F468714

General Info

Members Datasets Scaffolds Average Seq Length
607 192 1214 233

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0213090|Ga0395899_0213090_315_1049
Length 244
Sequence MNARGGWIVAAVGGGVVGSILTTGILFFAVPNSVATRVVRQGMVSDPQILRDSAEALQKQDEEKAQQQQISALAVNRVAIETPFASSWKGAAKPDVTLVEFFDYACPYCKVTNPTVDRLLQEDKGLRVVYRELPIIGGQESEIAARLSLTASKAGRFAQFHDALWAAGRPAPETLVIASNAAGISPEPPPNDPDIEAEINRNLKLASQLRATGTPLFVVGDQVINAAVPYETLKKAIADARAKS

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
163 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
166 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 0.82
Rhizosphere 98.35
Stem 0
Stem Tuber 0
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0213090 3300037312 Bacteria 1341
2 JGI24740J21852_10003441 3300001979 Bacteria 6959
3 JGI24740J21852_10034876 3300001979 Bacteria 1579
4 JGI24739J22299_10008395 3300001989 Bacteria 3857
5 JGI24737J22298_10006404 3300001990 Bacteria 4023
6 JGI24737J22298_10013258 3300001990 Bacteria 2684
7 JGI24735J21928_10003670 3300002067 Bacteria 5205
8 JGI24735J21928_10010863 3300002067 Bacteria 2893
9 JGI24735J21928_10011066 3300002067 Bacteria 2865
10 JGI24735J21928_10011759 3300002067 Bacteria 2772
11 JGI24735J21928_10029852 3300002067 Bacteria 1621
12 JGI24738J21930_10004376 3300002075 Bacteria 3467
13 rootH1_10069393 3300003323 Bacteria 1250
14 Ga0065715_10035602 3300005293 Unclassified 1488
15 Ga0065715_10259893 3300005293 Bacteria 1141
16 Ga0070658_10000630 3300005327 Bacteria 30439
17 Ga0070658_10040656 3300005327 Bacteria 3752
18 Ga0070658_10045495 3300005327 Bacteria 3549
19 Ga0070658_10085988 3300005327 Bacteria 2586
20 Ga0070658_10123150 3300005327 Bacteria 2156
21 Ga0070658_10148503 3300005327 Bacteria 1961
22 Ga0070658_10156226 3300005327 Bacteria 1912
23 Ga0070658_10207539 3300005327 Bacteria 1654
24 Ga0070676_10000844 3300005328 Bacteria 15153
25 Ga0070683_100004208 3300005329 Bacteria 11798
26 Ga0070683_100032561 3300005329 Bacteria 4747
27 Ga0070683_100063728 3300005329 Bacteria 3430
28 Ga0070683_100279421 3300005329 Bacteria 1588
29 Ga0070670_100050234 3300005331 Bacteria 3584
30 Ga0070670_100091643 3300005331 Bacteria 2613
31 Ga0070670_100359228 3300005331 Bacteria 1280
32 Ga0068869_100013397 3300005334 Bacteria 5453
33 Ga0070666_10001869 3300005335 Bacteria 12812
34 Ga0070666_10090837 3300005335 Bacteria 2097
35 Ga0070680_100019606 3300005336 Bacteria 5363
36 Ga0070680_100102505 3300005336 Bacteria 2377
37 Ga0070680_100296193 3300005336 Bacteria 1371
38 Ga0070660_100000442 3300005339 Bacteria 27575
39 Ga0070660_100000852 3300005339 Bacteria 20293
40 Ga0070660_100003475 3300005339 Bacteria 10846
41 Ga0070660_100003993 3300005339 Bacteria 10189
42 Ga0070660_100024119 3300005339 Bacteria 4512
43 Ga0070660_100040467 3300005339 Bacteria 3547
44 Ga0070660_100061132 3300005339 Bacteria 2924
45 Ga0070660_100067751 3300005339 Bacteria 2781
46 Ga0070660_100598887 3300005339 Bacteria 921
47 Ga0070660_100606538 3300005339 Bacteria 915
48 Ga0070689_100047888 3300005340 Bacteria 3296
49 Ga0070689_100436739 3300005340 Bacteria 1112
50 Ga0070691_10001625 3300005341 Bacteria 9739
51 Ga0070691_10122167 3300005341 Bacteria 1312
52 Ga0070661_100002014 3300005344 Bacteria 14053
53 Ga0070661_100005153 3300005344 Bacteria 8998
54 Ga0070661_100011009 3300005344 Bacteria 6304
55 Ga0070661_100021787 3300005344 Bacteria 4583
56 Ga0070661_100243880 3300005344 Bacteria 1384
57 Ga0070692_10007131 3300005345 Bacteria 4906
58 Ga0070692_10051361 3300005345 Bacteria 2144
59 Ga0070668_100001624 3300005347 Bacteria 16261
60 Ga0070669_100028412 3300005353 Bacteria 4028
61 Ga0070669_100032257 3300005353 Bacteria 3784
62 Ga0070669_100095080 3300005353 Bacteria 2240
63 Ga0070675_100007674 3300005354 Bacteria 8351
64 Ga0070671_100080376 3300005355 Bacteria 2726
65 Ga0070674_100005819 3300005356 Bacteria 7162
66 Ga0070673_100025408 3300005364 Bacteria 4359
67 Ga0070673_100040383 3300005364 Bacteria 3579
68 Ga0070673_100144502 3300005364 Bacteria 2010
69 Ga0070673_100155588 3300005364 Bacteria 1940
70 Ga0070659_100000562 3300005366 Bacteria 27149
71 Ga0070659_100001332 3300005366 Bacteria 17806
72 Ga0070659_100005925 3300005366 Bacteria 8811
73 Ga0070659_100021128 3300005366 Bacteria 4952
74 Ga0070659_100060147 3300005366 Bacteria 3001
75 Ga0070659_100093786 3300005366 Bacteria 2409
76 Ga0070659_100126816 3300005366 Bacteria 2071
77 Ga0070659_100351892 3300005366 Bacteria 1236
78 Ga0070667_100035587 3300005367 Bacteria 4172
79 Ga0070667_100051020 3300005367 Bacteria 3487
80 Ga0070667_100158924 3300005367 Bacteria 1989
81 Ga0070667_100176595 3300005367 Bacteria 1888
82 Ga0070667_100633021 3300005367 Bacteria 987
83 Ga0070714_100010052 3300005435 Bacteria 7465
84 Ga0070714_100038928 3300005435 Bacteria 4000
85 Ga0070714_100047071 3300005435 Bacteria 3662
86 Ga0070663_100001444 3300005455 Bacteria 13033
87 Ga0070663_100003322 3300005455 Bacteria 9274
88 Ga0070663_100054742 3300005455 Bacteria 2853
89 Ga0070663_100081880 3300005455 Bacteria 2374
90 Ga0070663_100166291 3300005455 Bacteria 1702
91 Ga0070663_100169404 3300005455 Bacteria 1687
92 Ga0070678_100398762 3300005456 Bacteria 1195
93 Ga0070662_100000517 3300005457 Bacteria 23238
94 Ga0070662_100009537 3300005457 Bacteria 6352
95 Ga0070662_100016343 3300005457 Bacteria 4982
96 Ga0070662_100214699 3300005457 Bacteria 1532
97 Ga0070662_100500004 3300005457 Bacteria 1014
98 Ga0070662_100640914 3300005457 Unclassified 896
99 Ga0070681_10006712 3300005458 Bacteria 11197
100 Ga0070681_10027941 3300005458 Bacteria 5671
101 Ga0070681_10118837 3300005458 Bacteria 2579
102 Ga0068867_100010532 3300005459 Bacteria 6524
103 Ga0070679_100075162 3300005530 Bacteria 3368
104 Ga0070679_100150717 3300005530 Bacteria 2302
105 Ga0070684_100005274 3300005535 Bacteria 9890
106 Ga0070684_100164680 3300005535 Bacteria 2012
107 Ga0068853_100002369 3300005539 Bacteria 14090
108 Ga0068853_100013398 3300005539 Bacteria 6694
109 Ga0068853_100086401 3300005539 Bacteria 2751
110 Ga0068853_100087893 3300005539 Bacteria 2728
111 Ga0068853_100112273 3300005539 Bacteria 2422
112 Ga0070672_100044303 3300005543 Bacteria 3435
113 Ga0070672_100058024 3300005543 Bacteria 3040
114 Ga0070695_100124620 3300005545 Bacteria 1768
115 Ga0070696_100020697 3300005546 Bacteria 4458
116 Ga0070693_100000698 3300005547 Bacteria 14813
117 Ga0068855_100000860 3300005563 Bacteria 37683
118 Ga0068855_100001245 3300005563 Bacteria 31618
119 Ga0068855_100006498 3300005563 Bacteria 14216
120 Ga0068855_100020508 3300005563 Bacteria 7925
121 Ga0068855_100095169 3300005563 Bacteria 3433
122 Ga0068855_100170389 3300005563 Bacteria 2466
123 Ga0068855_100213355 3300005563 Bacteria 2168
124 Ga0070664_100000609 3300005564 Bacteria 27376
125 Ga0070664_100019308 3300005564 Bacteria 5607
126 Ga0070664_100048348 3300005564 Bacteria 3595
127 Ga0070664_100065197 3300005564 Bacteria 3107
128 Ga0070664_100107333 3300005564 Bacteria 2434
129 Ga0070664_100232361 3300005564 Unclassified 1653
130 Ga0070664_100415589 3300005564 Bacteria 1231
131 Ga0068857_100010802 3300005577 Bacteria 7948
132 Ga0068857_100049166 3300005577 Bacteria 3742
133 Ga0068857_100091135 3300005577 Bacteria 2728
134 Ga0068857_100244236 3300005577 Bacteria 1644
135 Ga0068854_100004546 3300005578 Bacteria 8752
136 Ga0068854_100017678 3300005578 Bacteria 4775
137 Ga0068854_100021815 3300005578 Bacteria 4352
138 Ga0068854_100035667 3300005578 Bacteria 3483
139 Ga0068854_100067295 3300005578 Bacteria 2609
140 Ga0068856_100001106 3300005614 Bacteria 28451
141 Ga0068856_100013686 3300005614 Bacteria 7844
142 Ga0068856_100021818 3300005614 Bacteria 6223
143 Ga0068856_100073208 3300005614 Bacteria 3393
144 Ga0068856_100208385 3300005614 Bacteria 1970
145 Ga0068856_100225925 3300005614 Bacteria 1887
146 Ga0068856_100281138 3300005614 Unclassified 1681
147 Ga0068856_100334806 3300005614 Bacteria 1531
148 Ga0068856_100534295 3300005614 Bacteria 1194
149 Ga0068852_100000738 3300005616 Bacteria 21461
150 Ga0068852_100003209 3300005616 Bacteria 11419
151 Ga0068852_100010498 3300005616 Bacteria 6925
152 Ga0068852_100016299 3300005616 Bacteria 5789
153 Ga0068852_100028155 3300005616 Bacteria 4594
154 Ga0068852_100071064 3300005616 Bacteria 3055
155 Ga0068852_100471572 3300005616 Bacteria 1246
156 Ga0068859_100004262 3300005617 Bacteria 14606
157 Ga0068859_100052942 3300005617 Bacteria 4082
158 Ga0068859_100113219 3300005617 Bacteria 2777
159 Ga0068859_100644527 3300005617 Bacteria 1151
160 Ga0068864_100037532 3300005618 Bacteria 4135
161 Ga0068866_10010258 3300005718 Bacteria 4011
162 Ga0068866_10122142 3300005718 Bacteria 1469
163 Ga0068851_10009840 3300005834 Bacteria 4453
164 Ga0068863_100024184 3300005841 Bacteria 5794
165 Ga0068863_100034262 3300005841 Bacteria 4837
166 Ga0068863_100277740 3300005841 Bacteria 1622
167 Ga0068863_100355262 3300005841 Unclassified 1428
168 Ga0068863_100503974 3300005841 Bacteria 1192
169 Ga0068858_100005310 3300005842 Bacteria 12630
170 Ga0068858_100033191 3300005842 Bacteria 4792
171 Ga0068858_100460359 3300005842 Unclassified 1226
172 Ga0068860_100006525 3300005843 Bacteria 11714
173 Ga0068860_100022168 3300005843 Bacteria 6148
174 Ga0068860_100022692 3300005843 Bacteria 6067
175 Ga0068860_100103217 3300005843 Bacteria 2721
176 Ga0068860_100147886 3300005843 Bacteria 2261
177 Ga0068860_100665969 3300005843 Unclassified 1049
178 Ga0068862_100005046 3300005844 Bacteria 11103
179 Ga0068862_100018767 3300005844 Bacteria 5763
180 Ga0068862_100048971 3300005844 Bacteria 3608
181 Ga0068862_100109489 3300005844 Bacteria 2423
182 Ga0097621_100048916 3300006237 Bacteria 3433
183 Ga0097621_100090679 3300006237 Bacteria 2558
184 Ga0097621_100154520 3300006237 Bacteria 1969
185 Ga0068871_100044110 3300006358 Bacteria 3584
186 Ga0075428_100087492 3300006844 Bacteria 3399
187 Ga0075428_100353252 3300006844 Bacteria 1578
188 Ga0075433_10005530 3300006852 Bacteria 9921
189 Ga0068865_100066735 3300006881 Bacteria 2539
190 Ga0097620_100004262 3300006931 Bacteria 14606
191 Ga0097620_100052938 3300006931 Bacteria 4082
192 Ga0097620_100113220 3300006931 Bacteria 2777
193 Ga0097620_100644530 3300006931 Bacteria 1151
194 Ga0105240_10010468 3300009093 Bacteria 13036
195 Ga0105240_10047593 3300009093 Bacteria 5426
196 Ga0111539_10021300 3300009094 Bacteria 7982
197 Ga0111539_10247971 3300009094 Bacteria 2073
198 Ga0114129_10149838 3300009147 Bacteria 3193
199 Ga0105243_10892249 3300009148 Bacteria 884
200 Ga0105241_10172870 3300009174 Bacteria 1786
201 Ga0105241_10186850 3300009174 Bacteria 1723
202 Ga0105242_10111211 3300009176 Bacteria 2335
203 Ga0105248_10003929 3300009177 Bacteria 16433
204 Ga0105248_10013316 3300009177 Bacteria 9053
205 Ga0105248_10077795 3300009177 Bacteria 3729
206 Ga0105248_10629299 3300009177 Bacteria 1211
207 Ga0105237_10024621 3300009545 Bacteria 6155
208 Ga0105237_10340239 3300009545 Bacteria 1505
209 Ga0105238_10018345 3300009551 Bacteria 7121
210 Ga0105238_10032686 3300009551 Bacteria 5295
211 Ga0105238_10482333 3300009551 Bacteria 1239
212 Ga0105249_10045875 3300009553 Bacteria 3977
213 Ga0105249_10111142 3300009553 Bacteria 2591
214 Ga0105249_10327323 3300009553 Bacteria 1545
215 Ga0105239_10039727 3300010375 Bacteria 5155
216 Ga0105239_10106732 3300010375 Bacteria 3102
217 Ga0105239_10220845 3300010375 Bacteria 2125
218 Ga0105246_10129197 3300011119 Unclassified 1884
219 Ga0157373_10019515 3300013100 Bacteria 4932
220 Ga0157373_10019667 3300013100 Bacteria 4912
221 Ga0157373_10052548 3300013100 Bacteria 2899
222 Ga0157373_10080440 3300013100 Bacteria 2298
223 Ga0157373_10246038 3300013100 Bacteria 1264
224 Ga0157371_10002006 3300013102 Bacteria 20133
225 Ga0157371_10003298 3300013102 Bacteria 14771
226 Ga0157371_10077595 3300013102 Bacteria 2352
227 Ga0157371_10153199 3300013102 Bacteria 1644
228 Ga0157370_10020968 3300013104 Bacteria 6517
229 Ga0157370_10026825 3300013104 Bacteria 5683
230 Ga0157370_10035761 3300013104 Bacteria 4825
231 Ga0157370_10236549 3300013104 Bacteria 1690
232 Ga0157370_10347223 3300013104 Bacteria 1368
233 Ga0157370_10434068 3300013104 Bacteria 1208
234 Ga0157370_10594021 3300013104 Bacteria 1014
235 Ga0157370_10761185 3300013104 Bacteria 882
236 Ga0157369_10000213 3300013105 Bacteria 80715
237 Ga0157369_10026269 3300013105 Bacteria 6461
238 Ga0157369_10032758 3300013105 Bacteria 5711
239 Ga0157369_10064308 3300013105 Bacteria 3951
240 Ga0157369_10064372 3300013105 Bacteria 3949
241 Ga0157369_10081026 3300013105 Bacteria 3474
242 Ga0157369_10195922 3300013105 Bacteria 2122
243 Ga0157372_10007219 3300013307 Bacteria 11830
244 Ga0157372_10137707 3300013307 Bacteria 2812
245 Ga0157372_10279675 3300013307 Unclassified 1940
246 Ga0157372_10355401 3300013307 Bacteria 1707
247 Ga0157372_10760430 3300013307 Bacteria 1126
248 Ga0157375_10115659 3300013308 Bacteria 2785
249 Ga0157375_10279009 3300013308 Bacteria 1834
250 Ga0163163_10019596 3300014325 Bacteria 6354
251 Ga0163163_10029533 3300014325 Bacteria 5275
252 Ga0163163_10034454 3300014325 Bacteria 4904
253 Ga0157377_10032193 3300014745 Bacteria 2854
254 Ga0157377_10153415 3300014745 Bacteria 1426
255 Ga0157379_10064767 3300014968 Bacteria 3266
256 Ga0157379_10140765 3300014968 Bacteria 2175
257 Ga0157379_10779418 3300014968 Bacteria 901
258 Ga0157376_10008878 3300014969 Bacteria 7275
259 Ga0163161_10036353 3300017792 Bacteria 3527
260 Ga0163161_10363566 3300017792 Bacteria 1153
261 Ga0213875_10002686 3300021388 Bacteria 10496
262 Ga0224712_10006016 3300022467 Bacteria 3428
263 Ga0207697_10042232 3300025315 Bacteria 1873
264 Ga0207697_10046998 3300025315 Bacteria 1779
265 Ga0207656_10189642 3300025321 Bacteria 989
266 Ga0207642_10158414 3300025899 Bacteria 1213
267 Ga0207642_10342355 3300025899 Bacteria 879
268 Ga0207688_10124724 3300025901 Bacteria 1505
269 Ga0207680_10007304 3300025903 Bacteria 5378
270 Ga0207680_10292101 3300025903 Bacteria 1135
271 Ga0207647_10001074 3300025904 Bacteria 21074
272 Ga0207647_10007658 3300025904 Bacteria 7783
273 Ga0207647_10010181 3300025904 Bacteria 6646
274 Ga0207647_10028550 3300025904 Bacteria 3621
275 Ga0207647_10037564 3300025904 Bacteria 3069
276 Ga0207647_10061924 3300025904 Bacteria 2281
277 Ga0207647_10136350 3300025904 Bacteria 1440
278 Ga0207647_10139118 3300025904 Bacteria 1423
279 Ga0207645_10002872 3300025907 Bacteria 13336
280 Ga0207645_10021417 3300025907 Bacteria 4215
281 Ga0207645_10058455 3300025907 Bacteria 2462
282 Ga0207705_10001214 3300025909 Bacteria 20873
283 Ga0207705_10002368 3300025909 Bacteria 14572
284 Ga0207705_10017404 3300025909 Bacteria 5148
285 Ga0207705_10020215 3300025909 Bacteria 4762
286 Ga0207705_10020627 3300025909 Bacteria 4705
287 Ga0207705_10024090 3300025909 Bacteria 4343
288 Ga0207705_10030128 3300025909 Bacteria 3870
289 Ga0207705_10059327 3300025909 Bacteria 2761
290 Ga0207705_10099561 3300025909 Bacteria 2137
291 Ga0207705_10129899 3300025909 Unclassified 1874
292 Ga0207705_10153741 3300025909 Bacteria 1725
293 Ga0207705_10167832 3300025909 Bacteria 1651
294 Ga0207705_10232687 3300025909 Bacteria 1402
295 Ga0207705_10288038 3300025909 Bacteria 1258
296 Ga0207654_10027334 3300025911 Bacteria 3100
297 Ga0207707_10008385 3300025912 Bacteria 8968
298 Ga0207695_10013682 3300025913 Bacteria 9659
299 Ga0207695_10017532 3300025913 Bacteria 8328
300 Ga0207671_10054465 3300025914 Bacteria 2964
301 Ga0207660_10004911 3300025917 Bacteria 8709
302 Ga0207660_10210578 3300025917 Bacteria 1522
303 Ga0207662_10138279 3300025918 Bacteria 1541
304 Ga0207657_10001247 3300025919 Bacteria 27200
305 Ga0207657_10002236 3300025919 Bacteria 20990
306 Ga0207657_10002430 3300025919 Bacteria 20114
307 Ga0207657_10003232 3300025919 Bacteria 17438
308 Ga0207657_10010524 3300025919 Bacteria 9224
309 Ga0207657_10015442 3300025919 Bacteria 7398
310 Ga0207657_10018639 3300025919 Bacteria 6617
311 Ga0207657_10020641 3300025919 Bacteria 6220
312 Ga0207657_10028856 3300025919 Bacteria 5056
313 Ga0207657_10036391 3300025919 Bacteria 4406
314 Ga0207657_10331216 3300025919 Bacteria 1202
315 Ga0207649_10000609 3300025920 Bacteria 24164
316 Ga0207649_10000647 3300025920 Bacteria 23229
317 Ga0207649_10007796 3300025920 Bacteria 5824
318 Ga0207649_10008776 3300025920 Bacteria 5517
319 Ga0207649_10020707 3300025920 Bacteria 3774
320 Ga0207649_10027575 3300025920 Bacteria 3334
321 Ga0207649_10029742 3300025920 Bacteria 3228
322 Ga0207649_10089167 3300025920 Bacteria 2016
323 Ga0207649_10658121 3300025920 Bacteria 810
324 Ga0207652_10088360 3300025921 Bacteria 2719
325 Ga0207681_10022979 3300025923 Bacteria 3982
326 Ga0207681_10094032 3300025923 Bacteria 2147
327 Ga0207681_10199614 3300025923 Bacteria 1535
328 Ga0207694_10002362 3300025924 Bacteria 15426
329 Ga0207650_10008694 3300025925 Bacteria 6932
330 Ga0207650_10316094 3300025925 Bacteria 1278
331 Ga0207659_10013978 3300025926 Bacteria 5165
332 Ga0207664_10083139 3300025929 Bacteria 2609
333 Ga0207664_10100330 3300025929 Bacteria 2390
334 Ga0207644_10038322 3300025931 Bacteria 3376
335 Ga0207690_10000614 3300025932 Bacteria 23026
336 Ga0207690_10004774 3300025932 Bacteria 7992
337 Ga0207690_10005086 3300025932 Bacteria 7768
338 Ga0207690_10020996 3300025932 Bacteria 4045
339 Ga0207690_10024846 3300025932 Bacteria 3756
340 Ga0207690_10041290 3300025932 Bacteria 3022
341 Ga0207690_10062818 3300025932 Bacteria 2530
342 Ga0207690_10070101 3300025932 Bacteria 2414
343 Ga0207690_10200781 3300025932 Bacteria 1514
344 Ga0207690_10489928 3300025932 Bacteria 993
345 Ga0207706_10000862 3300025933 Bacteria 31208
346 Ga0207706_10007589 3300025933 Bacteria 10033
347 Ga0207706_10024926 3300025933 Bacteria 5362
348 Ga0207706_10033765 3300025933 Bacteria 4553
349 Ga0207706_10116236 3300025933 Bacteria 2353
350 Ga0207669_10004190 3300025937 Bacteria 6322
351 Ga0207704_10014589 3300025938 Bacteria 3972
352 Ga0207691_10012508 3300025940 Bacteria 8136
353 Ga0207691_10116513 3300025940 Bacteria 2371
354 Ga0207691_10146298 3300025940 Bacteria 2080
355 Ga0207691_10215694 3300025940 Bacteria 1665
356 Ga0207691_10357101 3300025940 Bacteria 1250
357 Ga0207711_10001010 3300025941 Bacteria 26975
358 Ga0207711_10005718 3300025941 Bacteria 10492
359 Ga0207711_10314175 3300025941 Bacteria 1447
360 Ga0207689_10147227 3300025942 Bacteria 1940
361 Ga0207661_10024940 3300025944 Bacteria 4540
362 Ga0207661_10288568 3300025944 Bacteria 1468
363 Ga0207679_10000410 3300025945 Bacteria 30698
364 Ga0207679_10004536 3300025945 Bacteria 8651
365 Ga0207679_10004905 3300025945 Bacteria 8340
366 Ga0207679_10025323 3300025945 Bacteria 4078
367 Ga0207679_10034412 3300025945 Bacteria 3574
368 Ga0207679_10050055 3300025945 Bacteria 3051
369 Ga0207679_10314650 3300025945 Unclassified 1354
370 Ga0207667_10010674 3300025949 Bacteria 10720
371 Ga0207667_10017086 3300025949 Bacteria 8181
372 Ga0207667_10018840 3300025949 Bacteria 7728
373 Ga0207667_10111446 3300025949 Bacteria 2822
374 Ga0207667_10233779 3300025949 Bacteria 1882
375 Ga0207651_10055442 3300025960 Bacteria 2722
376 Ga0207651_10182940 3300025960 Bacteria 1664
377 Ga0207712_10001750 3300025961 Bacteria 14499
378 Ga0207712_10110152 3300025961 Bacteria 2064
379 Ga0207712_10761407 3300025961 Unclassified 849
380 Ga0207668_10000281 3300025972 Bacteria 33444
381 Ga0207668_10204772 3300025972 Bacteria 1574
382 Ga0207640_10004228 3300025981 Bacteria 7768
383 Ga0207640_10013237 3300025981 Bacteria 4723
384 Ga0207640_10023817 3300025981 Bacteria 3685
385 Ga0207640_10024044 3300025981 Bacteria 3670
386 Ga0207640_10102653 3300025981 Bacteria 2009
387 Ga0207640_10117933 3300025981 Bacteria 1895
388 Ga0207658_10006330 3300025986 Bacteria 8083
389 Ga0207658_10030150 3300025986 Bacteria 3838
390 Ga0207658_10062898 3300025986 Bacteria 2779
391 Ga0207658_10528371 3300025986 Bacteria 1053
392 Ga0207677_10249592 3300026023 Bacteria 1440
393 Ga0207639_10000559 3300026041 Bacteria 25570
394 Ga0207639_10000810 3300026041 Bacteria 21238
395 Ga0207639_10097795 3300026041 Bacteria 2364
396 Ga0207639_10122256 3300026041 Bacteria 2140
397 Ga0207678_10001544 3300026067 Bacteria 21123
398 Ga0207678_10004968 3300026067 Bacteria 11935
399 Ga0207678_10008333 3300026067 Bacteria 9137
400 Ga0207678_10028774 3300026067 Bacteria 4851
401 Ga0207678_10030479 3300026067 Bacteria 4708
402 Ga0207678_10036802 3300026067 Bacteria 4260
403 Ga0207678_10037554 3300026067 Bacteria 4212
404 Ga0207678_10060426 3300026067 Bacteria 3260
405 Ga0207702_10001481 3300026078 Bacteria 23260
406 Ga0207702_10004991 3300026078 Bacteria 11657
407 Ga0207702_10016055 3300026078 Bacteria 6200
408 Ga0207702_10029543 3300026078 Bacteria 4562
409 Ga0207702_10056453 3300026078 Bacteria 3334
410 Ga0207702_10066637 3300026078 Bacteria 3087
411 Ga0207702_10071331 3300026078 Bacteria 2991
412 Ga0207702_10315225 3300026078 Bacteria 1488
413 Ga0207641_10027877 3300026088 Bacteria 4665
414 Ga0207641_10117368 3300026088 Bacteria 2369
415 Ga0207648_10014655 3300026089 Bacteria 7238
416 Ga0207676_10083926 3300026095 Bacteria 2595
417 Ga0207674_10002478 3300026116 Bacteria 23285
418 Ga0207674_10003401 3300026116 Bacteria 19514
419 Ga0207674_10015606 3300026116 Bacteria 8338
420 Ga0207674_10142777 3300026116 Bacteria 2353
421 Ga0207674_10182513 3300026116 Bacteria 2050
422 Ga0207674_10187407 3300026116 Bacteria 2019
423 Ga0207683_10014890 3300026121 Bacteria 6620
424 Ga0207683_10048317 3300026121 Bacteria 3726
425 Ga0207683_10063547 3300026121 Bacteria 3252
426 Ga0207698_10002979 3300026142 Bacteria 10149
427 Ga0207698_10010517 3300026142 Bacteria 5953
428 Ga0207698_10030678 3300026142 Bacteria 3870
429 Ga0207698_10032434 3300026142 Bacteria 3784
430 Ga0207698_10098883 3300026142 Bacteria 2412
431 Ga0207698_10138579 3300026142 Bacteria 2092
432 Ga0207698_10421929 3300026142 Bacteria 1280
433 Ga0268266_10030760 3300028379 Bacteria 4560
434 Ga0268265_10008286 3300028380 Bacteria 7021
435 Ga0268265_10008905 3300028380 Bacteria 6783
436 Ga0268265_10020028 3300028380 Bacteria 4662
437 Ga0268265_10049567 3300028380 Bacteria 3159
438 Ga0268265_10571021 3300028380 Viruses 1076
439 Ga0268265_10886885 3300028380 Bacteria 875
440 Ga0268264_10001669 3300028381 Bacteria 20437
441 Ga0268264_10002107 3300028381 Bacteria 17736
442 Ga0268264_10088773 3300028381 Bacteria 2661
443 Ga0268264_10103969 3300028381 Bacteria 2475
444 Ga0268264_10884468 3300028381 Bacteria 896
445 Ga0316182_1064693 3300030745 Bacteria 1923
446 Ga0307513_10300636 3300031456 Bacteria 1372
447 Ga0307408_100056804 3300031548 Bacteria 2839
448 Ga0307408_100488907 3300031548 Unclassified 1075
449 Ga0307405_10097566 3300031731 Bacteria 1963
450 Ga0307413_10242292 3300031824 Bacteria 1332
451 Ga0307410_10000497 3300031852 Bacteria 15987
452 Ga0307410_10004834 3300031852 Bacteria 7038
453 Ga0307410_10548036 3300031852 Bacteria 958
454 Ga0307406_10034965 3300031901 Bacteria 3086
455 Ga0307407_10060161 3300031903 Bacteria 2216
456 Ga0307407_10081135 3300031903 Unclassified 1962
457 Ga0307412_10140319 3300031911 Bacteria 1769
458 Ga0307412_10172572 3300031911 Bacteria 1618
459 Ga0307409_100005023 3300031995 Bacteria 7537
460 Ga0307409_100023796 3300031995 Bacteria 4254
461 Ga0307409_100056326 3300031995 Bacteria 3039
462 Ga0307416_100207293 3300032002 Bacteria 1866
463 Ga0307416_100694729 3300032002 Bacteria 1106
464 Ga0307416_100839658 3300032002 Bacteria 1016
465 Ga0307414_10043247 3300032004 Bacteria 3067
466 Ga0307414_10203662 3300032004 Bacteria 1612
467 Ga0307411_10010086 3300032005 Bacteria 5014
468 Ga0307411_10014648 3300032005 Bacteria 4372
469 Ga0307411_10030736 3300032005 Bacteria 3296
470 Ga0307411_10223975 3300032005 Bacteria 1461
471 Ga0307415_100048132 3300032126 Bacteria 2875
472 Ga0307415_100088732 3300032126 Bacteria 2232
473 Ga0307415_100247511 3300032126 Bacteria 1446
474 Ga0307415_100268999 3300032126 Bacteria 1395
475 Ga0307415_100383596 3300032126 Bacteria 1194
476 Ga0373959_0020634 3300034820 Bacteria 1258
477 Ga0373931_0006935 3300035691 Bacteria 5330
478 Ga0373935_0411513 3300035692 Bacteria 972
479 Ga0373927_0044621 3300035695 Bacteria 2868
480 Ga0373947_0020526 3300035725 Bacteria 3815
481 Ga0395899_0002597 3300037312 Bacteria 14556
482 Ga0395899_0012036 3300037312 Bacteria 6629
483 Ga0395899_0012049 3300037312 Bacteria 6627
484 Ga0395899_0145790 3300037312 Bacteria 1681
485 Ga0395899_0172296 3300037312 Bacteria 1523
486 Ga0395899_0172852 3300037312 Bacteria 1520
487 Ga0395899_0184350 3300037312 Bacteria 1463
488 Ga0395899_0188507 3300037312 Bacteria 1444
489 Ga0395899_0263291 3300037312 Bacteria 1178
490 Ga0395900_0000777 3300037418 Bacteria 42484
491 Ga0395900_0003388 3300037418 Bacteria 17216
492 Ga0395900_0006010 3300037418 Bacteria 12663
493 Ga0395900_0008568 3300037418 Bacteria 10513
494 Ga0395900_0017042 3300037418 Bacteria 7417
495 Ga0395900_0027310 3300037418 Bacteria 5845
496 Ga0395900_0039722 3300037418 Bacteria 4848
497 Ga0395900_0045115 3300037418 Bacteria 4540
498 Ga0395900_0098367 3300037418 Bacteria 3006
499 Ga0395900_0142029 3300037418 Bacteria 2458
500 Ga0395900_0159697 3300037418 Bacteria 2300
501 Ga0395900_0214946 3300037418 Bacteria 1940
502 Ga0395900_0287889 3300037418 Bacteria 1632
503 Ga0395900_0353482 3300037418 Bacteria 1442
504 Ga0395900_0353494 3300037418 Bacteria 1442
505 Ga0395898_0016194 3300037466 Bacteria 7635
506 Ga0395898_0016372 3300037466 Bacteria 7587
507 Ga0395898_0021176 3300037466 Bacteria 6596
508 Ga0395898_0136755 3300037466 Bacteria 2346
509 Ga0395898_0217299 3300037466 Bacteria 1823
510 Ga0395898_0284049 3300037466 Bacteria 1579
511 Ga0395898_0335171 3300037466 Bacteria 1442
512 Ga0395898_0340154 3300037466 Bacteria 1431
513 Ga0395898_0403397 3300037466 Bacteria 1303
514 Ga0395898_0442312 3300037466 Bacteria 1238
515 Ga0395898_0454356 3300037466 Bacteria 1220
516 Ga0395898_0472188 3300037466 Bacteria 1194
517 Ga0395898_0561431 3300037466 Unclassified 1084
518 Ga0395898_0838705 3300037466 Unclassified 859
519 Ga0395898_1069160 3300037466 Unclassified 741
520 Ga0395905_0001949 3300037471 Bacteria 23650
521 Ga0395905_0010016 3300037471 Bacteria 9238
522 Ga0395905_0038240 3300037471 Bacteria 4502
523 Ga0395905_0047223 3300037471 Bacteria 4036
524 Ga0395905_0048004 3300037471 Bacteria 4001
525 Ga0395905_0208844 3300037471 Bacteria 1830
526 Ga0395905_0322114 3300037471 Bacteria 1435
527 Ga0395905_0385345 3300037471 Bacteria 1296
528 Ga0395905_0821345 3300037471 Bacteria 832
529 Ga0436364_0920172 3300037853 Bacteria 27253
530 Ga0395901_0000260 3300038443 Bacteria 66084
531 Ga0395901_0000440 3300038443 Bacteria 48641
532 Ga0395901_0009148 3300038443 Bacteria 10034
533 Ga0395901_0019723 3300038443 Bacteria 6893
534 Ga0395901_0021910 3300038443 Bacteria 6549
535 Ga0395901_0030900 3300038443 Bacteria 5519
536 Ga0395901_0038690 3300038443 Bacteria 4934
537 Ga0395901_0043715 3300038443 Bacteria 4646
538 Ga0395901_0054623 3300038443 Bacteria 4151
539 Ga0395901_0181580 3300038443 Bacteria 2207
540 Ga0395901_0182007 3300038443 Bacteria 2204
541 Ga0395901_0204780 3300038443 Bacteria 2067
542 Ga0395901_0210770 3300038443 Bacteria 2034
543 Ga0395901_0303054 3300038443 Bacteria 1656
544 Ga0395901_0324728 3300038443 Bacteria 1592
545 Ga0395901_0489369 3300038443 Bacteria 1253
546 Ga0395901_0489397 3300038443 Bacteria 1253
547 Ga0395901_1140465 3300038443 Bacteria 748
548 Ga0439436_0031558 3300041404 Bacteria 1538
549 Ga0439439_0103608 3300041406 Bacteria 785
550 Ga0439455_0037464 3300042012 Bacteria 1230
551 Ga0450898_020400 3300042134 Bacteria 1161
552 Ga0450905_003095 3300042142 Bacteria 2172
553 Ga0466969_0007721 3300044656 Bacteria 5719
554 Ga0466966_0004035 3300044684 Bacteria 9695
555 Ga0466961_0008379 3300044693 Bacteria 6583
556 Ga0466963_0008103 3300044694 Bacteria 6292
557 Ga0466963_0011384 3300044694 Bacteria 5416
558 Ga0466963_0013712 3300044694 Bacteria 4984
559 Ga0466963_0032077 3300044694 Bacteria 3399
560 Ga0466963_0041559 3300044694 Bacteria 3016
561 Ga0466963_0049002 3300044694 Bacteria 2792
562 Ga0466964_0053997 3300044706 Bacteria 1655
563 Ga0466971_0015072 3300044719 Bacteria 3400
564 Ga0466971_0030755 3300044719 Bacteria 2403
565 Ga0466970_0001410 3300044765 Bacteria 11620
566 Ga0466957_0000119 3300044842 Bacteria 32814
567 Ga0466957_0008553 3300044842 Bacteria 5825
568 Ga0466957_0013148 3300044842 Bacteria 4799
569 Ga0466957_0021041 3300044842 Bacteria 3840
570 Ga0466957_0025502 3300044842 Bacteria 3505
571 Ga0466957_0028622 3300044842 Bacteria 3318
572 Ga0466957_0100659 3300044842 Bacteria 1821
573 Ga0466958_0001880 3300045836 Bacteria 10259
574 Ga0466958_0010624 3300045836 Bacteria 5161
575 Ga0466958_0014058 3300045836 Bacteria 4566
576 Ga0466967_0012381 3300045976 Bacteria 6521
577 Ga0466967_0014248 3300045976 Bacteria 6185
578 Ga0466967_0043397 3300045976 Bacteria 3893
579 Ga0466967_0044392 3300045976 Bacteria 3855
580 Ga0466967_0100831 3300045976 Bacteria 2638
581 Ga0466967_0116142 3300045976 Bacteria 2465
582 Ga0466967_0177754 3300045976 Bacteria 2005
583 Ga0466967_0346008 3300045976 Bacteria 1438
584 Ga0466967_0380745 3300045976 Bacteria 1370
585 Ga0466967_0576987 3300045976 Bacteria 1108
586 Ga0466967_0596897 3300045976 Bacteria 1090
587 Ga0466967_0940675 3300045976 Bacteria 860
588 Ga0495668_0004735 3300046616 Bacteria 9531
589 Ga0495625_0142714 3300046660 Bacteria 1615
590 Ga0495669_0023707 3300046684 Bacteria 2673
591 Ga0495669_0025964 3300046684 Bacteria 2558
592 Ga0495677_0084672 3300047445 Bacteria 1191
593 Ga0496107_0424944 3300048910 Bacteria 988
594 Ga0496107_0463200 3300048910 Bacteria 941
595 Ga0496109_0228285 3300048912 Bacteria 1751
596 Ga0496109_0875459 3300048912 Unclassified 836
597 Ga0496112_0379706 3300048915 Bacteria 1354
598 Ga0501067_0067887 3300049583 Bacteria 1974
599 Ga0501068_0077224 3300049584 Bacteria 2039
600 Ga0501069_0087184 3300049585 Bacteria 1763
601 Ga0501070_0012968 3300049586 Bacteria 7025
602 nmdc:mga08y16_230136_c1 3300050511 Bacteria 1917
603 nmdc:mga0n895_76452_c1 3300050512 Bacteria 3329
604 nmdc:mga0a205_14292_c1 3300050515 Bacteria 7403
605 Ga0500658_0000023 3300053134 Bacteria 123176
606 Ga0466962_0005903 3300061719 Bacteria 5883
607 Ga0466962_0008845 3300061719 Bacteria 4826
608 Ga0395899_0213090
609 JGI24740J21852_10003441
610 JGI24740J21852_10034876
611 JGI24739J22299_10008395
612 JGI24737J22298_10006404
613 JGI24737J22298_10013258
614 JGI24735J21928_10003670
615 JGI24735J21928_10010863
616 JGI24735J21928_10011066
617 JGI24735J21928_10011759
618 JGI24735J21928_10029852
619 JGI24738J21930_10004376
620 rootH1_10069393
621 Ga0065715_10035602
622 Ga0065715_10259893
623 Ga0070658_10000630
624 Ga0070658_10040656
625 Ga0070658_10045495
626 Ga0070658_10085988
627 Ga0070658_10123150
628 Ga0070658_10148503
629 Ga0070658_10156226
630 Ga0070658_10207539
631 Ga0070676_10000844
632 Ga0070683_100004208
633 Ga0070683_100032561
634 Ga0070683_100063728
635 Ga0070683_100279421
636 Ga0070670_100050234
637 Ga0070670_100091643
638 Ga0070670_100359228
639 Ga0068869_100013397
640 Ga0070666_10001869
641 Ga0070666_10090837
642 Ga0070680_100019606
643 Ga0070680_100102505
644 Ga0070680_100296193
645 Ga0070660_100000442
646 Ga0070660_100000852
647 Ga0070660_100003475
648 Ga0070660_100003993
649 Ga0070660_100024119
650 Ga0070660_100040467
651 Ga0070660_100061132
652 Ga0070660_100067751
653 Ga0070660_100598887
654 Ga0070660_100606538
655 Ga0070689_100047888
656 Ga0070689_100436739
657 Ga0070691_10001625
658 Ga0070691_10122167
659 Ga0070661_100002014
660 Ga0070661_100005153
661 Ga0070661_100011009
662 Ga0070661_100021787
663 Ga0070661_100243880
664 Ga0070692_10007131
665 Ga0070692_10051361
666 Ga0070668_100001624
667 Ga0070669_100028412
668 Ga0070669_100032257
669 Ga0070669_100095080
670 Ga0070675_100007674
671 Ga0070671_100080376
672 Ga0070674_100005819
673 Ga0070673_100025408
674 Ga0070673_100040383
675 Ga0070673_100144502
676 Ga0070673_100155588
677 Ga0070659_100000562
678 Ga0070659_100001332
679 Ga0070659_100005925
680 Ga0070659_100021128
681 Ga0070659_100060147
682 Ga0070659_100093786
683 Ga0070659_100126816
684 Ga0070659_100351892
685 Ga0070667_100035587
686 Ga0070667_100051020
687 Ga0070667_100158924
688 Ga0070667_100176595
689 Ga0070667_100633021
690 Ga0070714_100010052
691 Ga0070714_100038928
692 Ga0070714_100047071
693 Ga0070663_100001444
694 Ga0070663_100003322
695 Ga0070663_100054742
696 Ga0070663_100081880
697 Ga0070663_100166291
698 Ga0070663_100169404
699 Ga0070678_100398762
700 Ga0070662_100000517
701 Ga0070662_100009537
702 Ga0070662_100016343
703 Ga0070662_100214699
704 Ga0070662_100500004
705 Ga0070662_100640914
706 Ga0070681_10006712
707 Ga0070681_10027941
708 Ga0070681_10118837
709 Ga0068867_100010532
710 Ga0070679_100075162
711 Ga0070679_100150717
712 Ga0070684_100005274
713 Ga0070684_100164680
714 Ga0068853_100002369
715 Ga0068853_100013398
716 Ga0068853_100086401
717 Ga0068853_100087893
718 Ga0068853_100112273
719 Ga0070672_100044303
720 Ga0070672_100058024
721 Ga0070695_100124620
722 Ga0070696_100020697
723 Ga0070693_100000698
724 Ga0068855_100000860
725 Ga0068855_100001245
726 Ga0068855_100006498
727 Ga0068855_100020508
728 Ga0068855_100095169
729 Ga0068855_100170389
730 Ga0068855_100213355
731 Ga0070664_100000609
732 Ga0070664_100019308
733 Ga0070664_100048348
734 Ga0070664_100065197
735 Ga0070664_100107333
736 Ga0070664_100232361
737 Ga0070664_100415589
738 Ga0068857_100010802
739 Ga0068857_100049166
740 Ga0068857_100091135
741 Ga0068857_100244236
742 Ga0068854_100004546
743 Ga0068854_100017678
744 Ga0068854_100021815
745 Ga0068854_100035667
746 Ga0068854_100067295
747 Ga0068856_100001106
748 Ga0068856_100013686
749 Ga0068856_100021818
750 Ga0068856_100073208
751 Ga0068856_100208385
752 Ga0068856_100225925
753 Ga0068856_100281138
754 Ga0068856_100334806
755 Ga0068856_100534295
756 Ga0068852_100000738
757 Ga0068852_100003209
758 Ga0068852_100010498
759 Ga0068852_100016299
760 Ga0068852_100028155
761 Ga0068852_100071064
762 Ga0068852_100471572
763 Ga0068859_100004262
764 Ga0068859_100052942
765 Ga0068859_100113219
766 Ga0068859_100644527
767 Ga0068864_100037532
768 Ga0068866_10010258
769 Ga0068866_10122142
770 Ga0068851_10009840
771 Ga0068863_100024184
772 Ga0068863_100034262
773 Ga0068863_100277740
774 Ga0068863_100355262
775 Ga0068863_100503974
776 Ga0068858_100005310
777 Ga0068858_100033191
778 Ga0068858_100460359
779 Ga0068860_100006525
780 Ga0068860_100022168
781 Ga0068860_100022692
782 Ga0068860_100103217
783 Ga0068860_100147886
784 Ga0068860_100665969
785 Ga0068862_100005046
786 Ga0068862_100018767
787 Ga0068862_100048971
788 Ga0068862_100109489
789 Ga0097621_100048916
790 Ga0097621_100090679
791 Ga0097621_100154520
792 Ga0068871_100044110
793 Ga0075428_100087492
794 Ga0075428_100353252
795 Ga0075433_10005530
796 Ga0068865_100066735
797 Ga0097620_100004262
798 Ga0097620_100052938
799 Ga0097620_100113220
800 Ga0097620_100644530
801 Ga0105240_10010468
802 Ga0105240_10047593
803 Ga0111539_10021300
804 Ga0111539_10247971
805 Ga0114129_10149838
806 Ga0105243_10892249
807 Ga0105241_10172870
808 Ga0105241_10186850
809 Ga0105242_10111211
810 Ga0105248_10003929
811 Ga0105248_10013316
812 Ga0105248_10077795
813 Ga0105248_10629299
814 Ga0105237_10024621
815 Ga0105237_10340239
816 Ga0105238_10018345
817 Ga0105238_10032686
818 Ga0105238_10482333
819 Ga0105249_10045875
820 Ga0105249_10111142
821 Ga0105249_10327323
822 Ga0105239_10039727
823 Ga0105239_10106732
824 Ga0105239_10220845
825 Ga0105246_10129197
826 Ga0157373_10019515
827 Ga0157373_10019667
828 Ga0157373_10052548
829 Ga0157373_10080440
830 Ga0157373_10246038
831 Ga0157371_10002006
832 Ga0157371_10003298
833 Ga0157371_10077595
834 Ga0157371_10153199
835 Ga0157370_10020968
836 Ga0157370_10026825
837 Ga0157370_10035761
838 Ga0157370_10236549
839 Ga0157370_10347223
840 Ga0157370_10434068
841 Ga0157370_10594021
842 Ga0157370_10761185
843 Ga0157369_10000213
844 Ga0157369_10026269
845 Ga0157369_10032758
846 Ga0157369_10064308
847 Ga0157369_10064372
848 Ga0157369_10081026
849 Ga0157369_10195922
850 Ga0157372_10007219
851 Ga0157372_10137707
852 Ga0157372_10279675
853 Ga0157372_10355401
854 Ga0157372_10760430
855 Ga0157375_10115659
856 Ga0157375_10279009
857 Ga0163163_10019596
858 Ga0163163_10029533
859 Ga0163163_10034454
860 Ga0157377_10032193
861 Ga0157377_10153415
862 Ga0157379_10064767
863 Ga0157379_10140765
864 Ga0157379_10779418
865 Ga0157376_10008878
866 Ga0163161_10036353
867 Ga0163161_10363566
868 Ga0213875_10002686
869 Ga0224712_10006016
870 Ga0207697_10042232
871 Ga0207697_10046998
872 Ga0207656_10189642
873 Ga0207642_10158414
874 Ga0207642_10342355
875 Ga0207688_10124724
876 Ga0207680_10007304
877 Ga0207680_10292101
878 Ga0207647_10001074
879 Ga0207647_10007658
880 Ga0207647_10010181
881 Ga0207647_10028550
882 Ga0207647_10037564
883 Ga0207647_10061924
884 Ga0207647_10136350
885 Ga0207647_10139118
886 Ga0207645_10002872
887 Ga0207645_10021417
888 Ga0207645_10058455
889 Ga0207705_10001214
890 Ga0207705_10002368
891 Ga0207705_10017404
892 Ga0207705_10020215
893 Ga0207705_10020627
894 Ga0207705_10024090
895 Ga0207705_10030128
896 Ga0207705_10059327
897 Ga0207705_10099561
898 Ga0207705_10129899
899 Ga0207705_10153741
900 Ga0207705_10167832
901 Ga0207705_10232687
902 Ga0207705_10288038
903 Ga0207654_10027334
904 Ga0207707_10008385
905 Ga0207695_10013682
906 Ga0207695_10017532
907 Ga0207671_10054465
908 Ga0207660_10004911
909 Ga0207660_10210578
910 Ga0207662_10138279
911 Ga0207657_10001247
912 Ga0207657_10002236
913 Ga0207657_10002430
914 Ga0207657_10003232
915 Ga0207657_10010524
916 Ga0207657_10015442
917 Ga0207657_10018639
918 Ga0207657_10020641
919 Ga0207657_10028856
920 Ga0207657_10036391
921 Ga0207657_10331216
922 Ga0207649_10000609
923 Ga0207649_10000647
924 Ga0207649_10007796
925 Ga0207649_10008776
926 Ga0207649_10020707
927 Ga0207649_10027575
928 Ga0207649_10029742
929 Ga0207649_10089167
930 Ga0207649_10658121
931 Ga0207652_10088360
932 Ga0207681_10022979
933 Ga0207681_10094032
934 Ga0207681_10199614
935 Ga0207694_10002362
936 Ga0207650_10008694
937 Ga0207650_10316094
938 Ga0207659_10013978
939 Ga0207664_10083139
940 Ga0207664_10100330
941 Ga0207644_10038322
942 Ga0207690_10000614
943 Ga0207690_10004774
944 Ga0207690_10005086
945 Ga0207690_10020996
946 Ga0207690_10024846
947 Ga0207690_10041290
948 Ga0207690_10062818
949 Ga0207690_10070101
950 Ga0207690_10200781
951 Ga0207690_10489928
952 Ga0207706_10000862
953 Ga0207706_10007589
954 Ga0207706_10024926
955 Ga0207706_10033765
956 Ga0207706_10116236
957 Ga0207669_10004190
958 Ga0207704_10014589
959 Ga0207691_10012508
960 Ga0207691_10116513
961 Ga0207691_10146298
962 Ga0207691_10215694
963 Ga0207691_10357101
964 Ga0207711_10001010
965 Ga0207711_10005718
966 Ga0207711_10314175
967 Ga0207689_10147227
968 Ga0207661_10024940
969 Ga0207661_10288568
970 Ga0207679_10000410
971 Ga0207679_10004536
972 Ga0207679_10004905
973 Ga0207679_10025323
974 Ga0207679_10034412
975 Ga0207679_10050055
976 Ga0207679_10314650
977 Ga0207667_10010674
978 Ga0207667_10017086
979 Ga0207667_10018840
980 Ga0207667_10111446
981 Ga0207667_10233779
982 Ga0207651_10055442
983 Ga0207651_10182940
984 Ga0207712_10001750
985 Ga0207712_10110152
986 Ga0207712_10761407
987 Ga0207668_10000281
988 Ga0207668_10204772
989 Ga0207640_10004228
990 Ga0207640_10013237
991 Ga0207640_10023817
992 Ga0207640_10024044
993 Ga0207640_10102653
994 Ga0207640_10117933
995 Ga0207658_10006330
996 Ga0207658_10030150
997 Ga0207658_10062898
998 Ga0207658_10528371
999 Ga0207677_10249592
1000 Ga0207639_10000559
1001 Ga0207639_10000810
1002 Ga0207639_10097795
1003 Ga0207639_10122256
1004 Ga0207678_10001544
1005 Ga0207678_10004968
1006 Ga0207678_10008333
1007 Ga0207678_10028774
1008 Ga0207678_10030479
1009 Ga0207678_10036802
1010 Ga0207678_10037554
1011 Ga0207678_10060426
1012 Ga0207702_10001481
1013 Ga0207702_10004991
1014 Ga0207702_10016055
1015 Ga0207702_10029543
1016 Ga0207702_10056453
1017 Ga0207702_10066637
1018 Ga0207702_10071331
1019 Ga0207702_10315225
1020 Ga0207641_10027877
1021 Ga0207641_10117368
1022 Ga0207648_10014655
1023 Ga0207676_10083926
1024 Ga0207674_10002478
1025 Ga0207674_10003401
1026 Ga0207674_10015606
1027 Ga0207674_10142777
1028 Ga0207674_10182513
1029 Ga0207674_10187407
1030 Ga0207683_10014890
1031 Ga0207683_10048317
1032 Ga0207683_10063547
1033 Ga0207698_10002979
1034 Ga0207698_10010517
1035 Ga0207698_10030678
1036 Ga0207698_10032434
1037 Ga0207698_10098883
1038 Ga0207698_10138579
1039 Ga0207698_10421929
1040 Ga0268266_10030760
1041 Ga0268265_10008286
1042 Ga0268265_10008905
1043 Ga0268265_10020028
1044 Ga0268265_10049567
1045 Ga0268265_10571021
1046 Ga0268265_10886885
1047 Ga0268264_10001669
1048 Ga0268264_10002107
1049 Ga0268264_10088773
1050 Ga0268264_10103969
1051 Ga0268264_10884468
1052 Ga0316182_1064693
1053 Ga0307513_10300636
1054 Ga0307408_100056804
1055 Ga0307408_100488907
1056 Ga0307405_10097566
1057 Ga0307413_10242292
1058 Ga0307410_10000497
1059 Ga0307410_10004834
1060 Ga0307410_10548036
1061 Ga0307406_10034965
1062 Ga0307407_10060161
1063 Ga0307407_10081135
1064 Ga0307412_10140319
1065 Ga0307412_10172572
1066 Ga0307409_100005023
1067 Ga0307409_100023796
1068 Ga0307409_100056326
1069 Ga0307416_100207293
1070 Ga0307416_100694729
1071 Ga0307416_100839658
1072 Ga0307414_10043247
1073 Ga0307414_10203662
1074 Ga0307411_10010086
1075 Ga0307411_10014648
1076 Ga0307411_10030736
1077 Ga0307411_10223975
1078 Ga0307415_100048132
1079 Ga0307415_100088732
1080 Ga0307415_100247511
1081 Ga0307415_100268999
1082 Ga0307415_100383596
1083 Ga0373959_0020634
1084 Ga0373931_0006935
1085 Ga0373935_0411513
1086 Ga0373927_0044621
1087 Ga0373947_0020526
1088 Ga0395899_0002597
1089 Ga0395899_0012036
1090 Ga0395899_0012049
1091 Ga0395899_0145790
1092 Ga0395899_0172296
1093 Ga0395899_0172852
1094 Ga0395899_0184350
1095 Ga0395899_0188507
1096 Ga0395899_0263291
1097 Ga0395900_0000777
1098 Ga0395900_0003388
1099 Ga0395900_0006010
1100 Ga0395900_0008568
1101 Ga0395900_0017042
1102 Ga0395900_0027310
1103 Ga0395900_0039722
1104 Ga0395900_0045115
1105 Ga0395900_0098367
1106 Ga0395900_0142029
1107 Ga0395900_0159697
1108 Ga0395900_0214946
1109 Ga0395900_0287889
1110 Ga0395900_0353482
1111 Ga0395900_0353494
1112 Ga0395898_0016194
1113 Ga0395898_0016372
1114 Ga0395898_0021176
1115 Ga0395898_0136755
1116 Ga0395898_0217299
1117 Ga0395898_0284049
1118 Ga0395898_0335171
1119 Ga0395898_0340154
1120 Ga0395898_0403397
1121 Ga0395898_0442312
1122 Ga0395898_0454356
1123 Ga0395898_0472188
1124 Ga0395898_0561431
1125 Ga0395898_0838705
1126 Ga0395898_1069160
1127 Ga0395905_0001949
1128 Ga0395905_0010016
1129 Ga0395905_0038240
1130 Ga0395905_0047223
1131 Ga0395905_0048004
1132 Ga0395905_0208844
1133 Ga0395905_0322114
1134 Ga0395905_0385345
1135 Ga0395905_0821345
1136 Ga0436364_0920172
1137 Ga0395901_0000260
1138 Ga0395901_0000440
1139 Ga0395901_0009148
1140 Ga0395901_0019723
1141 Ga0395901_0021910
1142 Ga0395901_0030900
1143 Ga0395901_0038690
1144 Ga0395901_0043715
1145 Ga0395901_0054623
1146 Ga0395901_0181580
1147 Ga0395901_0182007
1148 Ga0395901_0204780
1149 Ga0395901_0210770
1150 Ga0395901_0303054
1151 Ga0395901_0324728
1152 Ga0395901_0489369
1153 Ga0395901_0489397
1154 Ga0395901_1140465
1155 Ga0439436_0031558
1156 Ga0439439_0103608
1157 Ga0439455_0037464
1158 Ga0450898_020400
1159 Ga0450905_003095
1160 Ga0466969_0007721
1161 Ga0466966_0004035
1162 Ga0466961_0008379
1163 Ga0466963_0008103
1164 Ga0466963_0011384
1165 Ga0466963_0013712
1166 Ga0466963_0032077
1167 Ga0466963_0041559
1168 Ga0466963_0049002
1169 Ga0466964_0053997
1170 Ga0466971_0015072
1171 Ga0466971_0030755
1172 Ga0466970_0001410
1173 Ga0466957_0000119
1174 Ga0466957_0008553
1175 Ga0466957_0013148
1176 Ga0466957_0021041
1177 Ga0466957_0025502
1178 Ga0466957_0028622
1179 Ga0466957_0100659
1180 Ga0466958_0001880
1181 Ga0466958_0010624
1182 Ga0466958_0014058
1183 Ga0466967_0012381
1184 Ga0466967_0014248
1185 Ga0466967_0043397
1186 Ga0466967_0044392
1187 Ga0466967_0100831
1188 Ga0466967_0116142
1189 Ga0466967_0177754
1190 Ga0466967_0346008
1191 Ga0466967_0380745
1192 Ga0466967_0576987
1193 Ga0466967_0596897
1194 Ga0466967_0940675
1195 Ga0495668_0004735
1196 Ga0495625_0142714
1197 Ga0495669_0023707
1198 Ga0495669_0025964
1199 Ga0495677_0084672
1200 Ga0496107_0424944
1201 Ga0496107_0463200
1202 Ga0496109_0228285
1203 Ga0496109_0875459
1204 Ga0496112_0379706
1205 Ga0501067_0067887
1206 Ga0501068_0077224
1207 Ga0501069_0087184
1208 Ga0501070_0012968
1209 nmdc:mga08y16_230136_c1
1210 nmdc:mga0n895_76452_c1
1211 nmdc:mga0a205_14292_c1
1212 Ga0500658_0000023
1213 Ga0466962_0005903
1214 Ga0466962_0008845

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

97

238

0.96

PF13462

Thioredoxin_4

Thioredoxin

82

239

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gyk-assembly4.cif.gz_D the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 0.9158 75 238
6nen-assembly1.cif.gz_A catalytic domain of proteus mirabilis scsc 0.9009 68 238
4gxz-assembly3.cif.gz_C crystal structure of a periplasmic thioredoxin-like protein from salmonella enterica serovar typhimurium 0.894 76 238
6nen-assembly1.cif.gz_A catalytic domain of proteus mirabilis scsc 0.8723 68 238
6eez-assembly1.cif.gz_A crystal structure of the thiol-disulfide exchange protein alpha-dsba2 from wolbachia pipientis 0.8673 63 235
ID Description Score Start End Superfamily
3gykA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8937 74 239 3.40.30.10
3gykA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8736 74 239 3.40.30.10
4xvwC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8688 68 240 3.40.30.10
4xvwC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.846 68 240 3.40.30.10
3eu4A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8104 84 238 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2A2K558-F1-model_v4 Thioredoxin domain-containing protein 0.9746 62 238 GO:0016491
AF-A0A418Q2E3-F1-model_v4 DsbA family protein 0.9708 37 238 GO:0016491
AF-A0A2A2K558-F1-model_v4 Thioredoxin domain-containing protein 0.9482 62 238 GO:0016491
AF-A0A258X6G2-F1-model_v4 Disulfide bond formation protein DsbA 0.9405 94 238 GO:0016491
AF-A0A418Q2E3-F1-model_v4 DsbA family protein 0.9387 37 238 GO:0016491

Map