Ga0213872_10009790
822 Ga0213875_10009612
823 Ga0213875_10137166
824 Ga0209130_1000732
825 Ga0209676_1000019
826 Ga0209025_1000509
827 Ga0209758_1003243
828 Ga0209050_1002828
829 Ga0209050_1019231
830 Ga0207426_1000080
831 Ga0209257_1000407
832 Ga0209257_1050148
833 Ga0207697_10043250
834 Ga0207696_1010591
835 Ga0207692_10009314
836 Ga0207642_10014815
837 Ga0207642_10025853
838 Ga0207710_10007162
839 Ga0207688_10022493
840 Ga0207688_10111040
841 Ga0207680_10055367
842 Ga0207647_10009490
843 Ga0207647_10022158
844 Ga0207647_10301756
845 Ga0207685_10011336
846 Ga0207699_10001015
847 Ga0207699_10012546
848 Ga0207645_10003182
849 Ga0207705_10011206
850 Ga0207705_10256260
851 Ga0207654_10002679
852 Ga0207707_10001919
853 Ga0207707_10151852
854 Ga0207707_10192226
855 Ga0207695_10134579
856 Ga0207695_10178461
857 Ga0207695_10749852
858 Ga0207671_10093458
859 Ga0207693_10000607
860 Ga0207693_10117966
861 Ga0207663_10081631
862 Ga0207660_10024108
863 Ga0207662_10005337
864 Ga0207657_10000086
865 Ga0207657_10004302
866 Ga0207657_10082856
867 Ga0207649_10021335
868 Ga0207652_10002048
869 Ga0207652_10054764
870 Ga0207652_10071936
871 Ga0207652_10113144
872 Ga0207652_10263304
873 Ga0207681_10007570
874 Ga0207694_10024759
875 Ga0207694_10767247
876 Ga0207650_10042782
877 Ga0207659_10008710
878 Ga0207687_10030461
879 Ga0207700_10782813
880 Ga0207664_10000480
881 Ga0207644_10006653
882 Ga0207644_10817006
883 Ga0207690_10002052
884 Ga0207706_10000234
885 Ga0207709_10029629
886 Ga0207709_10054159
887 Ga0207670_10006243
888 Ga0207669_10030459
889 Ga0207669_11036504
890 Ga0207704_10020514
891 Ga0207665_10000120
892 Ga0207691_10000538
893 Ga0207711_10145492
894 Ga0207711_10326914
895 Ga0207689_10016336
896 Ga0207661_10016618
897 Ga0207679_10003216
898 Ga0207667_10026394
899 Ga0207667_10122957
900 Ga0207667_10126328
901 Ga0207651_10000671
902 Ga0207651_10498645
903 Ga0207651_10573495
904 Ga0207712_10014439
905 Ga0207712_10370311
906 Ga0207668_10016635
907 Ga0207668_10019195
908 Ga0207640_10066766
909 Ga0207658_10014490
910 Ga0207677_10122179
911 Ga0207703_10032516
912 Ga0207703_10649488
913 Ga0207703_10729107
914 Ga0207639_10079743
915 Ga0207678_10000048
916 Ga0207678_10638711
917 Ga0207678_10746607
918 Ga0207708_10000443
919 Ga0207702_10020692
920 Ga0207641_10042481
921 Ga0207648_10076143
922 Ga0207676_10010515
923 Ga0207674_10003550
924 Ga0207675_100000155
925 Ga0207675_100013005
926 Ga0207675_100751434
927 Ga0207683_10001926
928 Ga0207683_10496668
929 Ga0207698_10006352
930 Ga0207428_10023841
931 Ga0268265_10028643
932 Ga0268265_10460763
933 Ga0268265_10562176
934 Ga0268264_10004457
935 Ga0268264_10084296
936 Ga0265337_1002083
937 Ga0265334_10000903
938 Ga0265338_10071781
939 Ga0265324_10001535
940 Ga0265328_10035084
941 Ga0265325_10001592
942 Ga0265340_10000404
943 Ga0265340_10091301
944 Ga0265340_10095259
945 Ga0265339_10005238
946 Ga0265339_10039465
947 Ga0265331_10000033
948 Ga0265331_10009695
949 Ga0265331_10016028
950 Ga0265331_10037631
951 Ga0265327_10000277
952 Ga0265327_10067351
953 Ga0265316_10174252
954 Ga0265316_10269362
955 Ga0265313_10000071
956 Ga0265313_10006761
957 Ga0265313_10007796
958 Ga0265313_10028685
959 Ga0316575_10058040
960 Ga0316579_10000697
961 Ga0316579_10177546
962 Ga0265314_10000193
963 Ga0265314_10089597
964 Ga0265314_10198510
965 Ga0265342_10034406
966 Ga0265342_10046507
967 Ga0307406_10044477
968 Ga0307409_100079519
969 Ga0307416_100233951
970 Ga0316583_10004109
971 Ga0316585_10018622
972 Ga0316580_10000948
973 Ga0316593_10071188
974 Ga0316596_1076105
975 Ga0373940_0048669
976 Ga0373923_0216435
977 Ga0373932_0002515
978 Ga0373939_0012760
979 Ga0373941_0012686
980 Ga0373960_0001594
981 Ga0373955_0075902
982 Ga0373942_0053559
983 Ga0373961_0014443
984 Ga0373962_0009326
985 Ga0316574_0454676
986 Ga0373931_0029959
987 Ga0373931_0037937
988 Ga0373935_0034816
989 Ga0373927_0014460
990 Ga0373947_0019698
991 Ga0373947_0142400
992 Ga0373937_0089280
993 Ga0373937_1004422
994 Ga0373937_1512019
995 Ga0316582_0007422
996 Ga0316582_0105133
997 Ga0316584_0002253
998 Ga0373925_0014449
999 Ga0395899_0001286
1000 Ga0395899_0036441
1001 Ga0395899_0206041
1002 Ga0395899_0392553
1003 Ga0395900_0001976
1004 Ga0395900_0209592
1005 Ga0395900_0447024
1006 Ga0395900_0523011
1007 Ga0395898_0001527
1008 Ga0395898_0002650
1009 Ga0395898_0507498
1010 Ga0316581_0000324
1011 Ga0436364_0642882
1012 Ga0436364_1385597
1013 Ga0395901_0002322
1014 Ga0436361_0008912
1015 Ga0436361_0081024
1016 Ga0436361_0324429
1017 Ga0436361_0359530
1018 Ga0436361_0378619
1019 Ga0436361_0566426
1020 Ga0436361_0753731
1021 Ga0436361_0807183
1022 Ga0436361_0878292
1023 Ga0436361_0943087
1024 Ga0436361_1085848
1025 Ga0436361_1137753
1026 Ga0436362_1102833
1027 Ga0451855_0192528
1028 Ga0439445_0083762
1029 Ga0451577_0018155
1030 Ga0451577_0065784
1031 Ga0453683_0028476
1032 Ga0453683_0309658
1033 Ga0453684_0000006
1034 Ga0453684_0000031
1035 Ga0453684_0028599
1036 Ga0453684_0037772
1037 Ga0453684_0145377
1038 Ga0453684_0156506
1039 Ga0466957_0018994
1040 Ga0466957_0372919
1041 Ga0466957_0780562
1042 Ga0451576_0000219
1043 Ga0451576_0039568
1044 Ga0451576_0090963
1045 Ga0466958_0001224
1046 Ga0466967_0023435
1047 Ga0495603_0000028
1048 Ga0495629_0002953
1049 Ga0495641_0023733
1050 Ga0495580_0018748
1051 Ga0495580_0055120
1052 Ga0495582_0005654
1053 Ga0495639_0001421
1054 Ga0495662_0028913
1055 Ga0495584_0388941
1056 Ga0495594_0000227
1057 Ga0495583_0106799
1058 Ga0495610_0121287
1059 Ga0495630_0282926
1060 Ga0495666_0021467
1061 Ga0495665_0021675
1062 Ga0495587_0166112
1063 Ga0495609_0128043
1064 Ga0495622_0001287
1065 Ga0495634_0058060
1066 Ga0495635_0062418
1067 Ga0495588_0005853
1068 Ga0495647_0003365
1069 Ga0495658_0120654
1070 Ga0495613_0002754
1071 Ga0495581_0006801
1072 Ga0495581_0323019
1073 Ga0495674_0454860
1074 Ga0495676_0109853
1075 Ga0495680_0016438
1076 Ga0495677_0115772
1077 Ga0495684_0777419
1078 Ga0495593_0001079
1079 Ga0495602_0133931
1080 Ga0495614_0003079
1081 Ga0496100_0039469
1082 Ga0496100_0266634
1083 Ga0496100_0508645
1084 Ga0496101_0005059
1085 Ga0496101_0120240
1086 Ga0496101_0284617
1087 Ga0496102_0271125
1088 Ga0496102_0347946
1089 Ga0496103_0006682
1090 Ga0496103_0157246
1091 Ga0496104_0052024
1092 Ga0496104_0070677
1093 Ga0496104_0215736
1094 Ga0496105_0151440
1095 Ga0496105_0350286
1096 Ga0496105_0796840
1097 Ga0496106_0120191
1098 Ga0496106_0186155
1099 Ga0496107_0005627
1100 Ga0496107_0038472
1101 Ga0496107_0223137
1102 Ga0496108_0093532
1103 Ga0496108_0220098
1104 Ga0496108_0706036
1105 Ga0496109_0017174
1106 Ga0496109_0039015
1107 Ga0496109_0102716
1108 Ga0496109_0201749
1109 Ga0496110_0116475
1110 Ga0496110_0158053
1111 Ga0496110_0223466
1112 Ga0496111_0016669
1113 Ga0496112_0014551
1114 Ga0496112_0083693
1115 Ga0496113_0067441
1116 Ga0496113_0096079
1117 Ga0496114_0037773
1118 Ga0496114_0145310
1119 Ga0496114_0197020
1120 Ga0496115_0042616
1121 Ga0496115_0074962
1122 Ga0496115_0257461
1123 Ga0496115_0930724
1124 Ga0496122_0072505
1125 Ga0501033_0023065
1126 Ga0501034_0247154
1127 Ga0501036_0134595
1128 Ga0501037_0633472
1129 Ga0501039_0354427
1130 Ga0501040_0192687
1131 Ga0501041_0177286
1132 Ga0501042_0905359
1133 Ga0501047_0038941
1134 Ga0501047_0446549
1135 Ga0501067_0205124
1136 Ga0501067_0470740
1137 Ga0501070_0313491
1138 Ga0501070_0520183
1139 Ga0501071_0183263
1140 Ga0501072_0774397
1141 Ga0501073_0327372
1142 Ga0501074_0300242
1143 Ga0501074_0856905
1144 Ga0501075_0326766
1145 Ga0501076_0206200
1146 Ga0501079_0291718
1147 Ga0501080_0129821
1148 Ga0501080_0231071
1149 Ga0501080_0274671
1150 Ga0501080_0836058
1151 Ga0501081_0357212
1152 Ga0501083_0006638
1153 Ga0501083_0485877
1154 Ga0501044_0217822
1155 Ga0501045_0994986
1156 nmdc:mga06z11_396493_c1
1157 nmdc:mga05p37_208929_c1
1158 nmdc:mga09592_204320_c1
1159 nmdc:mga0qj67_425802_c1
1160 nmdc:mga06r32_34663_c1
1161 nmdc:mga08y16_204024_c1
1162 nmdc:mga0n895_225642_c1
1163 nmdc:mga0rr50_224902_c1
1164 nmdc:mga0rr50_5898_c1
1165 nmdc:mga08x19_12927_c1
1166 nmdc:mga08x19_20580_c1
1167 Ga0495612_0256932
1168 Ga0495595_0038371
1169 Ga0495619_0054425
1170 Ga0495619_0095496
1171 Ga0500652_002927
1172 Ga0500559_0048073
1173 Ga0500633_0001120
1174 Ga0501084_1031861
1175 Ga0587101_007528
1176 Ga0587111_0064896
1177 Ga0501082_0757286
1178 Ga0530510_0017122
1179 2512032692
1180 2512645822
1181 2523102861
1182 2524610183
1183 2535485782
1184 2585167951
1185 2585265443
1186 2585388477
1187 2599102423
1188 2643949137
1189 2644051017
1190 2644205520
1191 2644483921
1192 2644496300
1193 2644500274
1194 2757570500
1195 2758642493
1196 2770198106
1197 2809062091
1198 2809078055
1199 2809082237
1200 2821449293
1201 2842777715
1202 2844538629
1203 2846954501
1204 2848859237
1205 2880519724
1206 2883296061
1207 2883358818
1208 2894654061
1209 2897804400
1210 2915654214
1211 2919710032
1212 3002141369
1213 8054006200
1214 8054558540

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

162

217

0.99

PF01132

EFP

Elongation factor P (EF-P) OB domain

101

154

0.98

PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

36

93

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a5z-assembly1.cif.gz_B crystal structure of escherichia coli genx in complex with elongation factor p 0.9317 4 127
3a5z-assembly2.cif.gz_H crystal structure of escherichia coli genx in complex with elongation factor p 0.9252 4 186
5j3b-assembly2.cif.gz_B structure of translation elongation factor p from acinetobacter baumannii 0.921 3 186
3a5z-assembly2.cif.gz_F crystal structure of escherichia coli genx in complex with elongation factor p 0.9206 3 59
5j3b-assembly1.cif.gz_A structure of translation elongation factor p from acinetobacter baumannii 0.9117 1 186
ID Description Score Start End Superfamily
af_F4JUX3_135_197_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9778 65 127 2.40.50.140
af_P9WNM3_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9758 65 127 2.40.50.140
af_P0A6N8_1_64_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9685 4 62 2.30.30.30
af_I1JVU1_126_189_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9629 65 127 2.40.50.140
af_F4JUX3_135_197_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9629 65 127 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2A5YF18-F1-model_v4 Elongation factor P (EF-P) 0.9631 3 186 GO:0003746
GO:0005737
GO:0043043
AF-A0A023DY07-F1-model_v4 Elongation factor P (EF-P) 0.9576 1 188 GO:0003746
GO:0005737
GO:0043043
AF-A0A1F8N9H0-F1-model_v4 Elongation factor P (EF-P) 0.9574 3 187 GO:0003746
GO:0005737
GO:0043043
AF-A6DS65-F1-model_v4 Elongation factor P (EF-P) 0.9533 1 187 GO:0003746
GO:0005737
GO:0043043
AF-A0A2A5YF18-F1-model_v4 Elongation factor P (EF-P) 0.953 3 186 GO:0003746
GO:0005737
GO:0043043

Map