F468718
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 607 | 399 | 1214 | 187 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_0347270|Ga0436361_0347270_78_740 |
| Length | 220 |
| Sequence | MQDLTPPYRHGCTAGTKLLGSAPVFSKPIRIIMKIDANLIRPGNILEHNNRQWAVLKIQIVQPGKGGAFIQVEMRDVRTGTKTQERWRTVDTVEKLQVEEKECTYLFGDGESITFMDQETYEQFTVSRELVGEPGAFLQDGMTCTIDMIEGSPVSVTLPDKVVMTVTEADPVVKGQTAASSYKPGLLENGVRVLIPPFVEAGTRIVVNTADATYVERAKD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 140 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 141 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 214 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 218 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 219 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 220 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 223 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 224 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 226 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 230 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 231 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 232 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 233 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 234 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 235 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 241 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 247 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 248 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 251 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 252 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 254 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 255 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 260 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 261 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 262 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 263 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 264 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 265 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 266 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 267 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 268 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 269 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 270 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 271 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 272 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 307 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 308 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 309 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 310 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 311 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 312 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 315 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 316 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 317 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 318 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 319 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 320 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 321 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 345 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 357 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 358 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 359 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 364 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 365 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 366 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 367 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 368 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 369 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 370 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 371 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 372 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 373 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 374 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 375 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 376 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 377 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 378 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 379 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 380 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 381 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 382 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 383 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 384 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 385 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 386 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 387 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 388 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 389 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 390 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 391 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 392 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 393 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 394 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 395 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 396 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 397 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 398 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 399 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.25 |
| Metatranscriptomes | 0.82 |
| Isolates | 5.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.97 |
| Nodule | 0.33 |
| Rhizoplane | 7.25 |
| Rhizosphere | 85.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436361_0347270 | 3300039447 | Bacteria | 907 |
| 2 | SwRhRL2b_contig_345966 | 2162886007 | Bacteria | 931 |
| 3 | SwRhRL2b_contig_3681263 | 2162886007 | Bacteria | 877 |
| 4 | JGI24737J22298_10088585 | 3300001990 | Bacteria | 919 |
| 5 | JGI24750J21931_1001475 | 3300002070 | Bacteria | 2918 |
| 6 | JGI24748J21848_1010959 | 3300002074 | Bacteria | 1066 |
| 7 | JGI24738J21930_10044430 | 3300002075 | Bacteria | 904 |
| 8 | JGI24749J21850_1024409 | 3300002076 | Bacteria | 861 |
| 9 | JGI24744J21845_10025792 | 3300002077 | Bacteria | 1143 |
| 10 | JGI24034J26672_10026285 | 3300002239 | Bacteria | 933 |
| 11 | JGI24742J22300_10033591 | 3300002244 | Bacteria | 901 |
| 12 | JGI25406J46586_10031467 | 3300003203 | Bacteria | 1984 |
| 13 | JGI25160J50197_1009123 | 3300003354 | Bacteria | 3709 |
| 14 | Ga0055536_1005913 | 3300003781 | Bacteria | 5855 |
| 15 | Ga0055530_10042377 | 3300003791 | Bacteria | 1105 |
| 16 | Ga0055531_10006826 | 3300003794 | Bacteria | 6371 |
| 17 | JGI25405J52794_10056826 | 3300003911 | Bacteria | 843 |
| 18 | Ga0070658_10307996 | 3300005327 | Bacteria | 1351 |
| 19 | Ga0070676_10000987 | 3300005328 | Bacteria | 14130 |
| 20 | Ga0070676_10316975 | 3300005328 | Bacteria | 1062 |
| 21 | Ga0070683_100066827 | 3300005329 | Bacteria | 3349 |
| 22 | Ga0070683_100211128 | 3300005329 | Bacteria | 1844 |
| 23 | Ga0070683_100468363 | 3300005329 | Bacteria | 1203 |
| 24 | Ga0070690_100000506 | 3300005330 | Bacteria | 19537 |
| 25 | Ga0070670_100001094 | 3300005331 | Bacteria | 21528 |
| 26 | Ga0070670_100220958 | 3300005331 | Bacteria | 1648 |
| 27 | Ga0070670_100732890 | 3300005331 | Bacteria | 890 |
| 28 | Ga0068869_100084816 | 3300005334 | Bacteria | 2372 |
| 29 | Ga0070666_10002984 | 3300005335 | Bacteria | 10257 |
| 30 | Ga0070666_10442344 | 3300005335 | Bacteria | 938 |
| 31 | Ga0070680_100021223 | 3300005336 | Bacteria | 5160 |
| 32 | Ga0070682_100004821 | 3300005337 | Bacteria | 7489 |
| 33 | Ga0068868_100000904 | 3300005338 | Bacteria | 20173 |
| 34 | Ga0070660_100001178 | 3300005339 | Bacteria | 17696 |
| 35 | Ga0070660_100032089 | 3300005339 | Bacteria | 3950 |
| 36 | Ga0070689_100004127 | 3300005340 | Bacteria | 9782 |
| 37 | Ga0070689_100779159 | 3300005340 | Bacteria | 840 |
| 38 | Ga0070691_10000155 | 3300005341 | Bacteria | 22187 |
| 39 | Ga0070687_100008938 | 3300005343 | Bacteria | 4266 |
| 40 | Ga0070661_100001464 | 3300005344 | Bacteria | 16401 |
| 41 | Ga0070692_10000912 | 3300005345 | Bacteria | 10006 |
| 42 | Ga0070692_10624784 | 3300005345 | Bacteria | 716 |
| 43 | Ga0070668_100000692 | 3300005347 | Bacteria | 22968 |
| 44 | Ga0070668_100346596 | 3300005347 | Bacteria | 1256 |
| 45 | Ga0070669_100000807 | 3300005353 | Bacteria | 22765 |
| 46 | Ga0070675_100012884 | 3300005354 | Bacteria | 6563 |
| 47 | Ga0070671_100001121 | 3300005355 | Bacteria | 19883 |
| 48 | Ga0070674_100001386 | 3300005356 | Bacteria | 12805 |
| 49 | Ga0070674_100029503 | 3300005356 | Bacteria | 3614 |
| 50 | Ga0070673_100000626 | 3300005364 | Bacteria | 19353 |
| 51 | Ga0070673_100219163 | 3300005364 | Bacteria | 1646 |
| 52 | Ga0070673_100898474 | 3300005364 | Bacteria | 821 |
| 53 | Ga0070688_100000139 | 3300005365 | Bacteria | 39353 |
| 54 | Ga0070659_100015488 | 3300005366 | Bacteria | 5712 |
| 55 | Ga0070667_100017103 | 3300005367 | Bacteria | 6008 |
| 56 | Ga0070709_10001924 | 3300005434 | Bacteria | 11284 |
| 57 | Ga0070714_100001275 | 3300005435 | Bacteria | 18217 |
| 58 | Ga0070714_100002022 | 3300005435 | Bacteria | 14858 |
| 59 | Ga0070713_100402886 | 3300005436 | Bacteria | 1278 |
| 60 | Ga0070710_10013755 | 3300005437 | Bacteria | 4060 |
| 61 | Ga0070701_10001747 | 3300005438 | Bacteria | 8179 |
| 62 | Ga0070701_10057859 | 3300005438 | Bacteria | 2033 |
| 63 | Ga0070711_100002491 | 3300005439 | Bacteria | 10512 |
| 64 | Ga0070705_100000298 | 3300005440 | Bacteria | 29561 |
| 65 | Ga0070705_100873241 | 3300005440 | Bacteria | 721 |
| 66 | Ga0070700_100000648 | 3300005441 | Bacteria | 17205 |
| 67 | Ga0070694_100004154 | 3300005444 | Bacteria | 8699 |
| 68 | Ga0070694_100070603 | 3300005444 | Bacteria | 2405 |
| 69 | Ga0070694_100106037 | 3300005444 | Bacteria | 1995 |
| 70 | Ga0070708_100124794 | 3300005445 | Bacteria | 2378 |
| 71 | Ga0070663_100003945 | 3300005455 | Bacteria | 8650 |
| 72 | Ga0070678_100000734 | 3300005456 | Bacteria | 16335 |
| 73 | Ga0070678_100313141 | 3300005456 | Bacteria | 1338 |
| 74 | Ga0070662_100001979 | 3300005457 | Bacteria | 12572 |
| 75 | Ga0070662_100728177 | 3300005457 | Bacteria | 840 |
| 76 | Ga0070681_10001440 | 3300005458 | Bacteria | 20950 |
| 77 | Ga0070681_10057357 | 3300005458 | Bacteria | 3874 |
| 78 | Ga0070681_10156466 | 3300005458 | Bacteria | 2204 |
| 79 | Ga0070681_10241360 | 3300005458 | Bacteria | 1720 |
| 80 | Ga0070681_10639990 | 3300005458 | Bacteria | 978 |
| 81 | Ga0070685_10002499 | 3300005466 | Bacteria | 9438 |
| 82 | Ga0070706_100659371 | 3300005467 | Unclassified | 971 |
| 83 | Ga0070707_100721244 | 3300005468 | Bacteria | 960 |
| 84 | Ga0070698_101085203 | 3300005471 | Bacteria | 749 |
| 85 | Ga0070699_100262442 | 3300005518 | Bacteria | 1545 |
| 86 | Ga0070679_100020169 | 3300005530 | Bacteria | 6496 |
| 87 | Ga0070679_100065459 | 3300005530 | Bacteria | 3623 |
| 88 | Ga0070679_100075617 | 3300005530 | Bacteria | 3357 |
| 89 | Ga0070679_100545952 | 3300005530 | Bacteria | 1103 |
| 90 | Ga0070684_100092785 | 3300005535 | Bacteria | 2687 |
| 91 | Ga0070684_100194552 | 3300005535 | Bacteria | 1846 |
| 92 | Ga0070697_100023341 | 3300005536 | Bacteria | 4918 |
| 93 | Ga0068853_100013838 | 3300005539 | Bacteria | 6595 |
| 94 | Ga0070672_100001796 | 3300005543 | Bacteria | 13421 |
| 95 | Ga0070686_100000266 | 3300005544 | Bacteria | 35675 |
| 96 | Ga0070695_100000864 | 3300005545 | Bacteria | 16329 |
| 97 | Ga0070695_100537000 | 3300005545 | Bacteria | 910 |
| 98 | Ga0070696_100000333 | 3300005546 | Bacteria | 28647 |
| 99 | Ga0070696_100474229 | 3300005546 | Bacteria | 991 |
| 100 | Ga0070693_100000326 | 3300005547 | Bacteria | 21830 |
| 101 | Ga0070704_100011313 | 3300005549 | Bacteria | 5467 |
| 102 | Ga0070704_100212585 | 3300005549 | Bacteria | 1568 |
| 103 | Ga0068855_100007108 | 3300005563 | Bacteria | 13578 |
| 104 | Ga0068855_100151444 | 3300005563 | Bacteria | 2637 |
| 105 | Ga0068855_100260651 | 3300005563 | Bacteria | 1931 |
| 106 | Ga0068855_100281082 | 3300005563 | Bacteria | 1848 |
| 107 | Ga0070664_100018030 | 3300005564 | Bacteria | 5795 |
| 108 | Ga0068857_100007649 | 3300005577 | Bacteria | 9304 |
| 109 | Ga0068857_100162482 | 3300005577 | Bacteria | 2027 |
| 110 | Ga0068854_100000885 | 3300005578 | Bacteria | 18009 |
| 111 | Ga0068854_100168990 | 3300005578 | Bacteria | 1700 |
| 112 | Ga0068856_100002298 | 3300005614 | Bacteria | 19709 |
| 113 | Ga0068856_100364984 | 3300005614 | Bacteria | 1463 |
| 114 | Ga0070702_100000139 | 3300005615 | Bacteria | 22443 |
| 115 | Ga0070702_100025937 | 3300005615 | Bacteria | 3145 |
| 116 | Ga0068852_100001969 | 3300005616 | Bacteria | 13992 |
| 117 | Ga0068859_100072515 | 3300005617 | Bacteria | 3480 |
| 118 | Ga0068859_100540647 | 3300005617 | Bacteria | 1260 |
| 119 | Ga0068859_100630765 | 3300005617 | Bacteria | 1164 |
| 120 | Ga0068859_101015098 | 3300005617 | Unclassified | 911 |
| 121 | Ga0068864_100011694 | 3300005618 | Bacteria | 7248 |
| 122 | Ga0068866_10006115 | 3300005718 | Bacteria | 5009 |
| 123 | Ga0068866_10074171 | 3300005718 | Bacteria | 1808 |
| 124 | Ga0068861_100002618 | 3300005719 | Bacteria | 11760 |
| 125 | Ga0068863_100000834 | 3300005841 | Bacteria | 30888 |
| 126 | Ga0068858_100001979 | 3300005842 | Bacteria | 20923 |
| 127 | Ga0068858_100056987 | 3300005842 | Bacteria | 3611 |
| 128 | Ga0068860_100002133 | 3300005843 | Bacteria | 20873 |
| 129 | Ga0068860_100321835 | 3300005843 | Bacteria | 1518 |
| 130 | Ga0068862_100008752 | 3300005844 | Bacteria | 8380 |
| 131 | Ga0068862_100030783 | 3300005844 | Bacteria | 4524 |
| 132 | Ga0081455_10003421 | 3300005937 | Bacteria | 18246 |
| 133 | Ga0081455_10103891 | 3300005937 | Bacteria | 2274 |
| 134 | Ga0081455_10170377 | 3300005937 | Bacteria | 1659 |
| 135 | Ga0081540_1050077 | 3300005983 | Bacteria | 2078 |
| 136 | Ga0075432_10006309 | 3300006058 | Bacteria | 4031 |
| 137 | Ga0070715_10003350 | 3300006163 | Bacteria | 5079 |
| 138 | Ga0070715_10547431 | 3300006163 | Bacteria | 670 |
| 139 | Ga0070716_100000665 | 3300006173 | Bacteria | 14606 |
| 140 | Ga0070712_100000828 | 3300006175 | Bacteria | 18403 |
| 141 | Ga0075369_10100426 | 3300006186 | Bacteria | 1298 |
| 142 | Ga0097621_100052449 | 3300006237 | Bacteria | 3323 |
| 143 | Ga0068871_100020391 | 3300006358 | Bacteria | 5077 |
| 144 | Ga0075428_100011583 | 3300006844 | Bacteria | 9812 |
| 145 | Ga0075430_100263289 | 3300006846 | Bacteria | 1428 |
| 146 | Ga0075431_100006991 | 3300006847 | Bacteria | 11220 |
| 147 | Ga0075433_10057597 | 3300006852 | Bacteria | 3397 |
| 148 | Ga0075433_10091162 | 3300006852 | Bacteria | 2694 |
| 149 | Ga0075434_100038910 | 3300006871 | Bacteria | 4712 |
| 150 | Ga0075434_100658168 | 3300006871 | Bacteria | 1066 |
| 151 | Ga0075429_100007710 | 3300006880 | Bacteria | 9344 |
| 152 | Ga0068865_100010883 | 3300006881 | Bacteria | 5675 |
| 153 | Ga0075436_100022707 | 3300006914 | Bacteria | 4310 |
| 154 | Ga0097620_100072507 | 3300006931 | Bacteria | 3480 |
| 155 | Ga0097620_100540652 | 3300006931 | Bacteria | 1260 |
| 156 | Ga0097620_100630762 | 3300006931 | Bacteria | 1164 |
| 157 | Ga0097620_101015247 | 3300006931 | Unclassified | 911 |
| 158 | Ga0075435_100019751 | 3300007076 | Bacteria | 5153 |
| 159 | Ga0075435_100207332 | 3300007076 | Bacteria | 1662 |
| 160 | Ga0105251_10137375 | 3300009011 | Bacteria | 1106 |
| 161 | Ga0105250_10010349 | 3300009092 | Bacteria | 3887 |
| 162 | Ga0105240_10032679 | 3300009093 | Bacteria | 6734 |
| 163 | Ga0105240_10044054 | 3300009093 | Bacteria | 5674 |
| 164 | Ga0105240_11091264 | 3300009093 | Bacteria | 850 |
| 165 | Ga0111539_10417778 | 3300009094 | Bacteria | 1562 |
| 166 | Ga0105245_10000795 | 3300009098 | Bacteria | 28669 |
| 167 | Ga0105247_10002881 | 3300009101 | Bacteria | 11450 |
| 168 | Ga0114129_10123347 | 3300009147 | Bacteria | 3563 |
| 169 | Ga0105243_10007413 | 3300009148 | Bacteria | 8435 |
| 170 | Ga0105243_10097656 | 3300009148 | Bacteria | 2432 |
| 171 | Ga0105241_10003139 | 3300009174 | Bacteria | 12289 |
| 172 | Ga0105242_10239960 | 3300009176 | Bacteria | 1629 |
| 173 | Ga0105248_10004961 | 3300009177 | Bacteria | 14704 |
| 174 | Ga0105248_10995210 | 3300009177 | Bacteria | 947 |
| 175 | Ga0105237_10002479 | 3300009545 | Bacteria | 22904 |
| 176 | Ga0105237_10193875 | 3300009545 | Bacteria | 2031 |
| 177 | Ga0105237_11316040 | 3300009545 | Bacteria | 729 |
| 178 | Ga0105238_10000136 | 3300009551 | Bacteria | 80983 |
| 179 | Ga0105238_10155349 | 3300009551 | Bacteria | 2263 |
| 180 | Ga0105249_10007009 | 3300009553 | Bacteria | 9835 |
| 181 | Ga0105249_10019431 | 3300009553 | Bacteria | 6062 |
| 182 | Ga0105239_10015919 | 3300010375 | Bacteria | 8324 |
| 183 | Ga0105246_10010014 | 3300011119 | Bacteria | 5847 |
| 184 | Ga0157335_1012194 | 3300012492 | Bacteria | 716 |
| 185 | Ga0157373_10060317 | 3300013100 | Bacteria | 2688 |
| 186 | Ga0157371_10010729 | 3300013102 | Bacteria | 7115 |
| 187 | Ga0157371_10013083 | 3300013102 | Bacteria | 6317 |
| 188 | Ga0157370_10002838 | 3300013104 | Bacteria | 20711 |
| 189 | Ga0157370_10030490 | 3300013104 | Bacteria | 5283 |
| 190 | Ga0157370_10094453 | 3300013104 | Bacteria | 2805 |
| 191 | Ga0157369_10006851 | 3300013105 | Bacteria | 13147 |
| 192 | Ga0157369_10205998 | 3300013105 | Bacteria | 2063 |
| 193 | Ga0157374_10092147 | 3300013296 | Bacteria | 2891 |
| 194 | Ga0157378_11178527 | 3300013297 | Bacteria | 805 |
| 195 | Ga0163162_10018703 | 3300013306 | Bacteria | 6789 |
| 196 | Ga0163162_10455268 | 3300013306 | Bacteria | 1411 |
| 197 | Ga0157372_10905216 | 3300013307 | Bacteria | 1023 |
| 198 | Ga0157375_10006110 | 3300013308 | Bacteria | 10497 |
| 199 | Ga0157375_10006188 | 3300013308 | Bacteria | 10430 |
| 200 | Ga0157375_10302062 | 3300013308 | Bacteria | 1764 |
| 201 | Ga0157375_11517202 | 3300013308 | Unclassified | 791 |
| 202 | Ga0163163_10003201 | 3300014325 | Bacteria | 13874 |
| 203 | Ga0157380_10001853 | 3300014326 | Bacteria | 13986 |
| 204 | Ga0182008_10129940 | 3300014497 | Bacteria | 1255 |
| 205 | Ga0157377_10005976 | 3300014745 | Bacteria | 5766 |
| 206 | Ga0157377_10193963 | 3300014745 | Bacteria | 1285 |
| 207 | Ga0157379_10008173 | 3300014968 | Bacteria | 9086 |
| 208 | Ga0157379_10348792 | 3300014968 | Bacteria | 1355 |
| 209 | Ga0157376_10000272 | 3300014969 | Bacteria | 35217 |
| 210 | Ga0163161_10002256 | 3300017792 | Bacteria | 13831 |
| 211 | Ga0163161_10008969 | 3300017792 | Bacteria | 6917 |
| 212 | Ga0206354_10395558 | 3300020081 | Bacteria | 1153 |
| 213 | Ga0213872_10000015 | 3300021361 | Bacteria | 180923 |
| 214 | Ga0213872_10009790 | 3300021361 | Bacteria | 4581 |
| 215 | Ga0213875_10009612 | 3300021388 | Bacteria | 4888 |
| 216 | Ga0213875_10137166 | 3300021388 | Bacteria | 1144 |
| 217 | Ga0209130_1000732 | 3300025284 | Bacteria | 29001 |
| 218 | Ga0209676_1000019 | 3300025292 | Bacteria | 620012 |
| 219 | Ga0209025_1000509 | 3300025294 | Bacteria | 74336 |
| 220 | Ga0209758_1003243 | 3300025297 | Bacteria | 15094 |
| 221 | Ga0209050_1002828 | 3300025298 | Bacteria | 13820 |
| 222 | Ga0209050_1019231 | 3300025298 | Bacteria | 2605 |
| 223 | Ga0207426_1000080 | 3300025302 | Bacteria | 304917 |
| 224 | Ga0209257_1000407 | 3300025304 | Bacteria | 83438 |
| 225 | Ga0209257_1050148 | 3300025304 | Bacteria | 1183 |
| 226 | Ga0207697_10043250 | 3300025315 | Bacteria | 1852 |
| 227 | Ga0207696_1010591 | 3300025711 | Bacteria | 3371 |
| 228 | Ga0207692_10009314 | 3300025898 | Bacteria | 4095 |
| 229 | Ga0207642_10014815 | 3300025899 | Bacteria | 2888 |
| 230 | Ga0207642_10025853 | 3300025899 | Bacteria | 2381 |
| 231 | Ga0207710_10007162 | 3300025900 | Bacteria | 4732 |
| 232 | Ga0207688_10022493 | 3300025901 | Bacteria | 3450 |
| 233 | Ga0207688_10111040 | 3300025901 | Bacteria | 1591 |
| 234 | Ga0207680_10055367 | 3300025903 | Bacteria | 2390 |
| 235 | Ga0207647_10009490 | 3300025904 | Bacteria | 6910 |
| 236 | Ga0207647_10022158 | 3300025904 | Bacteria | 4225 |
| 237 | Ga0207647_10301756 | 3300025904 | Bacteria | 912 |
| 238 | Ga0207685_10011336 | 3300025905 | Bacteria | 2676 |
| 239 | Ga0207699_10001015 | 3300025906 | Bacteria | 13296 |
| 240 | Ga0207699_10012546 | 3300025906 | Bacteria | 4312 |
| 241 | Ga0207645_10003182 | 3300025907 | Bacteria | 12568 |
| 242 | Ga0207705_10011206 | 3300025909 | Bacteria | 6499 |
| 243 | Ga0207705_10256260 | 3300025909 | Bacteria | 1335 |
| 244 | Ga0207654_10002679 | 3300025911 | Bacteria | 9043 |
| 245 | Ga0207707_10001919 | 3300025912 | Bacteria | 18897 |
| 246 | Ga0207707_10151852 | 3300025912 | Bacteria | 2024 |
| 247 | Ga0207707_10192226 | 3300025912 | Bacteria | 1780 |
| 248 | Ga0207695_10134579 | 3300025913 | Bacteria | 2426 |
| 249 | Ga0207695_10178461 | 3300025913 | Bacteria | 2045 |
| 250 | Ga0207695_10749852 | 3300025913 | Bacteria | 857 |
| 251 | Ga0207671_10093458 | 3300025914 | Bacteria | 2269 |
| 252 | Ga0207693_10000607 | 3300025915 | Bacteria | 32076 |
| 253 | Ga0207693_10117966 | 3300025915 | Bacteria | 2084 |
| 254 | Ga0207663_10081631 | 3300025916 | Bacteria | 2118 |
| 255 | Ga0207660_10024108 | 3300025917 | Bacteria | 4115 |
| 256 | Ga0207662_10005337 | 3300025918 | Bacteria | 6840 |
| 257 | Ga0207657_10000086 | 3300025919 | Bacteria | 88712 |
| 258 | Ga0207657_10004302 | 3300025919 | Bacteria | 15090 |
| 259 | Ga0207657_10082856 | 3300025919 | Bacteria | 2691 |
| 260 | Ga0207649_10021335 | 3300025920 | Bacteria | 3727 |
| 261 | Ga0207652_10002048 | 3300025921 | Bacteria | 17344 |
| 262 | Ga0207652_10054764 | 3300025921 | Bacteria | 3430 |
| 263 | Ga0207652_10071936 | 3300025921 | Bacteria | 3006 |
| 264 | Ga0207652_10113144 | 3300025921 | Bacteria | 2409 |
| 265 | Ga0207652_10263304 | 3300025921 | Bacteria | 1555 |
| 266 | Ga0207681_10007570 | 3300025923 | Bacteria | 6653 |
| 267 | Ga0207694_10024759 | 3300025924 | Bacteria | 4559 |
| 268 | Ga0207694_10767247 | 3300025924 | Bacteria | 814 |
| 269 | Ga0207650_10042782 | 3300025925 | Bacteria | 3323 |
| 270 | Ga0207659_10008710 | 3300025926 | Bacteria | 6315 |
| 271 | Ga0207687_10030461 | 3300025927 | Bacteria | 3638 |
| 272 | Ga0207700_10782813 | 3300025928 | Bacteria | 853 |
| 273 | Ga0207664_10000480 | 3300025929 | Bacteria | 28371 |
| 274 | Ga0207644_10006653 | 3300025931 | Bacteria | 7533 |
| 275 | Ga0207644_10817006 | 3300025931 | Bacteria | 780 |
| 276 | Ga0207690_10002052 | 3300025932 | Bacteria | 12339 |
| 277 | Ga0207706_10000234 | 3300025933 | Bacteria | 60759 |
| 278 | Ga0207709_10029629 | 3300025935 | Bacteria | 3177 |
| 279 | Ga0207709_10054159 | 3300025935 | Bacteria | 2472 |
| 280 | Ga0207670_10006243 | 3300025936 | Bacteria | 6600 |
| 281 | Ga0207669_10030459 | 3300025937 | Bacteria | 2998 |
| 282 | Ga0207669_11036504 | 3300025937 | Bacteria | 690 |
| 283 | Ga0207704_10020514 | 3300025938 | Bacteria | 3498 |
| 284 | Ga0207665_10000120 | 3300025939 | Bacteria | 51773 |
| 285 | Ga0207691_10000538 | 3300025940 | Bacteria | 37878 |
| 286 | Ga0207711_10145492 | 3300025941 | Bacteria | 2135 |
| 287 | Ga0207711_10326914 | 3300025941 | Bacteria | 1418 |
| 288 | Ga0207689_10016336 | 3300025942 | Bacteria | 6288 |
| 289 | Ga0207661_10016618 | 3300025944 | Bacteria | 5432 |
| 290 | Ga0207679_10003216 | 3300025945 | Bacteria | 10074 |
| 291 | Ga0207667_10026394 | 3300025949 | Bacteria | 6348 |
| 292 | Ga0207667_10122957 | 3300025949 | Bacteria | 2674 |
| 293 | Ga0207667_10126328 | 3300025949 | Bacteria | 2634 |
| 294 | Ga0207651_10000671 | 3300025960 | Bacteria | 14621 |
| 295 | Ga0207651_10498645 | 3300025960 | Bacteria | 1052 |
| 296 | Ga0207651_10573495 | 3300025960 | Bacteria | 984 |
| 297 | Ga0207712_10014439 | 3300025961 | Bacteria | 5083 |
| 298 | Ga0207712_10370311 | 3300025961 | Bacteria | 1196 |
| 299 | Ga0207668_10016635 | 3300025972 | Bacteria | 4594 |
| 300 | Ga0207668_10019195 | 3300025972 | Bacteria | 4315 |
| 301 | Ga0207640_10066766 | 3300025981 | Bacteria | 2404 |
| 302 | Ga0207658_10014490 | 3300025986 | Bacteria | 5398 |
| 303 | Ga0207677_10122179 | 3300026023 | Bacteria | 1961 |
| 304 | Ga0207703_10032516 | 3300026035 | Bacteria | 4129 |
| 305 | Ga0207703_10649488 | 3300026035 | Bacteria | 1001 |
| 306 | Ga0207703_10729107 | 3300026035 | Bacteria | 944 |
| 307 | Ga0207639_10079743 | 3300026041 | Bacteria | 2588 |
| 308 | Ga0207678_10000048 | 3300026067 | Bacteria | 90920 |
| 309 | Ga0207678_10638711 | 3300026067 | Bacteria | 935 |
| 310 | Ga0207678_10746607 | 3300026067 | Bacteria | 863 |
| 311 | Ga0207708_10000443 | 3300026075 | Bacteria | 32270 |
| 312 | Ga0207702_10020692 | 3300026078 | Bacteria | 5443 |
| 313 | Ga0207641_10042481 | 3300026088 | Bacteria | 3814 |
| 314 | Ga0207648_10076143 | 3300026089 | Bacteria | 2925 |
| 315 | Ga0207676_10010515 | 3300026095 | Bacteria | 6593 |
| 316 | Ga0207674_10003550 | 3300026116 | Bacteria | 19032 |
| 317 | Ga0207675_100000155 | 3300026118 | Bacteria | 60380 |
| 318 | Ga0207675_100013005 | 3300026118 | Bacteria | 7769 |
| 319 | Ga0207675_100751434 | 3300026118 | Bacteria | 986 |
| 320 | Ga0207683_10001926 | 3300026121 | Bacteria | 18374 |
| 321 | Ga0207683_10496668 | 3300026121 | Bacteria | 1127 |
| 322 | Ga0207698_10006352 | 3300026142 | Bacteria | 7365 |
| 323 | Ga0207428_10023841 | 3300027907 | Bacteria | 5140 |
| 324 | Ga0268265_10028643 | 3300028380 | Bacteria | 3990 |
| 325 | Ga0268265_10460763 | 3300028380 | Bacteria | 1189 |
| 326 | Ga0268265_10562176 | 3300028380 | Bacteria | 1085 |
| 327 | Ga0268264_10004457 | 3300028381 | Bacteria | 11942 |
| 328 | Ga0268264_10084296 | 3300028381 | Bacteria | 2724 |
| 329 | Ga0265337_1002083 | 3300028556 | Bacteria | 9458 |
| 330 | Ga0265334_10000903 | 3300028573 | Bacteria | 14825 |
| 331 | Ga0265338_10071781 | 3300028800 | Bacteria | 2959 |
| 332 | Ga0265324_10001535 | 3300029957 | Bacteria | 12980 |
| 333 | Ga0265328_10035084 | 3300031239 | Bacteria | 1855 |
| 334 | Ga0265325_10001592 | 3300031241 | Bacteria | 15832 |
| 335 | Ga0265340_10000404 | 3300031247 | Bacteria | 23202 |
| 336 | Ga0265340_10091301 | 3300031247 | Bacteria | 1423 |
| 337 | Ga0265340_10095259 | 3300031247 | Bacteria | 1388 |
| 338 | Ga0265339_10005238 | 3300031249 | Bacteria | 8662 |
| 339 | Ga0265339_10039465 | 3300031249 | Bacteria | 2628 |
| 340 | Ga0265331_10000033 | 3300031250 | Bacteria | 203767 |
| 341 | Ga0265331_10009695 | 3300031250 | Bacteria | 5385 |
| 342 | Ga0265331_10016028 | 3300031250 | Bacteria | 3942 |
| 343 | Ga0265331_10037631 | 3300031250 | Bacteria | 2368 |
| 344 | Ga0265327_10000277 | 3300031251 | Bacteria | 101027 |
| 345 | Ga0265327_10067351 | 3300031251 | Bacteria | 1804 |
| 346 | Ga0265316_10174252 | 3300031344 | Bacteria | 1604 |
| 347 | Ga0265316_10269362 | 3300031344 | Bacteria | 1247 |
| 348 | Ga0265313_10000071 | 3300031595 | Bacteria | 99087 |
| 349 | Ga0265313_10006761 | 3300031595 | Bacteria | 8021 |
| 350 | Ga0265313_10007796 | 3300031595 | Bacteria | 7232 |
| 351 | Ga0265313_10028685 | 3300031595 | Bacteria | 2889 |
| 352 | Ga0316575_10058040 | 3300031665 | Bacteria | 1543 |
| 353 | Ga0316579_10000697 | 3300031691 | Bacteria | 11453 |
| 354 | Ga0316579_10177546 | 3300031691 | Bacteria | 1030 |
| 355 | Ga0265314_10000193 | 3300031711 | Bacteria | 90595 |
| 356 | Ga0265314_10089597 | 3300031711 | Bacteria | 2006 |
| 357 | Ga0265314_10198510 | 3300031711 | Bacteria | 1188 |
| 358 | Ga0265342_10034406 | 3300031712 | Bacteria | 3108 |
| 359 | Ga0265342_10046507 | 3300031712 | Bacteria | 2608 |
| 360 | Ga0307406_10044477 | 3300031901 | Bacteria | 2783 |
| 361 | Ga0307409_100079519 | 3300031995 | Bacteria | 2643 |
| 362 | Ga0307416_100233951 | 3300032002 | Bacteria | 1774 |
| 363 | Ga0316583_10004109 | 3300032133 | Bacteria | 5171 |
| 364 | Ga0316585_10018622 | 3300032137 | Bacteria | 2108 |
| 365 | Ga0316580_10000948 | 3300032139 | Bacteria | 7207 |
| 366 | Ga0316593_10071188 | 3300032168 | Bacteria | 1203 |
| 367 | Ga0316596_1076105 | 3300033541 | Bacteria | 900 |
| 368 | Ga0373940_0048669 | 3300035088 | Bacteria | 1185 |
| 369 | Ga0373923_0216435 | 3300035111 | Bacteria | 889 |
| 370 | Ga0373932_0002515 | 3300035112 | Bacteria | 4608 |
| 371 | Ga0373939_0012760 | 3300035114 | Bacteria | 2148 |
| 372 | Ga0373941_0012686 | 3300035115 | Bacteria | 2209 |
| 373 | Ga0373960_0001594 | 3300035121 | Bacteria | 5066 |
| 374 | Ga0373955_0075902 | 3300035172 | Bacteria | 1890 |
| 375 | Ga0373942_0053559 | 3300035207 | Bacteria | 1138 |
| 376 | Ga0373961_0014443 | 3300035241 | Bacteria | 2006 |
| 377 | Ga0373962_0009326 | 3300035242 | Bacteria | 2430 |
| 378 | Ga0316574_0454676 | 3300035398 | Unclassified | 802 |
| 379 | Ga0373931_0029959 | 3300035691 | Bacteria | 2798 |
| 380 | Ga0373931_0037937 | 3300035691 | Bacteria | 2518 |
| 381 | Ga0373935_0034816 | 3300035692 | Bacteria | 3141 |
| 382 | Ga0373927_0014460 | 3300035695 | Bacteria | 5223 |
| 383 | Ga0373947_0019698 | 3300035725 | Bacteria | 3890 |
| 384 | Ga0373947_0142400 | 3300035725 | Bacteria | 1539 |
| 385 | Ga0373937_0089280 | 3300036401 | Bacteria | 2854 |
| 386 | Ga0373937_1004422 | 3300036401 | Bacteria | 783 |
| 387 | Ga0373937_1512019 | 3300036401 | Bacteria | 619 |
| 388 | Ga0316582_0007422 | 3300036647 | Bacteria | 5833 |
| 389 | Ga0316582_0105133 | 3300036647 | Bacteria | 1874 |
| 390 | Ga0316584_0002253 | 3300036712 | Bacteria | 12117 |
| 391 | Ga0373925_0014449 | 3300037068 | Bacteria | 5708 |
| 392 | Ga0395899_0001286 | 3300037312 | Bacteria | 21730 |
| 393 | Ga0395899_0036441 | 3300037312 | Bacteria | 3690 |
| 394 | Ga0395899_0206041 | 3300037312 | Bacteria | 1369 |
| 395 | Ga0395899_0392553 | 3300037312 | Bacteria | 920 |
| 396 | Ga0395900_0001976 | 3300037418 | Bacteria | 23144 |
| 397 | Ga0395900_0209592 | 3300037418 | Bacteria | 1968 |
| 398 | Ga0395900_0447024 | 3300037418 | Bacteria | 1249 |
| 399 | Ga0395900_0523011 | 3300037418 | Bacteria | 1134 |
| 400 | Ga0395898_0001527 | 3300037466 | Bacteria | 31896 |
| 401 | Ga0395898_0002650 | 3300037466 | Bacteria | 20816 |
| 402 | Ga0395898_0507498 | 3300037466 | Bacteria | 1147 |
| 403 | Ga0316581_0000324 | 3300037588 | Bacteria | 8599 |
| 404 | Ga0436364_0642882 | 3300037853 | Bacteria | 2050 |
| 405 | Ga0436364_1385597 | 3300037853 | Bacteria | 17706 |
| 406 | Ga0395901_0002322 | 3300038443 | Bacteria | 19373 |
| 407 | Ga0436361_0008912 | 3300039447 | Bacteria | 1750 |
| 408 | Ga0436361_0081024 | 3300039447 | Bacteria | 11106 |
| 409 | Ga0436361_0324429 | 3300039447 | Bacteria | 708 |
| 410 | Ga0436361_0359530 | 3300039447 | Bacteria | 18918 |
| 411 | Ga0436361_0378619 | 3300039447 | Bacteria | 1635 |
| 412 | Ga0436361_0566426 | 3300039447 | Bacteria | 28880 |
| 413 | Ga0436361_0753731 | 3300039447 | Bacteria | 1474 |
| 414 | Ga0436361_0807183 | 3300039447 | Bacteria | 94852 |
| 415 | Ga0436361_0878292 | 3300039447 | Bacteria | 7293 |
| 416 | Ga0436361_0943087 | 3300039447 | Bacteria | 874 |
| 417 | Ga0436361_1085848 | 3300039447 | Bacteria | 1229 |
| 418 | Ga0436361_1137753 | 3300039447 | Bacteria | 3374 |
| 419 | Ga0436362_1102833 | 3300039453 | Bacteria | 1317 |
| 420 | Ga0451855_0192528 | 3300041511 | Unclassified | 705 |
| 421 | Ga0439445_0083762 | 3300042004 | Bacteria | 893 |
| 422 | Ga0451577_0018155 | 3300042876 | Bacteria | 6482 |
| 423 | Ga0451577_0065784 | 3300042876 | Bacteria | 3233 |
| 424 | Ga0453683_0028476 | 3300044673 | Bacteria | 3538 |
| 425 | Ga0453683_0309658 | 3300044673 | Bacteria | 1011 |
| 426 | Ga0453684_0000006 | 3300044712 | Bacteria | 1364191 |
| 427 | Ga0453684_0000031 | 3300044712 | Bacteria | 752632 |
| 428 | Ga0453684_0028599 | 3300044712 | Bacteria | 7947 |
| 429 | Ga0453684_0037772 | 3300044712 | Bacteria | 6622 |
| 430 | Ga0453684_0145377 | 3300044712 | Bacteria | 2825 |
| 431 | Ga0453684_0156506 | 3300044712 | Bacteria | 2701 |
| 432 | Ga0466957_0018994 | 3300044842 | Bacteria | 4041 |
| 433 | Ga0466957_0372919 | 3300044842 | Bacteria | 972 |
| 434 | Ga0466957_0780562 | 3300044842 | Bacteria | 678 |
| 435 | Ga0451576_0000219 | 3300045051 | Bacteria | 141949 |
| 436 | Ga0451576_0039568 | 3300045051 | Bacteria | 4991 |
| 437 | Ga0451576_0090963 | 3300045051 | Bacteria | 3174 |
| 438 | Ga0466958_0001224 | 3300045836 | Bacteria | 12009 |
| 439 | Ga0466967_0023435 | 3300045976 | Bacteria | 5058 |
| 440 | Ga0495603_0000028 | 3300046455 | Bacteria | 61042 |
| 441 | Ga0495629_0002953 | 3300046459 | Bacteria | 12944 |
| 442 | Ga0495641_0023733 | 3300046461 | Bacteria | 3040 |
| 443 | Ga0495580_0018748 | 3300046472 | Bacteria | 5149 |
| 444 | Ga0495580_0055120 | 3300046472 | Bacteria | 2802 |
| 445 | Ga0495582_0005654 | 3300046473 | Bacteria | 6960 |
| 446 | Ga0495639_0001421 | 3300046475 | Bacteria | 10701 |
| 447 | Ga0495662_0028913 | 3300046476 | Bacteria | 2676 |
| 448 | Ga0495584_0388941 | 3300046491 | Bacteria | 709 |
| 449 | Ga0495594_0000227 | 3300046499 | Bacteria | 27180 |
| 450 | Ga0495583_0106799 | 3300046506 | Bacteria | 1190 |
| 451 | Ga0495610_0121287 | 3300046512 | Bacteria | 1145 |
| 452 | Ga0495630_0282926 | 3300046517 | Bacteria | 1267 |
| 453 | Ga0495666_0021467 | 3300046526 | Bacteria | 3196 |
| 454 | Ga0495665_0021675 | 3300046531 | Bacteria | 3455 |
| 455 | Ga0495587_0166112 | 3300046536 | Bacteria | 1255 |
| 456 | Ga0495609_0128043 | 3300046538 | Bacteria | 1089 |
| 457 | Ga0495622_0001287 | 3300046557 | Bacteria | 12870 |
| 458 | Ga0495634_0058060 | 3300046642 | Bacteria | 2580 |
| 459 | Ga0495635_0062418 | 3300046663 | Bacteria | 2559 |
| 460 | Ga0495588_0005853 | 3300046674 | Bacteria | 5504 |
| 461 | Ga0495647_0003365 | 3300046681 | Bacteria | 5125 |
| 462 | Ga0495658_0120654 | 3300046683 | Bacteria | 1585 |
| 463 | Ga0495613_0002754 | 3300046689 | Bacteria | 13202 |
| 464 | Ga0495581_0006801 | 3300047315 | Bacteria | 6631 |
| 465 | Ga0495581_0323019 | 3300047315 | Bacteria | 902 |
| 466 | Ga0495674_0454860 | 3300047319 | Bacteria | 1028 |
| 467 | Ga0495676_0109853 | 3300047321 | Bacteria | 2025 |
| 468 | Ga0495680_0016438 | 3300047322 | Bacteria | 6355 |
| 469 | Ga0495677_0115772 | 3300047445 | Bacteria | 1021 |
| 470 | Ga0495684_0777419 | 3300047471 | Bacteria | 628 |
| 471 | Ga0495593_0001079 | 3300047673 | Bacteria | 15934 |
| 472 | Ga0495602_0133931 | 3300048088 | Bacteria | 1972 |
| 473 | Ga0495614_0003079 | 3300048089 | Bacteria | 7427 |
| 474 | Ga0496100_0039469 | 3300048903 | Bacteria | 2998 |
| 475 | Ga0496100_0266634 | 3300048903 | Bacteria | 1272 |
| 476 | Ga0496100_0508645 | 3300048903 | Bacteria | 929 |
| 477 | Ga0496101_0005059 | 3300048904 | Bacteria | 8383 |
| 478 | Ga0496101_0120240 | 3300048904 | Bacteria | 1985 |
| 479 | Ga0496101_0284617 | 3300048904 | Bacteria | 1293 |
| 480 | Ga0496102_0271125 | 3300048905 | Bacteria | 1600 |
| 481 | Ga0496102_0347946 | 3300048905 | Bacteria | 1395 |
| 482 | Ga0496103_0006682 | 3300048906 | Bacteria | 6883 |
| 483 | Ga0496103_0157246 | 3300048906 | Bacteria | 1457 |
| 484 | Ga0496104_0052024 | 3300048907 | Bacteria | 3868 |
| 485 | Ga0496104_0070677 | 3300048907 | Bacteria | 3319 |
| 486 | Ga0496104_0215736 | 3300048907 | Bacteria | 1830 |
| 487 | Ga0496105_0151440 | 3300048908 | Bacteria | 1906 |
| 488 | Ga0496105_0350286 | 3300048908 | Bacteria | 1179 |
| 489 | Ga0496105_0796840 | 3300048908 | Bacteria | 719 |
| 490 | Ga0496106_0120191 | 3300048909 | Bacteria | 2053 |
| 491 | Ga0496106_0186155 | 3300048909 | Bacteria | 1649 |
| 492 | Ga0496107_0005627 | 3300048910 | Bacteria | 8582 |
| 493 | Ga0496107_0038472 | 3300048910 | Bacteria | 3431 |
| 494 | Ga0496107_0223137 | 3300048910 | Bacteria | 1402 |
| 495 | Ga0496108_0093532 | 3300048911 | Bacteria | 2557 |
| 496 | Ga0496108_0220098 | 3300048911 | Bacteria | 1649 |
| 497 | Ga0496108_0706036 | 3300048911 | Bacteria | 874 |
| 498 | Ga0496109_0017174 | 3300048912 | Bacteria | 6337 |
| 499 | Ga0496109_0039015 | 3300048912 | Bacteria | 4297 |
| 500 | Ga0496109_0102716 | 3300048912 | Bacteria | 2653 |
| 501 | Ga0496109_0201749 | 3300048912 | Bacteria | 1870 |
| 502 | Ga0496110_0116475 | 3300048913 | Bacteria | 2405 |
| 503 | Ga0496110_0158053 | 3300048913 | Bacteria | 2054 |
| 504 | Ga0496110_0223466 | 3300048913 | Bacteria | 1713 |
| 505 | Ga0496111_0016669 | 3300048914 | Bacteria | 5067 |
| 506 | Ga0496112_0014551 | 3300048915 | Bacteria | 7308 |
| 507 | Ga0496112_0083693 | 3300048915 | Bacteria | 3155 |
| 508 | Ga0496113_0067441 | 3300048916 | Bacteria | 2713 |
| 509 | Ga0496113_0096079 | 3300048916 | Bacteria | 2290 |
| 510 | Ga0496114_0037773 | 3300048917 | Bacteria | 3995 |
| 511 | Ga0496114_0145310 | 3300048917 | Bacteria | 2055 |
| 512 | Ga0496114_0197020 | 3300048917 | Bacteria | 1763 |
| 513 | Ga0496115_0042616 | 3300048918 | Bacteria | 3616 |
| 514 | Ga0496115_0074962 | 3300048918 | Bacteria | 2748 |
| 515 | Ga0496115_0257461 | 3300048918 | Bacteria | 1435 |
| 516 | Ga0496115_0930724 | 3300048918 | Bacteria | 668 |
| 517 | Ga0496122_0072505 | 3300048925 | Bacteria | 2448 |
| 518 | Ga0501033_0023065 | 3300049570 | Bacteria | 4692 |
| 519 | Ga0501034_0247154 | 3300049571 | Bacteria | 1729 |
| 520 | Ga0501036_0134595 | 3300049572 | Bacteria | 2086 |
| 521 | Ga0501037_0633472 | 3300049573 | Bacteria | 716 |
| 522 | Ga0501039_0354427 | 3300049575 | Bacteria | 1153 |
| 523 | Ga0501040_0192687 | 3300049576 | Bacteria | 1447 |
| 524 | Ga0501041_0177286 | 3300049577 | Bacteria | 1334 |
| 525 | Ga0501042_0905359 | 3300049578 | Bacteria | 642 |
| 526 | Ga0501047_0038941 | 3300049581 | Bacteria | 4599 |
| 527 | Ga0501047_0446549 | 3300049581 | Bacteria | 1123 |
| 528 | Ga0501067_0205124 | 3300049583 | Bacteria | 1098 |
| 529 | Ga0501067_0470740 | 3300049583 | Bacteria | 702 |
| 530 | Ga0501070_0313491 | 3300049586 | Bacteria | 1277 |
| 531 | Ga0501070_0520183 | 3300049586 | Bacteria | 955 |
| 532 | Ga0501071_0183263 | 3300049587 | Bacteria | 1569 |
| 533 | Ga0501072_0774397 | 3300049588 | Bacteria | 752 |
| 534 | Ga0501073_0327372 | 3300049589 | Bacteria | 1058 |
| 535 | Ga0501074_0300242 | 3300049590 | Bacteria | 1141 |
| 536 | Ga0501074_0856905 | 3300049590 | Bacteria | 640 |
| 537 | Ga0501075_0326766 | 3300049591 | Bacteria | 1169 |
| 538 | Ga0501076_0206200 | 3300049592 | Bacteria | 1606 |
| 539 | Ga0501079_0291718 | 3300049741 | Bacteria | 1276 |
| 540 | Ga0501080_0129821 | 3300049742 | Bacteria | 2333 |
| 541 | Ga0501080_0231071 | 3300049742 | Bacteria | 1691 |
| 542 | Ga0501080_0274671 | 3300049742 | Bacteria | 1533 |
| 543 | Ga0501080_0836058 | 3300049742 | Bacteria | 806 |
| 544 | Ga0501081_0357212 | 3300049743 | Bacteria | 1077 |
| 545 | Ga0501083_0006638 | 3300049744 | Bacteria | 8207 |
| 546 | Ga0501083_0485877 | 3300049744 | Bacteria | 804 |
| 547 | Ga0501044_0217822 | 3300049823 | Bacteria | 1861 |
| 548 | Ga0501045_0994986 | 3300049824 | Bacteria | 615 |
| 549 | nmdc:mga06z11_396493_c1 | 3300050494 | Bacteria | 830 |
| 550 | nmdc:mga05p37_208929_c1 | 3300050507 | Bacteria | 2361 |
| 551 | nmdc:mga09592_204320_c1 | 3300050508 | Bacteria | 1711 |
| 552 | nmdc:mga0qj67_425802_c1 | 3300050509 | Bacteria | 1070 |
| 553 | nmdc:mga06r32_34663_c1 | 3300050510 | Bacteria | 4761 |
| 554 | nmdc:mga08y16_204024_c1 | 3300050511 | Bacteria | 2049 |
| 555 | nmdc:mga0n895_225642_c1 | 3300050512 | Bacteria | 1902 |
| 556 | nmdc:mga0rr50_224902_c1 | 3300050513 | Bacteria | 1551 |
| 557 | nmdc:mga0rr50_5898_c1 | 3300050513 | Bacteria | 7371 |
| 558 | nmdc:mga08x19_12927_c1 | 3300050514 | Bacteria | 5039 |
| 559 | nmdc:mga08x19_20580_c1 | 3300050514 | Bacteria | 4063 |
| 560 | Ga0495612_0256932 | 3300053078 | Bacteria | 778 |
| 561 | Ga0495595_0038371 | 3300053084 | Bacteria | 2182 |
| 562 | Ga0495619_0054425 | 3300053085 | Bacteria | 2648 |
| 563 | Ga0495619_0095496 | 3300053085 | Bacteria | 2017 |
| 564 | Ga0500652_002927 | 3300053131 | Bacteria | 5151 |
| 565 | Ga0500559_0048073 | 3300053136 | Bacteria | 1875 |
| 566 | Ga0500633_0001120 | 3300053160 | Bacteria | 4833 |
| 567 | Ga0501084_1031861 | 3300054114 | Bacteria | 691 |
| 568 | Ga0587101_007528 | 3300059623 | Bacteria | 1288 |
| 569 | Ga0587111_0064896 | 3300060346 | Bacteria | 839 |
| 570 | Ga0501082_0757286 | 3300060353 | Bacteria | 850 |
| 571 | Ga0530510_0017122 | 3300061734 | Bacteria | 5133 |
| 572 | 2512032692 | 2511231221 | Bacteria | 6846400 |
| 573 | 2512645822 | 2512564014 | Bacteria | 4639632 |
| 574 | 2523102861 | 2522572158 | Bacteria | 6514390 |
| 575 | 2524610183 | 2524023250 | Bacteria | 5457705 |
| 576 | 2535485782 | 2534681786 | Bacteria | 3308809 |
| 577 | 2585167951 | 2582581283 | Bacteria | 6030556 |
| 578 | 2585265443 | 2582581306 | Bacteria | 6450535 |
| 579 | 2585388477 | 2582581865 | Bacteria | 6644329 |
| 580 | 2599102423 | 2597490356 | Bacteria | 7030811 |
| 581 | 2643949137 | 2643221588 | Bacteria | 3692460 |
| 582 | 2644051017 | 2643221607 | Bacteria | 6314006 |
| 583 | 2644205520 | 2643221636 | Bacteria | 6583769 |
| 584 | 2644483921 | 2643221686 | Bacteria | 6310811 |
| 585 | 2644496300 | 2643221688 | Bacteria | 5260751 |
| 586 | 2644500274 | 2643221689 | Bacteria | 6042950 |
| 587 | 2757570500 | 2757320392 | Bacteria | 3737298 |
| 588 | 2758642493 | 2758568016 | Bacteria | 5645291 |
| 589 | 2770198106 | 2767802442 | Bacteria | 5747986 |
| 590 | 2809062091 | 2808606401 | Bacteria | 4586670 |
| 591 | 2809078055 | 2808606404 | Bacteria | 4652788 |
| 592 | 2809082237 | 2808606405 | Bacteria | 4586632 |
| 593 | 2821449293 | 2821443989 | Bacteria | 7658172 |
| 594 | 2842777715 | 2842775625 | Bacteria | 5587290 |
| 595 | 2844538629 | 2844533157 | Bacteria | 7517899 |
| 596 | 2846954501 | 2846952575 | Bacteria | 6587527 |
| 597 | 2848859237 | 2848858292 | Bacteria | 7391279 |
| 598 | 2880519724 | 2880518877 | Bacteria | 5012590 |
| 599 | 2883296061 | 2883291878 | Bacteria | 5894118 |
| 600 | 2883358818 | 2883354860 | Bacteria | 5865246 |
| 601 | 2894654061 | 2894652903 | Bacteria | 4587256 |
| 602 | 2897804400 | 2897803580 | Bacteria | 7000062 |
| 603 | 2915654214 | 2915650412 | Bacteria | 4288180 |
| 604 | 2919710032 | 2919709256 | Bacteria | 4318106 |
| 605 | 3002141369 | 3002141150 | Bacteria | 5254435 |
| 606 | 8054006200 | 8054002106 | Bacteria | 7987183 |
| 607 | 8054558540 | 8054558443 | Bacteria | 5204801 |
| 608 | Ga0436361_0347270 | |||
| 609 | SwRhRL2b_contig_345966 | |||
| 610 | SwRhRL2b_contig_3681263 | |||
| 611 | JGI24737J22298_10088585 | |||
| 612 | JGI24750J21931_1001475 | |||
| 613 | JGI24748J21848_1010959 | |||
| 614 | JGI24738J21930_10044430 | |||
| 615 | JGI24749J21850_1024409 | |||
| 616 | JGI24744J21845_10025792 | |||
| 617 | JGI24034J26672_10026285 | |||
| 618 | JGI24742J22300_10033591 | |||
| 619 | JGI25406J46586_10031467 | |||
| 620 | JGI25160J50197_1009123 | |||
| 621 | Ga0055536_1005913 | |||
| 622 | Ga0055530_10042377 | |||
| 623 | Ga0055531_10006826 | |||
| 624 | JGI25405J52794_10056826 | |||
| 625 | Ga0070658_10307996 | |||
| 626 | Ga0070676_10000987 | |||
| 627 | Ga0070676_10316975 | |||
| 628 | Ga0070683_100066827 | |||
| 629 | Ga0070683_100211128 | |||
| 630 | Ga0070683_100468363 | |||
| 631 | Ga0070690_100000506 | |||
| 632 | Ga0070670_100001094 | |||
| 633 | Ga0070670_100220958 | |||
| 634 | Ga0070670_100732890 | |||
| 635 | Ga0068869_100084816 | |||
| 636 | Ga0070666_10002984 | |||
| 637 | Ga0070666_10442344 | |||
| 638 | Ga0070680_100021223 | |||
| 639 | Ga0070682_100004821 | |||
| 640 | Ga0068868_100000904 | |||
| 641 | Ga0070660_100001178 | |||
| 642 | Ga0070660_100032089 | |||
| 643 | Ga0070689_100004127 | |||
| 644 | Ga0070689_100779159 | |||
| 645 | Ga0070691_10000155 | |||
| 646 | Ga0070687_100008938 | |||
| 647 | Ga0070661_100001464 | |||
| 648 | Ga0070692_10000912 | |||
| 649 | Ga0070692_10624784 | |||
| 650 | Ga0070668_100000692 | |||
| 651 | Ga0070668_100346596 | |||
| 652 | Ga0070669_100000807 | |||
| 653 | Ga0070675_100012884 | |||
| 654 | Ga0070671_100001121 | |||
| 655 | Ga0070674_100001386 | |||
| 656 | Ga0070674_100029503 | |||
| 657 | Ga0070673_100000626 | |||
| 658 | Ga0070673_100219163 | |||
| 659 | Ga0070673_100898474 | |||
| 660 | Ga0070688_100000139 | |||
| 661 | Ga0070659_100015488 | |||
| 662 | Ga0070667_100017103 | |||
| 663 | Ga0070709_10001924 | |||
| 664 | Ga0070714_100001275 | |||
| 665 | Ga0070714_100002022 | |||
| 666 | Ga0070713_100402886 | |||
| 667 | Ga0070710_10013755 | |||
| 668 | Ga0070701_10001747 | |||
| 669 | Ga0070701_10057859 | |||
| 670 | Ga0070711_100002491 | |||
| 671 | Ga0070705_100000298 | |||
| 672 | Ga0070705_100873241 | |||
| 673 | Ga0070700_100000648 | |||
| 674 | Ga0070694_100004154 | |||
| 675 | Ga0070694_100070603 | |||
| 676 | Ga0070694_100106037 | |||
| 677 | Ga0070708_100124794 | |||
| 678 | Ga0070663_100003945 | |||
| 679 | Ga0070678_100000734 | |||
| 680 | Ga0070678_100313141 | |||
| 681 | Ga0070662_100001979 | |||
| 682 | Ga0070662_100728177 | |||
| 683 | Ga0070681_10001440 | |||
| 684 | Ga0070681_10057357 | |||
| 685 | Ga0070681_10156466 | |||
| 686 | Ga0070681_10241360 | |||
| 687 | Ga0070681_10639990 | |||
| 688 | Ga0070685_10002499 | |||
| 689 | Ga0070706_100659371 | |||
| 690 | Ga0070707_100721244 | |||
| 691 | Ga0070698_101085203 | |||
| 692 | Ga0070699_100262442 | |||
| 693 | Ga0070679_100020169 | |||
| 694 | Ga0070679_100065459 | |||
| 695 | Ga0070679_100075617 | |||
| 696 | Ga0070679_100545952 | |||
| 697 | Ga0070684_100092785 | |||
| 698 | Ga0070684_100194552 | |||
| 699 | Ga0070697_100023341 | |||
| 700 | Ga0068853_100013838 | |||
| 701 | Ga0070672_100001796 | |||
| 702 | Ga0070686_100000266 | |||
| 703 | Ga0070695_100000864 | |||
| 704 | Ga0070695_100537000 | |||
| 705 | Ga0070696_100000333 | |||
| 706 | Ga0070696_100474229 | |||
| 707 | Ga0070693_100000326 | |||
| 708 | Ga0070704_100011313 | |||
| 709 | Ga0070704_100212585 | |||
| 710 | Ga0068855_100007108 | |||
| 711 | Ga0068855_100151444 | |||
| 712 | Ga0068855_100260651 | |||
| 713 | Ga0068855_100281082 | |||
| 714 | Ga0070664_100018030 | |||
| 715 | Ga0068857_100007649 | |||
| 716 | Ga0068857_100162482 | |||
| 717 | Ga0068854_100000885 | |||
| 718 | Ga0068854_100168990 | |||
| 719 | Ga0068856_100002298 | |||
| 720 | Ga0068856_100364984 | |||
| 721 | Ga0070702_100000139 | |||
| 722 | Ga0070702_100025937 | |||
| 723 | Ga0068852_100001969 | |||
| 724 | Ga0068859_100072515 | |||
| 725 | Ga0068859_100540647 | |||
| 726 | Ga0068859_100630765 | |||
| 727 | Ga0068859_101015098 | |||
| 728 | Ga0068864_100011694 | |||
| 729 | Ga0068866_10006115 | |||
| 730 | Ga0068866_10074171 | |||
| 731 | Ga0068861_100002618 | |||
| 732 | Ga0068863_100000834 | |||
| 733 | Ga0068858_100001979 | |||
| 734 | Ga0068858_100056987 | |||
| 735 | Ga0068860_100002133 | |||
| 736 | Ga0068860_100321835 | |||
| 737 | Ga0068862_100008752 | |||
| 738 | Ga0068862_100030783 | |||
| 739 | Ga0081455_10003421 | |||
| 740 | Ga0081455_10103891 | |||
| 741 | Ga0081455_10170377 | |||
| 742 | Ga0081540_1050077 | |||
| 743 | Ga0075432_10006309 | |||
| 744 | Ga0070715_10003350 | |||
| 745 | Ga0070715_10547431 | |||
| 746 | Ga0070716_100000665 | |||
| 747 | Ga0070712_100000828 | |||
| 748 | Ga0075369_10100426 | |||
| 749 | Ga0097621_100052449 | |||
| 750 | Ga0068871_100020391 | |||
| 751 | Ga0075428_100011583 | |||
| 752 | Ga0075430_100263289 | |||
| 753 | Ga0075431_100006991 | |||
| 754 | Ga0075433_10057597 | |||
| 755 | Ga0075433_10091162 | |||
| 756 | Ga0075434_100038910 | |||
| 757 | Ga0075434_100658168 | |||
| 758 | Ga0075429_100007710 | |||
| 759 | Ga0068865_100010883 | |||
| 760 | Ga0075436_100022707 | |||
| 761 | Ga0097620_100072507 | |||
| 762 | Ga0097620_100540652 | |||
| 763 | Ga0097620_100630762 | |||
| 764 | Ga0097620_101015247 | |||
| 765 | Ga0075435_100019751 | |||
| 766 | Ga0075435_100207332 | |||
| 767 | Ga0105251_10137375 | |||
| 768 | Ga0105250_10010349 | |||
| 769 | Ga0105240_10032679 | |||
| 770 | Ga0105240_10044054 | |||
| 771 | Ga0105240_11091264 | |||
| 772 | Ga0111539_10417778 | |||
| 773 | Ga0105245_10000795 | |||
| 774 | Ga0105247_10002881 | |||
| 775 | Ga0114129_10123347 | |||
| 776 | Ga0105243_10007413 | |||
| 777 | Ga0105243_10097656 | |||
| 778 | Ga0105241_10003139 | |||
| 779 | Ga0105242_10239960 | |||
| 780 | Ga0105248_10004961 | |||
| 781 | Ga0105248_10995210 | |||
| 782 | Ga0105237_10002479 | |||
| 783 | Ga0105237_10193875 | |||
| 784 | Ga0105237_11316040 | |||
| 785 | Ga0105238_10000136 | |||
| 786 | Ga0105238_10155349 | |||
| 787 | Ga0105249_10007009 | |||
| 788 | Ga0105249_10019431 | |||
| 789 | Ga0105239_10015919 | |||
| 790 | Ga0105246_10010014 | |||
| 791 | Ga0157335_1012194 | |||
| 792 | Ga0157373_10060317 | |||
| 793 | Ga0157371_10010729 | |||
| 794 | Ga0157371_10013083 | |||
| 795 | Ga0157370_10002838 | |||
| 796 | Ga0157370_10030490 | |||
| 797 | Ga0157370_10094453 | |||
| 798 | Ga0157369_10006851 | |||
| 799 | Ga0157369_10205998 | |||
| 800 | Ga0157374_10092147 | |||
| 801 | Ga0157378_11178527 | |||
| 802 | Ga0163162_10018703 | |||
| 803 | Ga0163162_10455268 | |||
| 804 | Ga0157372_10905216 | |||
| 805 | Ga0157375_10006110 | |||
| 806 | Ga0157375_10006188 | |||
| 807 | Ga0157375_10302062 | |||
| 808 | Ga0157375_11517202 | |||
| 809 | Ga0163163_10003201 | |||
| 810 | Ga0157380_10001853 | |||
| 811 | Ga0182008_10129940 | |||
| 812 | Ga0157377_10005976 | |||
| 813 | Ga0157377_10193963 | |||
| 814 | Ga0157379_10008173 | |||
| 815 | Ga0157379_10348792 | |||
| 816 | Ga0157376_10000272 | |||
| 817 | Ga0163161_10002256 | |||
| 818 | Ga0163161_10008969 | |||
| 819 | Ga0206354_10395558 | |||
| 820 | Ga0213872_10000015 | |||
| 821 | Ga0213872_10009790 | |||
| 822 | Ga0213875_10009612 | |||
| 823 | Ga0213875_10137166 | |||
| 824 | Ga0209130_1000732 | |||
| 825 | Ga0209676_1000019 | |||
| 826 | Ga0209025_1000509 | |||
| 827 | Ga0209758_1003243 | |||
| 828 | Ga0209050_1002828 | |||
| 829 | Ga0209050_1019231 | |||
| 830 | Ga0207426_1000080 | |||
| 831 | Ga0209257_1000407 | |||
| 832 | Ga0209257_1050148 | |||
| 833 | Ga0207697_10043250 | |||
| 834 | Ga0207696_1010591 | |||
| 835 | Ga0207692_10009314 | |||
| 836 | Ga0207642_10014815 | |||
| 837 | Ga0207642_10025853 | |||
| 838 | Ga0207710_10007162 | |||
| 839 | Ga0207688_10022493 | |||
| 840 | Ga0207688_10111040 | |||
| 841 | Ga0207680_10055367 | |||
| 842 | Ga0207647_10009490 | |||
| 843 | Ga0207647_10022158 | |||
| 844 | Ga0207647_10301756 | |||
| 845 | Ga0207685_10011336 | |||
| 846 | Ga0207699_10001015 | |||
| 847 | Ga0207699_10012546 | |||
| 848 | Ga0207645_10003182 | |||
| 849 | Ga0207705_10011206 | |||
| 850 | Ga0207705_10256260 | |||
| 851 | Ga0207654_10002679 | |||
| 852 | Ga0207707_10001919 | |||
| 853 | Ga0207707_10151852 | |||
| 854 | Ga0207707_10192226 | |||
| 855 | Ga0207695_10134579 | |||
| 856 | Ga0207695_10178461 | |||
| 857 | Ga0207695_10749852 | |||
| 858 | Ga0207671_10093458 | |||
| 859 | Ga0207693_10000607 | |||
| 860 | Ga0207693_10117966 | |||
| 861 | Ga0207663_10081631 | |||
| 862 | Ga0207660_10024108 | |||
| 863 | Ga0207662_10005337 | |||
| 864 | Ga0207657_10000086 | |||
| 865 | Ga0207657_10004302 | |||
| 866 | Ga0207657_10082856 | |||
| 867 | Ga0207649_10021335 | |||
| 868 | Ga0207652_10002048 | |||
| 869 | Ga0207652_10054764 | |||
| 870 | Ga0207652_10071936 | |||
| 871 | Ga0207652_10113144 | |||
| 872 | Ga0207652_10263304 | |||
| 873 | Ga0207681_10007570 | |||
| 874 | Ga0207694_10024759 | |||
| 875 | Ga0207694_10767247 | |||
| 876 | Ga0207650_10042782 | |||
| 877 | Ga0207659_10008710 | |||
| 878 | Ga0207687_10030461 | |||
| 879 | Ga0207700_10782813 | |||
| 880 | Ga0207664_10000480 | |||
| 881 | Ga0207644_10006653 | |||
| 882 | Ga0207644_10817006 | |||
| 883 | Ga0207690_10002052 | |||
| 884 | Ga0207706_10000234 | |||
| 885 | Ga0207709_10029629 | |||
| 886 | Ga0207709_10054159 | |||
| 887 | Ga0207670_10006243 | |||
| 888 | Ga0207669_10030459 | |||
| 889 | Ga0207669_11036504 | |||
| 890 | Ga0207704_10020514 | |||
| 891 | Ga0207665_10000120 | |||
| 892 | Ga0207691_10000538 | |||
| 893 | Ga0207711_10145492 | |||
| 894 | Ga0207711_10326914 | |||
| 895 | Ga0207689_10016336 | |||
| 896 | Ga0207661_10016618 | |||
| 897 | Ga0207679_10003216 | |||
| 898 | Ga0207667_10026394 | |||
| 899 | Ga0207667_10122957 | |||
| 900 | Ga0207667_10126328 | |||
| 901 | Ga0207651_10000671 | |||
| 902 | Ga0207651_10498645 | |||
| 903 | Ga0207651_10573495 | |||
| 904 | Ga0207712_10014439 | |||
| 905 | Ga0207712_10370311 | |||
| 906 | Ga0207668_10016635 | |||
| 907 | Ga0207668_10019195 | |||
| 908 | Ga0207640_10066766 | |||
| 909 | Ga0207658_10014490 | |||
| 910 | Ga0207677_10122179 | |||
| 911 | Ga0207703_10032516 | |||
| 912 | Ga0207703_10649488 | |||
| 913 | Ga0207703_10729107 | |||
| 914 | Ga0207639_10079743 | |||
| 915 | Ga0207678_10000048 | |||
| 916 | Ga0207678_10638711 | |||
| 917 | Ga0207678_10746607 | |||
| 918 | Ga0207708_10000443 | |||
| 919 | Ga0207702_10020692 | |||
| 920 | Ga0207641_10042481 | |||
| 921 | Ga0207648_10076143 | |||
| 922 | Ga0207676_10010515 | |||
| 923 | Ga0207674_10003550 | |||
| 924 | Ga0207675_100000155 | |||
| 925 | Ga0207675_100013005 | |||
| 926 | Ga0207675_100751434 | |||
| 927 | Ga0207683_10001926 | |||
| 928 | Ga0207683_10496668 | |||
| 929 | Ga0207698_10006352 | |||
| 930 | Ga0207428_10023841 | |||
| 931 | Ga0268265_10028643 | |||
| 932 | Ga0268265_10460763 | |||
| 933 | Ga0268265_10562176 | |||
| 934 | Ga0268264_10004457 | |||
| 935 | Ga0268264_10084296 | |||
| 936 | Ga0265337_1002083 | |||
| 937 | Ga0265334_10000903 | |||
| 938 | Ga0265338_10071781 | |||
| 939 | Ga0265324_10001535 | |||
| 940 | Ga0265328_10035084 | |||
| 941 | Ga0265325_10001592 | |||
| 942 | Ga0265340_10000404 | |||
| 943 | Ga0265340_10091301 | |||
| 944 | Ga0265340_10095259 | |||
| 945 | Ga0265339_10005238 | |||
| 946 | Ga0265339_10039465 | |||
| 947 | Ga0265331_10000033 | |||
| 948 | Ga0265331_10009695 | |||
| 949 | Ga0265331_10016028 | |||
| 950 | Ga0265331_10037631 | |||
| 951 | Ga0265327_10000277 | |||
| 952 | Ga0265327_10067351 | |||
| 953 | Ga0265316_10174252 | |||
| 954 | Ga0265316_10269362 | |||
| 955 | Ga0265313_10000071 | |||
| 956 | Ga0265313_10006761 | |||
| 957 | Ga0265313_10007796 | |||
| 958 | Ga0265313_10028685 | |||
| 959 | Ga0316575_10058040 | |||
| 960 | Ga0316579_10000697 | |||
| 961 | Ga0316579_10177546 | |||
| 962 | Ga0265314_10000193 | |||
| 963 | Ga0265314_10089597 | |||
| 964 | Ga0265314_10198510 | |||
| 965 | Ga0265342_10034406 | |||
| 966 | Ga0265342_10046507 | |||
| 967 | Ga0307406_10044477 | |||
| 968 | Ga0307409_100079519 | |||
| 969 | Ga0307416_100233951 | |||
| 970 | Ga0316583_10004109 | |||
| 971 | Ga0316585_10018622 | |||
| 972 | Ga0316580_10000948 | |||
| 973 | Ga0316593_10071188 | |||
| 974 | Ga0316596_1076105 | |||
| 975 | Ga0373940_0048669 | |||
| 976 | Ga0373923_0216435 | |||
| 977 | Ga0373932_0002515 | |||
| 978 | Ga0373939_0012760 | |||
| 979 | Ga0373941_0012686 | |||
| 980 | Ga0373960_0001594 | |||
| 981 | Ga0373955_0075902 | |||
| 982 | Ga0373942_0053559 | |||
| 983 | Ga0373961_0014443 | |||
| 984 | Ga0373962_0009326 | |||
| 985 | Ga0316574_0454676 | |||
| 986 | Ga0373931_0029959 | |||
| 987 | Ga0373931_0037937 | |||
| 988 | Ga0373935_0034816 | |||
| 989 | Ga0373927_0014460 | |||
| 990 | Ga0373947_0019698 | |||
| 991 | Ga0373947_0142400 | |||
| 992 | Ga0373937_0089280 | |||
| 993 | Ga0373937_1004422 | |||
| 994 | Ga0373937_1512019 | |||
| 995 | Ga0316582_0007422 | |||
| 996 | Ga0316582_0105133 | |||
| 997 | Ga0316584_0002253 | |||
| 998 | Ga0373925_0014449 | |||
| 999 | Ga0395899_0001286 | |||
| 1000 | Ga0395899_0036441 | |||
| 1001 | Ga0395899_0206041 | |||
| 1002 | Ga0395899_0392553 | |||
| 1003 | Ga0395900_0001976 | |||
| 1004 | Ga0395900_0209592 | |||
| 1005 | Ga0395900_0447024 | |||
| 1006 | Ga0395900_0523011 | |||
| 1007 | Ga0395898_0001527 | |||
| 1008 | Ga0395898_0002650 | |||
| 1009 | Ga0395898_0507498 | |||
| 1010 | Ga0316581_0000324 | |||
| 1011 | Ga0436364_0642882 | |||
| 1012 | Ga0436364_1385597 | |||
| 1013 | Ga0395901_0002322 | |||
| 1014 | Ga0436361_0008912 | |||
| 1015 | Ga0436361_0081024 | |||
| 1016 | Ga0436361_0324429 | |||
| 1017 | Ga0436361_0359530 | |||
| 1018 | Ga0436361_0378619 | |||
| 1019 | Ga0436361_0566426 | |||
| 1020 | Ga0436361_0753731 | |||
| 1021 | Ga0436361_0807183 | |||
| 1022 | Ga0436361_0878292 | |||
| 1023 | Ga0436361_0943087 | |||
| 1024 | Ga0436361_1085848 | |||
| 1025 | Ga0436361_1137753 | |||
| 1026 | Ga0436362_1102833 | |||
| 1027 | Ga0451855_0192528 | |||
| 1028 | Ga0439445_0083762 | |||
| 1029 | Ga0451577_0018155 | |||
| 1030 | Ga0451577_0065784 | |||
| 1031 | Ga0453683_0028476 | |||
| 1032 | Ga0453683_0309658 | |||
| 1033 | Ga0453684_0000006 | |||
| 1034 | Ga0453684_0000031 | |||
| 1035 | Ga0453684_0028599 | |||
| 1036 | Ga0453684_0037772 | |||
| 1037 | Ga0453684_0145377 | |||
| 1038 | Ga0453684_0156506 | |||
| 1039 | Ga0466957_0018994 | |||
| 1040 | Ga0466957_0372919 | |||
| 1041 | Ga0466957_0780562 | |||
| 1042 | Ga0451576_0000219 | |||
| 1043 | Ga0451576_0039568 | |||
| 1044 | Ga0451576_0090963 | |||
| 1045 | Ga0466958_0001224 | |||
| 1046 | Ga0466967_0023435 | |||
| 1047 | Ga0495603_0000028 | |||
| 1048 | Ga0495629_0002953 | |||
| 1049 | Ga0495641_0023733 | |||
| 1050 | Ga0495580_0018748 | |||
| 1051 | Ga0495580_0055120 | |||
| 1052 | Ga0495582_0005654 | |||
| 1053 | Ga0495639_0001421 | |||
| 1054 | Ga0495662_0028913 | |||
| 1055 | Ga0495584_0388941 | |||
| 1056 | Ga0495594_0000227 | |||
| 1057 | Ga0495583_0106799 | |||
| 1058 | Ga0495610_0121287 | |||
| 1059 | Ga0495630_0282926 | |||
| 1060 | Ga0495666_0021467 | |||
| 1061 | Ga0495665_0021675 | |||
| 1062 | Ga0495587_0166112 | |||
| 1063 | Ga0495609_0128043 | |||
| 1064 | Ga0495622_0001287 | |||
| 1065 | Ga0495634_0058060 | |||
| 1066 | Ga0495635_0062418 | |||
| 1067 | Ga0495588_0005853 | |||
| 1068 | Ga0495647_0003365 | |||
| 1069 | Ga0495658_0120654 | |||
| 1070 | Ga0495613_0002754 | |||
| 1071 | Ga0495581_0006801 | |||
| 1072 | Ga0495581_0323019 | |||
| 1073 | Ga0495674_0454860 | |||
| 1074 | Ga0495676_0109853 | |||
| 1075 | Ga0495680_0016438 | |||
| 1076 | Ga0495677_0115772 | |||
| 1077 | Ga0495684_0777419 | |||
| 1078 | Ga0495593_0001079 | |||
| 1079 | Ga0495602_0133931 | |||
| 1080 | Ga0495614_0003079 | |||
| 1081 | Ga0496100_0039469 | |||
| 1082 | Ga0496100_0266634 | |||
| 1083 | Ga0496100_0508645 | |||
| 1084 | Ga0496101_0005059 | |||
| 1085 | Ga0496101_0120240 | |||
| 1086 | Ga0496101_0284617 | |||
| 1087 | Ga0496102_0271125 | |||
| 1088 | Ga0496102_0347946 | |||
| 1089 | Ga0496103_0006682 | |||
| 1090 | Ga0496103_0157246 | |||
| 1091 | Ga0496104_0052024 | |||
| 1092 | Ga0496104_0070677 | |||
| 1093 | Ga0496104_0215736 | |||
| 1094 | Ga0496105_0151440 | |||
| 1095 | Ga0496105_0350286 | |||
| 1096 | Ga0496105_0796840 | |||
| 1097 | Ga0496106_0120191 | |||
| 1098 | Ga0496106_0186155 | |||
| 1099 | Ga0496107_0005627 | |||
| 1100 | Ga0496107_0038472 | |||
| 1101 | Ga0496107_0223137 | |||
| 1102 | Ga0496108_0093532 | |||
| 1103 | Ga0496108_0220098 | |||
| 1104 | Ga0496108_0706036 | |||
| 1105 | Ga0496109_0017174 | |||
| 1106 | Ga0496109_0039015 | |||
| 1107 | Ga0496109_0102716 | |||
| 1108 | Ga0496109_0201749 | |||
| 1109 | Ga0496110_0116475 | |||
| 1110 | Ga0496110_0158053 | |||
| 1111 | Ga0496110_0223466 | |||
| 1112 | Ga0496111_0016669 | |||
| 1113 | Ga0496112_0014551 | |||
| 1114 | Ga0496112_0083693 | |||
| 1115 | Ga0496113_0067441 | |||
| 1116 | Ga0496113_0096079 | |||
| 1117 | Ga0496114_0037773 | |||
| 1118 | Ga0496114_0145310 | |||
| 1119 | Ga0496114_0197020 | |||
| 1120 | Ga0496115_0042616 | |||
| 1121 | Ga0496115_0074962 | |||
| 1122 | Ga0496115_0257461 | |||
| 1123 | Ga0496115_0930724 | |||
| 1124 | Ga0496122_0072505 | |||
| 1125 | Ga0501033_0023065 | |||
| 1126 | Ga0501034_0247154 | |||
| 1127 | Ga0501036_0134595 | |||
| 1128 | Ga0501037_0633472 | |||
| 1129 | Ga0501039_0354427 | |||
| 1130 | Ga0501040_0192687 | |||
| 1131 | Ga0501041_0177286 | |||
| 1132 | Ga0501042_0905359 | |||
| 1133 | Ga0501047_0038941 | |||
| 1134 | Ga0501047_0446549 | |||
| 1135 | Ga0501067_0205124 | |||
| 1136 | Ga0501067_0470740 | |||
| 1137 | Ga0501070_0313491 | |||
| 1138 | Ga0501070_0520183 | |||
| 1139 | Ga0501071_0183263 | |||
| 1140 | Ga0501072_0774397 | |||
| 1141 | Ga0501073_0327372 | |||
| 1142 | Ga0501074_0300242 | |||
| 1143 | Ga0501074_0856905 | |||
| 1144 | Ga0501075_0326766 | |||
| 1145 | Ga0501076_0206200 | |||
| 1146 | Ga0501079_0291718 | |||
| 1147 | Ga0501080_0129821 | |||
| 1148 | Ga0501080_0231071 | |||
| 1149 | Ga0501080_0274671 | |||
| 1150 | Ga0501080_0836058 | |||
| 1151 | Ga0501081_0357212 | |||
| 1152 | Ga0501083_0006638 | |||
| 1153 | Ga0501083_0485877 | |||
| 1154 | Ga0501044_0217822 | |||
| 1155 | Ga0501045_0994986 | |||
| 1156 | nmdc:mga06z11_396493_c1 | |||
| 1157 | nmdc:mga05p37_208929_c1 | |||
| 1158 | nmdc:mga09592_204320_c1 | |||
| 1159 | nmdc:mga0qj67_425802_c1 | |||
| 1160 | nmdc:mga06r32_34663_c1 | |||
| 1161 | nmdc:mga08y16_204024_c1 | |||
| 1162 | nmdc:mga0n895_225642_c1 | |||
| 1163 | nmdc:mga0rr50_224902_c1 | |||
| 1164 | nmdc:mga0rr50_5898_c1 | |||
| 1165 | nmdc:mga08x19_12927_c1 | |||
| 1166 | nmdc:mga08x19_20580_c1 | |||
| 1167 | Ga0495612_0256932 | |||
| 1168 | Ga0495595_0038371 | |||
| 1169 | Ga0495619_0054425 | |||
| 1170 | Ga0495619_0095496 | |||
| 1171 | Ga0500652_002927 | |||
| 1172 | Ga0500559_0048073 | |||
| 1173 | Ga0500633_0001120 | |||
| 1174 | Ga0501084_1031861 | |||
| 1175 | Ga0587101_007528 | |||
| 1176 | Ga0587111_0064896 | |||
| 1177 | Ga0501082_0757286 | |||
| 1178 | Ga0530510_0017122 | |||
| 1179 | 2512032692 | |||
| 1180 | 2512645822 | |||
| 1181 | 2523102861 | |||
| 1182 | 2524610183 | |||
| 1183 | 2535485782 | |||
| 1184 | 2585167951 | |||
| 1185 | 2585265443 | |||
| 1186 | 2585388477 | |||
| 1187 | 2599102423 | |||
| 1188 | 2643949137 | |||
| 1189 | 2644051017 | |||
| 1190 | 2644205520 | |||
| 1191 | 2644483921 | |||
| 1192 | 2644496300 | |||
| 1193 | 2644500274 | |||
| 1194 | 2757570500 | |||
| 1195 | 2758642493 | |||
| 1196 | 2770198106 | |||
| 1197 | 2809062091 | |||
| 1198 | 2809078055 | |||
| 1199 | 2809082237 | |||
| 1200 | 2821449293 | |||
| 1201 | 2842777715 | |||
| 1202 | 2844538629 | |||
| 1203 | 2846954501 | |||
| 1204 | 2848859237 | |||
| 1205 | 2880519724 | |||
| 1206 | 2883296061 | |||
| 1207 | 2883358818 | |||
| 1208 | 2894654061 | |||
| 1209 | 2897804400 | |||
| 1210 | 2915654214 | |||
| 1211 | 2919710032 | |||
| 1212 | 3002141369 | |||
| 1213 | 8054006200 | |||
| 1214 | 8054558540 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3a5z-assembly1.cif.gz_B | crystal structure of escherichia coli genx in complex with elongation factor p | 0.9317 | 4 | 127 |
| 3a5z-assembly2.cif.gz_H | crystal structure of escherichia coli genx in complex with elongation factor p | 0.9252 | 4 | 186 |
| 5j3b-assembly2.cif.gz_B | structure of translation elongation factor p from acinetobacter baumannii | 0.921 | 3 | 186 |
| 3a5z-assembly2.cif.gz_F | crystal structure of escherichia coli genx in complex with elongation factor p | 0.9206 | 3 | 59 |
| 5j3b-assembly1.cif.gz_A | structure of translation elongation factor p from acinetobacter baumannii | 0.9117 | 1 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F4JUX3_135_197_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9778 | 65 | 127 | 2.40.50.140 |
| af_P9WNM3_64_126_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9758 | 65 | 127 | 2.40.50.140 |
| af_P0A6N8_1_64_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9685 | 4 | 62 | 2.30.30.30 |
| af_I1JVU1_126_189_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9629 | 65 | 127 | 2.40.50.140 |
| af_F4JUX3_135_197_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9629 | 65 | 127 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2A5YF18-F1-model_v4 | Elongation factor P (EF-P) | 0.9631 | 3 | 186 |
GO:0003746
GO:0005737 GO:0043043 |
| AF-A0A023DY07-F1-model_v4 | Elongation factor P (EF-P) | 0.9576 | 1 | 188 |
GO:0003746
GO:0005737 GO:0043043 |
| AF-A0A1F8N9H0-F1-model_v4 | Elongation factor P (EF-P) | 0.9574 | 3 | 187 |
GO:0003746
GO:0005737 GO:0043043 |
| AF-A6DS65-F1-model_v4 | Elongation factor P (EF-P) | 0.9533 | 1 | 187 |
GO:0003746
GO:0005737 GO:0043043 |
| AF-A0A2A5YF18-F1-model_v4 | Elongation factor P (EF-P) | 0.953 | 3 | 186 |
GO:0003746
GO:0005737 GO:0043043 |