F468653

General Info

Members Datasets Scaffolds Average Seq Length
607 257 1214 78

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10757549|Ga0070666_107575491
Length 92
Sequence MFLHNIELGHSFVEAMPYQAGSSAQRIRIGLTGLAFAFLLVLLGSIISRSSRDGTSNTXXQAVSNEPSEPLAEMGVAPGAADTSNNSDASKK

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
166 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
167 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
168 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
174 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
175 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
176 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
177 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
178 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
179 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
180 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
201 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
214 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
230 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
231 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
232 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
233 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
234 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
235 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
236 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
237 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
238 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
239 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
240 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
241 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
242 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
243 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
244 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
245 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
246 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
247 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
248 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
249 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
250 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
251 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
252 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 3.95
Rhizosphere 94.73
Stem 0
Stem Tuber 0
Unclassified 25.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10757549 3300005335 Unclassified 714
2 JGI24740J21852_10118845 3300001979 Unclassified 663
3 JGI24737J22298_10178084 3300001990 Bacteria 627
4 rootH1_10128635 3300003316 Bacteria 1125
5 rootH2_10185415 3300003320 Bacteria 1253
6 rootL2_10152757 3300003322 Bacteria 2308
7 rootL2_10176713 3300003322 Bacteria 1601
8 Ga0065712_10204682 3300005290 Bacteria 1095
9 Ga0070658_10020884 3300005327 Bacteria 5246
10 Ga0070658_10168974 3300005327 Bacteria 1837
11 Ga0070658_10258009 3300005327 Bacteria 1480
12 Ga0070658_10283000 3300005327 Bacteria 1412
13 Ga0070658_10340673 3300005327 Unclassified 1282
14 Ga0070658_10465325 3300005327 Unclassified 1090
15 Ga0070658_10665055 3300005327 Bacteria 904
16 Ga0070676_10340751 3300005328 Unclassified 1028
17 Ga0070676_10946033 3300005328 Bacteria 644
18 Ga0070676_11067877 3300005328 Bacteria 609
19 Ga0070683_100532577 3300005329 Unclassified 1123
20 Ga0070683_100556677 3300005329 Unclassified 1096
21 Ga0070683_100620475 3300005329 Unclassified 1035
22 Ga0070690_100965302 3300005330 Bacteria 670
23 Ga0070690_101440355 3300005330 Bacteria 555
24 Ga0070670_100170313 3300005331 Bacteria 1888
25 Ga0070670_100177347 3300005331 Bacteria 1849
26 Ga0070670_100608233 3300005331 Bacteria 978
27 Ga0070670_101184435 3300005331 Bacteria 698
28 Ga0070677_10393567 3300005333 Bacteria 728
29 Ga0068869_101866389 3300005334 Bacteria 538
30 Ga0070680_100011584 3300005336 Bacteria 6830
31 Ga0070680_100111764 3300005336 Bacteria 2275
32 Ga0070680_100679681 3300005336 Bacteria 885
33 Ga0070680_101290942 3300005336 Unclassified 632
34 Ga0068868_100135390 3300005338 Bacteria 2019
35 Ga0070660_100026058 3300005339 Bacteria 4352
36 Ga0070660_100026788 3300005339 Bacteria 4295
37 Ga0070660_100080371 3300005339 Bacteria 2558
38 Ga0070660_100122418 3300005339 Bacteria 2076
39 Ga0070660_100142437 3300005339 Bacteria 1924
40 Ga0070660_100389184 3300005339 Bacteria 1152
41 Ga0070660_100570503 3300005339 Bacteria 945
42 Ga0070661_100024962 3300005344 Bacteria 4291
43 Ga0070661_100093650 3300005344 Bacteria 2226
44 Ga0070661_100157009 3300005344 Bacteria 1722
45 Ga0070661_100432794 3300005344 Unclassified 1044
46 Ga0070661_100451363 3300005344 Unclassified 1023
47 Ga0070661_100638592 3300005344 Unclassified 863
48 Ga0070661_100901127 3300005344 Bacteria 730
49 Ga0070661_100957247 3300005344 Unclassified 709
50 Ga0070661_101134637 3300005344 Unclassified 652
51 Ga0070692_10003681 3300005345 Bacteria 6275
52 Ga0070692_10806706 3300005345 Bacteria 641
53 Ga0070668_100541714 3300005347 Bacteria 1012
54 Ga0070668_100554120 3300005347 Bacteria 1001
55 Ga0070668_100870328 3300005347 Unclassified 804
56 Ga0070668_101563599 3300005347 Unclassified 604
57 Ga0070669_100028408 3300005353 Bacteria 4028
58 Ga0070669_100160011 3300005353 Bacteria 1749
59 Ga0070669_100493484 3300005353 Bacteria 1015
60 Ga0070669_100850916 3300005353 Bacteria 777
61 Ga0070669_101989536 3300005353 Bacteria 508
62 Ga0070675_100132648 3300005354 Bacteria 2124
63 Ga0070675_100276329 3300005354 Unclassified 1475
64 Ga0070675_100317997 3300005354 Bacteria 1375
65 Ga0070675_102097332 3300005354 Bacteria 521
66 Ga0070671_100000424 3300005355 Bacteria 29408
67 Ga0070671_100005299 3300005355 Bacteria 10286
68 Ga0070671_100012605 3300005355 Bacteria 6811
69 Ga0070671_100040439 3300005355 Bacteria 3872
70 Ga0070673_100010631 3300005364 Bacteria 6239
71 Ga0070673_100079067 3300005364 Bacteria 2662
72 Ga0070673_100653063 3300005364 Bacteria 963
73 Ga0070673_100765288 3300005364 Bacteria 890
74 Ga0070659_100003841 3300005366 Bacteria 10712
75 Ga0070659_100006741 3300005366 Bacteria 8303
76 Ga0070659_100019063 3300005366 Bacteria 5189
77 Ga0070659_100020307 3300005366 Bacteria 5045
78 Ga0070659_100059539 3300005366 Bacteria 3015
79 Ga0070659_100354200 3300005366 Unclassified 1232
80 Ga0070659_100814096 3300005366 Bacteria 813
81 Ga0070659_101790228 3300005366 Bacteria 550
82 Ga0070659_102111739 3300005366 Bacteria 506
83 Ga0070709_10319080 3300005434 Bacteria 1140
84 Ga0070714_100264395 3300005435 Bacteria 1594
85 Ga0070714_100375316 3300005435 Unclassified 1340
86 Ga0070714_100433565 3300005435 Bacteria 1246
87 Ga0070714_101177850 3300005435 Unclassified 747
88 Ga0070713_100009963 3300005436 Bacteria 6845
89 Ga0070713_100014768 3300005436 Bacteria 5811
90 Ga0070705_100352646 3300005440 Unclassified 1073
91 Ga0070700_100943668 3300005441 Bacteria 705
92 Ga0070694_100336752 3300005444 Unclassified 1165
93 Ga0070663_100189828 3300005455 Unclassified 1598
94 Ga0070663_100336432 3300005455 Bacteria 1218
95 Ga0070663_101360029 3300005455 Bacteria 628
96 Ga0070663_101485221 3300005455 Unclassified 602
97 Ga0070678_100033036 3300005456 Bacteria 3588
98 Ga0070662_100039170 3300005457 Bacteria 3371
99 Ga0070662_100088002 3300005457 Bacteria 2327
100 Ga0070662_100100539 3300005457 Bacteria 2188
101 Ga0070662_100658417 3300005457 Bacteria 884
102 Ga0070662_101414908 3300005457 Unclassified 599
103 Ga0070662_101605115 3300005457 Bacteria 561
104 Ga0070681_10099847 3300005458 Bacteria 2848
105 Ga0070681_10237279 3300005458 Unclassified 1737
106 Ga0068867_100978014 3300005459 Bacteria 766
107 Ga0070679_100036574 3300005530 Bacteria 4872
108 Ga0070679_100089240 3300005530 Bacteria 3070
109 Ga0070679_100632002 3300005530 Bacteria 1014
110 Ga0070684_100284642 3300005535 Bacteria 1515
111 Ga0070684_100620578 3300005535 Unclassified 1006
112 Ga0068853_100066003 3300005539 Bacteria 3142
113 Ga0068853_100076618 3300005539 Bacteria 2920
114 Ga0068853_100142555 3300005539 Bacteria 2152
115 Ga0068853_100592034 3300005539 Bacteria 1053
116 Ga0068853_101195422 3300005539 Bacteria 734
117 Ga0070672_100184595 3300005543 Unclassified 1739
118 Ga0070672_100492361 3300005543 Bacteria 1060
119 Ga0070686_100507152 3300005544 Bacteria 937
120 Ga0070695_100069833 3300005545 Bacteria 2296
121 Ga0070696_100009681 3300005546 Bacteria 6446
122 Ga0070693_100996264 3300005547 Unclassified 634
123 Ga0070693_101374567 3300005547 Bacteria 548
124 Ga0070665_100014663 3300005548 Bacteria 7866
125 Ga0070665_100039454 3300005548 Bacteria 4747
126 Ga0070665_100628465 3300005548 Bacteria 1087
127 Ga0068855_100030396 3300005563 Bacteria 6461
128 Ga0068855_100276576 3300005563 Unclassified 1866
129 Ga0068855_101309524 3300005563 Bacteria 749
130 Ga0068855_101434033 3300005563 Bacteria 711
131 Ga0070664_100009821 3300005564 Bacteria 7754
132 Ga0070664_100018718 3300005564 Bacteria 5697
133 Ga0070664_100248095 3300005564 Bacteria 1600
134 Ga0070664_100348875 3300005564 Bacteria 1346
135 Ga0070664_100374372 3300005564 Bacteria 1299
136 Ga0070664_101046742 3300005564 Bacteria 768
137 Ga0068857_100003710 3300005577 Bacteria 12814
138 Ga0068857_100596231 3300005577 Unclassified 1044
139 Ga0068857_101054884 3300005577 Bacteria 784
140 Ga0068854_100027102 3300005578 Bacteria 3947
141 Ga0068854_100406332 3300005578 Bacteria 1128
142 Ga0068854_102283727 3300005578 Bacteria 501
143 Ga0068856_100017475 3300005614 Bacteria 6949
144 Ga0068856_100424546 3300005614 Bacteria 1349
145 Ga0068856_100625445 3300005614 Bacteria 1097
146 Ga0068852_100006491 3300005616 Bacteria 8456
147 Ga0068852_100216214 3300005616 Bacteria 1821
148 Ga0068852_100288814 3300005616 Bacteria 1584
149 Ga0068852_100625321 3300005616 Bacteria 1083
150 Ga0068852_102522461 3300005616 Bacteria 534
151 Ga0068859_100320186 3300005617 Bacteria 1645
152 Ga0068864_100010223 3300005618 Bacteria 7750
153 Ga0068864_100316845 3300005618 Bacteria 1464
154 Ga0068864_100445095 3300005618 Bacteria 1238
155 Ga0068851_10223753 3300005834 Bacteria 1058
156 Ga0068851_10823510 3300005834 Bacteria 578
157 Ga0068851_11015376 3300005834 Unclassified 524
158 Ga0068870_10105603 3300005840 Bacteria 1600
159 Ga0068863_100004350 3300005841 Bacteria 13956
160 Ga0068863_100056918 3300005841 Bacteria 3701
161 Ga0068863_101524401 3300005841 Unclassified 677
162 Ga0068858_100510931 3300005842 Unclassified 1161
163 Ga0068858_101676077 3300005842 Bacteria 628
164 Ga0068862_100042597 3300005844 Bacteria 3868
165 Ga0068862_100073529 3300005844 Bacteria 2954
166 Ga0068862_100149983 3300005844 Bacteria 2075
167 Ga0068862_100865288 3300005844 Bacteria 887
168 Ga0068862_102407586 3300005844 Bacteria 538
169 Ga0081539_10055636 3300005985 Bacteria 2200
170 Ga0081539_10220127 3300005985 Unclassified 864
171 Ga0070717_10002119 3300006028 Bacteria 13916
172 Ga0070716_100010383 3300006173 Bacteria 4665
173 Ga0070716_100020057 3300006173 Bacteria 3505
174 Ga0070712_100110851 3300006175 Bacteria 2047
175 Ga0075366_10379903 3300006195 Bacteria 869
176 Ga0097621_100616686 3300006237 Unclassified 993
177 Ga0068865_100170789 3300006881 Bacteria 1667
178 Ga0097620_100320202 3300006931 Bacteria 1645
179 Ga0097620_102413270 3300006931 Unclassified 579
180 Ga0111539_11446873 3300009094 Bacteria 797
181 Ga0114129_11177508 3300009147 Bacteria 956
182 Ga0105243_10113909 3300009148 Bacteria 2268
183 Ga0105241_12563693 3300009174 Bacteria 511
184 Ga0105242_12369423 3300009176 Bacteria 578
185 Ga0105248_10000269 3300009177 Bacteria 61063
186 Ga0105248_10112065 3300009177 Bacteria 3077
187 Ga0105248_10204451 3300009177 Bacteria 2225
188 Ga0105248_13239177 3300009177 Unclassified 518
189 Ga0105238_11797942 3300009551 Unclassified 645
190 Ga0105249_11413115 3300009553 Bacteria 768
191 Ga0105249_11711412 3300009553 Bacteria 701
192 Ga0157373_10006789 3300013100 Bacteria 8525
193 Ga0157373_10045238 3300013100 Plasmid 3143
194 Ga0157373_10051893 3300013100 Bacteria 2919
195 Ga0157373_10077439 3300013100 Bacteria 2346
196 Ga0157373_10090071 3300013100 Bacteria 2160
197 Ga0157373_10166983 3300013100 Bacteria 1549
198 Ga0157373_10459967 3300013100 Unclassified 916
199 Ga0157371_10061021 3300013102 Bacteria 2674
200 Ga0157371_10150436 3300013102 Unclassified 1660
201 Ga0157371_10386391 3300013102 Bacteria 1023
202 Ga0157371_11458067 3300013102 Unclassified 533
203 Ga0157370_10277195 3300013104 Unclassified 1549
204 Ga0157370_11549798 3300013104 Unclassified 595
205 Ga0157369_10061425 3300013105 Bacteria 4051
206 Ga0157369_10117123 3300013105 Bacteria 2828
207 Ga0157369_10528169 3300013105 Bacteria 1220
208 Ga0157374_11290519 3300013296 Bacteria 752
209 Ga0157378_10382335 3300013297 Unclassified 1383
210 Ga0157378_11176845 3300013297 Unclassified 806
211 Ga0157378_12897981 3300013297 Unclassified 532
212 Ga0163162_11356753 3300013306 Bacteria 808
213 Ga0157372_10196711 3300013307 Bacteria 2335
214 Ga0157372_10616891 3300013307 Unclassified 1264
215 Ga0157372_10956401 3300013307 Unclassified 993
216 Ga0157375_10786171 3300013308 Unclassified 1101
217 Ga0157375_10808963 3300013308 Unclassified 1085
218 Ga0157375_11137512 3300013308 Bacteria 914
219 Ga0163163_10221612 3300014325 Bacteria 1940
220 Ga0157380_10057906 3300014326 Bacteria 3088
221 Ga0157380_12421658 3300014326 Unclassified 590
222 Ga0182008_10382171 3300014497 Bacteria 753
223 Ga0157377_11109137 3300014745 Bacteria 607
224 Ga0206353_11831775 3300020082 Bacteria 3016
225 Ga0207656_10596364 3300025321 Unclassified 564
226 Ga0207688_10056038 3300025901 Bacteria 2214
227 Ga0207688_10078654 3300025901 Bacteria 1880
228 Ga0207647_10270775 3300025904 Unclassified 971
229 Ga0207699_10086349 3300025906 Bacteria 1959
230 Ga0207645_10116174 3300025907 Bacteria 1735
231 Ga0207645_10141703 3300025907 Bacteria 1567
232 Ga0207643_10343333 3300025908 Bacteria 936
233 Ga0207705_10002865 3300025909 Bacteria 13205
234 Ga0207705_10006627 3300025909 Bacteria 8571
235 Ga0207705_10034264 3300025909 Bacteria 3630
236 Ga0207705_10077100 3300025909 Bacteria 2424
237 Ga0207705_10270248 3300025909 Bacteria 1300
238 Ga0207705_10396756 3300025909 Unclassified 1067
239 Ga0207705_10402999 3300025909 Bacteria 1058
240 Ga0207705_10439532 3300025909 Bacteria 1011
241 Ga0207705_10728635 3300025909 Bacteria 770
242 Ga0207705_10820160 3300025909 Unclassified 722
243 Ga0207684_10426642 3300025910 Bacteria 1139
244 Ga0207707_10074109 3300025912 Bacteria 2969
245 Ga0207707_10083263 3300025912 Bacteria 2793
246 Ga0207695_10449577 3300025913 Bacteria 1172
247 Ga0207693_10009724 3300025915 Bacteria 7829
248 Ga0207660_10014545 3300025917 Bacteria 5177
249 Ga0207660_10035857 3300025917 Bacteria 3445
250 Ga0207660_10357318 3300025917 Unclassified 1171
251 Ga0207660_11347718 3300025917 Bacteria 579
252 Ga0207657_10017082 3300025919 Bacteria 6977
253 Ga0207657_10062300 3300025919 Bacteria 3194
254 Ga0207657_10067818 3300025919 Bacteria 3032
255 Ga0207657_10083328 3300025919 Bacteria 2683
256 Ga0207657_10089591 3300025919 Unclassified 2569
257 Ga0207657_10101423 3300025919 Bacteria 2389
258 Ga0207657_10146000 3300025919 Bacteria 1929
259 Ga0207657_10388992 3300025919 Bacteria 1097
260 Ga0207649_10092942 3300025920 Bacteria 1978
261 Ga0207649_10197653 3300025920 Bacteria 1418
262 Ga0207649_10369059 3300025920 Bacteria 1067
263 Ga0207649_10460160 3300025920 Unclassified 962
264 Ga0207649_11324458 3300025920 Bacteria 570
265 Ga0207649_11609890 3300025920 Unclassified 514
266 Ga0207652_10031171 3300025921 Bacteria 4475
267 Ga0207652_10068868 3300025921 Bacteria 3071
268 Ga0207652_10118149 3300025921 Bacteria 2356
269 Ga0207652_10245083 3300025921 Bacteria 1616
270 Ga0207652_10259583 3300025921 Bacteria 1567
271 Ga0207681_10010549 3300025923 Bacteria 5661
272 Ga0207681_10362315 3300025923 Bacteria 1163
273 Ga0207681_11251142 3300025923 Bacteria 623
274 Ga0207681_11253459 3300025923 Bacteria 623
275 Ga0207650_10008242 3300025925 Bacteria 7114
276 Ga0207650_10071950 3300025925 Bacteria 2602
277 Ga0207650_10152100 3300025925 Bacteria 1827
278 Ga0207650_11055477 3300025925 Unclassified 691
279 Ga0207659_10319797 3300025926 Unclassified 1280
280 Ga0207659_10933145 3300025926 Bacteria 746
281 Ga0207659_11442181 3300025926 Bacteria 590
282 Ga0207664_10068570 3300025929 Bacteria 2850
283 Ga0207664_10178659 3300025929 Bacteria 1821
284 Ga0207664_10730126 3300025929 Unclassified 891
285 Ga0207644_10001611 3300025931 Bacteria 14561
286 Ga0207644_10051098 3300025931 Bacteria 2965
287 Ga0207644_10928899 3300025931 Unclassified 729
288 Ga0207690_10012157 3300025932 Bacteria 5150
289 Ga0207690_10040371 3300025932 Bacteria 3050
290 Ga0207690_10052918 3300025932 Bacteria 2721
291 Ga0207690_10054901 3300025932 Unclassified 2681
292 Ga0207690_10061946 3300025932 Bacteria 2545
293 Ga0207690_10062295 3300025932 Bacteria 2539
294 Ga0207690_10302846 3300025932 Bacteria 1251
295 Ga0207690_10439882 3300025932 Bacteria 1046
296 Ga0207690_11309226 3300025932 Unclassified 606
297 Ga0207706_10020377 3300025933 Bacteria 5961
298 Ga0207706_10147095 3300025933 Bacteria 2073
299 Ga0207706_10184794 3300025933 Bacteria 1831
300 Ga0207706_10197970 3300025933 Bacteria 1762
301 Ga0207706_10729710 3300025933 Bacteria 845
302 Ga0207686_11368795 3300025934 Bacteria 582
303 Ga0207709_10231736 3300025935 Bacteria 1338
304 Ga0207669_10116366 3300025937 Bacteria 1804
305 Ga0207704_11187490 3300025938 Unclassified 650
306 Ga0207665_10006614 3300025939 Bacteria 7689
307 Ga0207665_10050476 3300025939 Bacteria 2797
308 Ga0207691_10195301 3300025940 Unclassified 1763
309 Ga0207691_10203949 3300025940 Bacteria 1720
310 Ga0207711_10000122 3300025941 Bacteria 81465
311 Ga0207711_11955382 3300025941 Unclassified 529
312 Ga0207689_11599615 3300025942 Unclassified 542
313 Ga0207661_10456630 3300025944 Unclassified 1164
314 Ga0207661_10733223 3300025944 Unclassified 909
315 Ga0207661_11350328 3300025944 Bacteria 654
316 Ga0207679_10015212 3300025945 Bacteria 5077
317 Ga0207679_10024018 3300025945 Bacteria 4176
318 Ga0207679_10412228 3300025945 Bacteria 1191
319 Ga0207679_11194253 3300025945 Unclassified 698
320 Ga0207679_11650116 3300025945 Unclassified 587
321 Ga0207667_10029135 3300025949 Bacteria 5989
322 Ga0207667_10552659 3300025949 Bacteria 1164
323 Ga0207667_10589663 3300025949 Unclassified 1122
324 Ga0207651_10016424 3300025960 Bacteria 4336
325 Ga0207651_10898838 3300025960 Bacteria 789
326 Ga0207651_11099582 3300025960 Bacteria 712
327 Ga0207712_10581824 3300025961 Bacteria 966
328 Ga0207668_10687184 3300025972 Unclassified 898
329 Ga0207640_10070651 3300025981 Bacteria 2349
330 Ga0207640_10102821 3300025981 Bacteria 2007
331 Ga0207640_10378307 3300025981 Bacteria 1146
332 Ga0207658_10320201 3300025986 Bacteria 1342
333 Ga0207658_10889049 3300025986 Bacteria 811
334 Ga0207703_11553660 3300026035 Bacteria 637
335 Ga0207639_10176423 3300026041 Bacteria 1814
336 Ga0207639_10242132 3300026041 Unclassified 1569
337 Ga0207639_10311636 3300026041 Bacteria 1394
338 Ga0207639_11913326 3300026041 Unclassified 554
339 Ga0207678_10084067 3300026067 Bacteria 2722
340 Ga0207678_10209335 3300026067 Unclassified 1668
341 Ga0207678_10264886 3300026067 Bacteria 1473
342 Ga0207708_11103726 3300026075 Bacteria 692
343 Ga0207702_10250319 3300026078 Bacteria 1664
344 Ga0207702_10701324 3300026078 Unclassified 997
345 Ga0207702_11005292 3300026078 Bacteria 827
346 Ga0207641_10131764 3300026088 Bacteria 2245
347 Ga0207648_10028843 3300026089 Bacteria 4919
348 Ga0207676_10008045 3300026095 Bacteria 7497
349 Ga0207676_10236536 3300026095 Bacteria 1636
350 Ga0207676_10616126 3300026095 Bacteria 1044
351 Ga0207676_11498879 3300026095 Bacteria 671
352 Ga0207674_10000082 3300026116 Bacteria 101650
353 Ga0207674_10246084 3300026116 Bacteria 1735
354 Ga0207674_11423828 3300026116 Unclassified 662
355 Ga0207675_100125814 3300026118 Bacteria 2428
356 Ga0207683_10066552 3300026121 Bacteria 3177
357 Ga0207683_11044427 3300026121 Unclassified 758
358 Ga0207698_10000203 3300026142 Bacteria 37263
359 Ga0207698_10051080 3300026142 Bacteria 3159
360 Ga0207698_10462815 3300026142 Bacteria 1227
361 Ga0207698_10500768 3300026142 Bacteria 1182
362 Ga0207698_10514911 3300026142 Unclassified 1167
363 Ga0209974_10344831 3300027876 Bacteria 577
364 Ga0268266_10011217 3300028379 Bacteria 7799
365 Ga0268266_10434809 3300028379 Bacteria 1245
366 Ga0268266_11994217 3300028379 Bacteria 554
367 Ga0268265_10020943 3300028380 Bacteria 4571
368 Ga0268265_10032684 3300028380 Bacteria 3773
369 Ga0268265_10196518 3300028380 Bacteria 1746
370 Ga0268265_10312102 3300028380 Bacteria 1420
371 Ga0268265_11914184 3300028380 Unclassified 600
372 Ga0307408_100061678 3300031548 Bacteria 2737
373 Ga0307408_100859703 3300031548 Bacteria 827
374 Ga0307408_101357745 3300031548 Unclassified 668
375 Ga0307405_10060147 3300031731 Bacteria 2396
376 Ga0307413_10060123 3300031824 Bacteria 2338
377 Ga0307413_10160633 3300031824 Bacteria 1578
378 Ga0307413_10375038 3300031824 Bacteria 1106
379 Ga0307410_10009788 3300031852 Bacteria 5396
380 Ga0307410_10055928 3300031852 Bacteria 2680
381 Ga0307410_10111177 3300031852 Bacteria 1982
382 Ga0307410_10507684 3300031852 Unclassified 993
383 Ga0307406_10088050 3300031901 Bacteria 2082
384 Ga0307406_10269085 3300031901 Unclassified 1293
385 Ga0307406_10654123 3300031901 Bacteria 873
386 Ga0307406_10951492 3300031901 Bacteria 734
387 Ga0307407_10005291 3300031903 Bacteria 5581
388 Ga0307407_10093767 3300031903 Bacteria 1846
389 Ga0307407_10227708 3300031903 Bacteria 1264
390 Ga0307407_10603502 3300031903 Unclassified 817
391 Ga0307407_11305366 3300031903 Unclassified 569
392 Ga0307412_10106151 3300031911 Unclassified 1996
393 Ga0307412_10278045 3300031911 Bacteria 1313
394 Ga0307412_10346145 3300031911 Unclassified 1191
395 Ga0307409_100024943 3300031995 Bacteria 4182
396 Ga0307409_100093066 3300031995 Bacteria 2476
397 Ga0307409_100240441 3300031995 Bacteria 1648
398 Ga0307409_100326875 3300031995 Bacteria 1437
399 Ga0307409_100554655 3300031995 Unclassified 1128
400 Ga0307409_101054176 3300031995 Bacteria 833
401 Ga0307409_101363221 3300031995 Bacteria 735
402 Ga0307409_101386317 3300031995 Unclassified 729
403 Ga0307409_101685209 3300031995 Bacteria 663
404 Ga0307416_100065933 3300032002 Bacteria 2978
405 Ga0307416_100725859 3300032002 Unclassified 1084
406 Ga0307416_100975902 3300032002 Bacteria 950
407 Ga0307416_101103266 3300032002 Unclassified 898
408 Ga0307416_101414158 3300032002 Unclassified 801
409 Ga0307416_102182960 3300032002 Bacteria 655
410 Ga0307414_10199318 3300032004 Bacteria 1627
411 Ga0307414_10218300 3300032004 Bacteria 1563
412 Ga0307414_11626450 3300032004 Unclassified 602
413 Ga0307414_12132287 3300032004 Unclassified 523
414 Ga0307411_10018271 3300032005 Bacteria 4017
415 Ga0307411_10491138 3300032005 Unclassified 1036
416 Ga0307411_10968131 3300032005 Bacteria 760
417 Ga0307411_11494125 3300032005 Bacteria 621
418 Ga0307415_100015587 3300032126 Bacteria 4506
419 Ga0307415_100033818 3300032126 Bacteria 3320
420 Ga0307415_100126616 3300032126 Bacteria 1926
421 Ga0307415_100302493 3300032126 Bacteria 1325
422 Ga0307415_101712260 3300032126 Unclassified 606
423 Ga0373943_0589245 3300035170 Bacteria 654
424 Ga0373946_0110934 3300035171 Bacteria 1241
425 Ga0373955_0187119 3300035172 Bacteria 1230
426 Ga0373962_0334744 3300035242 Unclassified 544
427 Ga0373935_0064921 3300035692 Bacteria 2341
428 Ga0373935_0982406 3300035692 Bacteria 627
429 Ga0373935_1316671 3300035692 Unclassified 539
430 Ga0373937_0427629 3300036401 Bacteria 1257
431 Ga0395899_0047878 3300037312 Bacteria 3182
432 Ga0395899_0133511 3300037312 Bacteria 1771
433 Ga0395899_0133804 3300037312 Unclassified 1768
434 Ga0395899_0139283 3300037312 Unclassified 1727
435 Ga0395899_0651918 3300037312 Unclassified 665
436 Ga0395900_0002427 3300037418 Bacteria 20530
437 Ga0395900_0027977 3300037418 Bacteria 5773
438 Ga0395900_0097316 3300037418 Bacteria 3023
439 Ga0395900_0212422 3300037418 Bacteria 1953
440 Ga0395900_0610656 3300037418 Bacteria 1030
441 Ga0395900_0709933 3300037418 Bacteria 938
442 Ga0395900_0743744 3300037418 Unclassified 911
443 Ga0395900_1079985 3300037418 Unclassified 720
444 Ga0395900_1133917 3300037418 Bacteria 699
445 Ga0395900_1439078 3300037418 Unclassified 602
446 Ga0395898_0002431 3300037466 Bacteria 22027
447 Ga0395898_0032507 3300037466 Bacteria 5208
448 Ga0395898_0245103 3300037466 Bacteria 1709
449 Ga0395898_0439074 3300037466 Unclassified 1243
450 Ga0395898_1211152 3300037466 Bacteria 686
451 Ga0395898_1912150 3300037466 Unclassified 513
452 Ga0395905_0001242 3300037471 Bacteria 31620
453 Ga0395905_0002743 3300037471 Bacteria 19277
454 Ga0395905_0037489 3300037471 Bacteria 4551
455 Ga0395905_0046416 3300037471 Bacteria 4073
456 Ga0395905_0167843 3300037471 Bacteria 2062
457 Ga0395905_0181987 3300037471 Bacteria 1973
458 Ga0395905_0325048 3300037471 Bacteria 1428
459 Ga0395905_0334940 3300037471 Unclassified 1404
460 Ga0395905_0465559 3300037471 Bacteria 1163
461 Ga0395905_0516925 3300037471 Bacteria 1094
462 Ga0395905_0537629 3300037471 Unclassified 1069
463 Ga0395905_0681076 3300037471 Bacteria 930
464 Ga0395905_0702557 3300037471 Unclassified 913
465 Ga0395905_1484620 3300037471 Bacteria 582
466 Ga0395905_1759423 3300037471 Bacteria 525
467 Ga0395901_0002715 3300038443 Bacteria 17826
468 Ga0395901_0172595 3300038443 Bacteria 2268
469 Ga0395901_0283557 3300038443 Bacteria 1720
470 Ga0395901_0616470 3300038443 Bacteria 1092
471 Ga0395901_0855337 3300038443 Unclassified 894
472 Ga0395901_1641827 3300038443 Unclassified 595
473 Ga0395901_1792848 3300038443 Bacteria 563
474 Ga0395901_1936332 3300038443 Bacteria 536
475 Ga0439438_032441 3300041405 Unclassified 1385
476 Ga0439461_0040676 3300041410 Unclassified 1003
477 Ga0439465_0059716 3300041413 Bacteria 1262
478 Ga0451789_0225514 3300041443 Bacteria 603
479 Ga0451853_3865687 3300041512 Bacteria 1081
480 Ga0439448_0003844 3300042005 Bacteria 4201
481 Ga0439432_127386 3300042006 Bacteria 752
482 Ga0439449_0015685 3300042007 Bacteria 2849
483 Ga0439455_0018375 3300042012 Bacteria 1639
484 Ga0450890_007518 3300042127 Unclassified 1391
485 Ga0450891_017721 3300042129 Bacteria 686
486 Ga0450902_019378 3300042137 Unclassified 1120
487 Ga0450903_037701 3300042138 Bacteria 719
488 Ga0450905_017556 3300042142 Bacteria 1038
489 Ga0450889_000285 3300042144 Bacteria 5665
490 Ga0439458_0002933 3300042157 Bacteria 4099
491 Ga0439464_0000131 3300042439 Bacteria 11917
492 Ga0450916_101765 3300042530 Bacteria 510
493 Ga0466969_0583977 3300044656 Unclassified 512
494 Ga0466972_0300685 3300044658 Bacteria 750
495 Ga0466972_0369111 3300044658 Bacteria 672
496 Ga0466966_0438022 3300044684 Bacteria 785
497 Ga0466961_0038669 3300044693 Bacteria 3060
498 Ga0466961_0434637 3300044693 Bacteria 795
499 Ga0466961_0721700 3300044693 Unclassified 596
500 Ga0466963_0203711 3300044694 Bacteria 1384
501 Ga0466963_0342952 3300044694 Bacteria 1052
502 Ga0466963_0612992 3300044694 Bacteria 768
503 Ga0466964_0026302 3300044706 Bacteria 2277
504 Ga0466971_0016934 3300044719 Bacteria 3221
505 Ga0466970_0111173 3300044765 Bacteria 1496
506 Ga0466970_0191099 3300044765 Bacteria 1137
507 Ga0466970_0487756 3300044765 Unclassified 709
508 Ga0466957_0084317 3300044842 Bacteria 1983
509 Ga0466957_0108437 3300044842 Unclassified 1758
510 Ga0466957_0891118 3300044842 Bacteria 635
511 Ga0466957_0943392 3300044842 Unclassified 618
512 Ga0466960_0242133 3300044901 Bacteria 999
513 Ga0466960_0944864 3300044901 Bacteria 528
514 Ga0466959_0405351 3300045049 Unclassified 926
515 Ga0466959_0440331 3300045049 Unclassified 884
516 Ga0466959_0684675 3300045049 Bacteria 687
517 Ga0466967_0006340 3300045976 Bacteria 8356
518 Ga0466967_0190591 3300045976 Unclassified 1937
519 Ga0466967_0291665 3300045976 Bacteria 1567
520 Ga0466967_0327230 3300045976 Unclassified 1479
521 Ga0466967_1147145 3300045976 Bacteria 774
522 Ga0466967_1420971 3300045976 Bacteria 691
523 Ga0466967_1434241 3300045976 Bacteria 688
524 Ga0495629_0499119 3300046459 Unclassified 821
525 Ga0495580_0478031 3300046472 Unclassified 834
526 Ga0495583_0161906 3300046506 Bacteria 923
527 Ga0495606_0304694 3300046507 Bacteria 862
528 Ga0495616_0154785 3300046513 Bacteria 1035
529 Ga0495620_0074048 3300046515 Bacteria 1388
530 Ga0495632_0183489 3300046519 Bacteria 958
531 Ga0495663_0099994 3300046525 Bacteria 954
532 Ga0495642_0182351 3300046528 Unclassified 914
533 Ga0495598_0001748 3300046537 Bacteria 4358
534 Ga0495621_0000198 3300046539 Bacteria 13896
535 Ga0495597_0387572 3300046542 Bacteria 532
536 Ga0495668_0016192 3300046616 Bacteria 4336
537 Ga0495625_0310812 3300046660 Bacteria 1006
538 Ga0495669_0004189 3300046684 Bacteria 5931
539 Ga0495669_0008551 3300046684 Bacteria 4310
540 Ga0495669_0011263 3300046684 Bacteria 3795
541 Ga0495669_0123634 3300046684 Bacteria 1214
542 Ga0495670_0010912 3300046691 Bacteria 4464
543 Ga0495683_0206149 3300047323 Bacteria 884
544 Ga0495677_0045083 3300047445 Bacteria 1617
545 Ga0495677_0240847 3300047445 Unclassified 706
546 Ga0495685_110842 3300047447 Bacteria 903
547 Ga0495681_0203528 3300047470 Bacteria 802
548 Ga0496100_0025228 3300048903 Bacteria 3634
549 Ga0496101_0008590 3300048904 Bacteria 6676
550 Ga0496101_0594331 3300048904 Bacteria 875
551 Ga0496102_1357178 3300048905 Unclassified 630
552 Ga0496106_0001364 3300048909 Bacteria 18291
553 Ga0496106_0280436 3300048909 Bacteria 1335
554 Ga0496106_1333566 3300048909 Bacteria 556
555 Ga0496107_0001881 3300048910 Bacteria 13284
556 Ga0496107_0039901 3300048910 Bacteria 3369
557 Ga0496107_0141740 3300048910 Bacteria 1777
558 Ga0496108_0019261 3300048911 Bacteria 5602
559 Ga0496108_0329362 3300048911 Bacteria 1332
560 Ga0496109_0000659 3300048912 Bacteria 28619
561 Ga0496109_0341808 3300048912 Unclassified 1413
562 Ga0496109_0440838 3300048912 Bacteria 1230
563 Ga0496109_1430287 3300048912 Unclassified 627
564 Ga0496110_0028507 3300048913 Bacteria 4796
565 Ga0496110_0199647 3300048913 Bacteria 1817
566 Ga0496111_0002251 3300048914 Bacteria 11595
567 Ga0496112_0001821 3300048915 Bacteria 16758
568 Ga0496112_0011866 3300048915 Bacteria 7980
569 Ga0496113_0007945 3300048916 Bacteria 6869
570 Ga0496113_0200796 3300048916 Unclassified 1585
571 Ga0501298_167691 3300049521 Unclassified 545
572 Ga0501067_0249282 3300049583 Unclassified 988
573 Ga0501069_0127871 3300049585 Unclassified 1454
574 Ga0501069_0409058 3300049585 Unclassified 803
575 Ga0501199_054296 3300049650 Unclassified 547
576 Ga0501202_030389 3300049652 Unclassified 1124
577 Ga0501209_271877 3300049656 Bacteria 531
578 Ga0501216_192933 3300049660 Unclassified 501
579 Ga0501217_031354 3300049661 Bacteria 1310
580 Ga0501224_006924 3300049664 Bacteria 1649
581 Ga0501224_024590 3300049664 Bacteria 900
582 Ga0501233_267665 3300049668 Unclassified 519
583 Ga0501235_043427 3300049669 Unclassified 1031
584 Ga0501239_001882 3300049672 Bacteria 1859
585 Ga0501240_033358 3300049673 Bacteria 832
586 Ga0501247_008998 3300049677 Bacteria 1174
587 Ga0501248_019384 3300049678 Unclassified 691
588 Ga0501252_067650 3300049682 Bacteria 570
589 Ga0501256_049911 3300049685 Unclassified 514
590 Ga0501257_137084 3300049686 Unclassified 666
591 Ga0501221_206081 3300049704 Unclassified 548
592 Ga0501225_0028368 3300049705 Bacteria 1539
593 Ga0501234_038313 3300049707 Bacteria 782
594 Ga0501232_016278 3300049757 Bacteria 913
595 Ga0501262_042800 3300049759 Unclassified 681
596 Ga0501267_009032 3300049764 Bacteria 990
597 Ga0501268_010297 3300049765 Bacteria 1454
598 Ga0501268_069147 3300049765 Unclassified 711
599 Ga0501270_132048 3300049767 Unclassified 553
600 Ga0501279_020226 3300049775 Unclassified 945
601 nmdc:mga00v17_326267_c1 3300050491 Bacteria 997
602 nmdc:mga0k408_349259_c1 3300050493 Bacteria 882
603 nmdc:mga09592_550383_c1 3300050508 Unclassified 991
604 nmdc:mga08y16_102979_c1 3300050511 Unclassified 2972
605 nmdc:mga08y16_1202552_c1 3300050511 Unclassified 728
606 Ga0466962_0017249 3300061719 Bacteria 3478
607 Ga0466962_0424250 3300061719 Bacteria 668
608 Ga0070666_10757549
609 JGI24740J21852_10118845
610 JGI24737J22298_10178084
611 rootH1_10128635
612 rootH2_10185415
613 rootL2_10152757
614 rootL2_10176713
615 Ga0065712_10204682
616 Ga0070658_10020884
617 Ga0070658_10168974
618 Ga0070658_10258009
619 Ga0070658_10283000
620 Ga0070658_10340673
621 Ga0070658_10465325
622 Ga0070658_10665055
623 Ga0070676_10340751
624 Ga0070676_10946033
625 Ga0070676_11067877
626 Ga0070683_100532577
627 Ga0070683_100556677
628 Ga0070683_100620475
629 Ga0070690_100965302
630 Ga0070690_101440355
631 Ga0070670_100170313
632 Ga0070670_100177347
633 Ga0070670_100608233
634 Ga0070670_101184435
635 Ga0070677_10393567
636 Ga0068869_101866389
637 Ga0070680_100011584
638 Ga0070680_100111764
639 Ga0070680_100679681
640 Ga0070680_101290942
641 Ga0068868_100135390
642 Ga0070660_100026058
643 Ga0070660_100026788
644 Ga0070660_100080371
645 Ga0070660_100122418
646 Ga0070660_100142437
647 Ga0070660_100389184
648 Ga0070660_100570503
649 Ga0070661_100024962
650 Ga0070661_100093650
651 Ga0070661_100157009
652 Ga0070661_100432794
653 Ga0070661_100451363
654 Ga0070661_100638592
655 Ga0070661_100901127
656 Ga0070661_100957247
657 Ga0070661_101134637
658 Ga0070692_10003681
659 Ga0070692_10806706
660 Ga0070668_100541714
661 Ga0070668_100554120
662 Ga0070668_100870328
663 Ga0070668_101563599
664 Ga0070669_100028408
665 Ga0070669_100160011
666 Ga0070669_100493484
667 Ga0070669_100850916
668 Ga0070669_101989536
669 Ga0070675_100132648
670 Ga0070675_100276329
671 Ga0070675_100317997
672 Ga0070675_102097332
673 Ga0070671_100000424
674 Ga0070671_100005299
675 Ga0070671_100012605
676 Ga0070671_100040439
677 Ga0070673_100010631
678 Ga0070673_100079067
679 Ga0070673_100653063
680 Ga0070673_100765288
681 Ga0070659_100003841
682 Ga0070659_100006741
683 Ga0070659_100019063
684 Ga0070659_100020307
685 Ga0070659_100059539
686 Ga0070659_100354200
687 Ga0070659_100814096
688 Ga0070659_101790228
689 Ga0070659_102111739
690 Ga0070709_10319080
691 Ga0070714_100264395
692 Ga0070714_100375316
693 Ga0070714_100433565
694 Ga0070714_101177850
695 Ga0070713_100009963
696 Ga0070713_100014768
697 Ga0070705_100352646
698 Ga0070700_100943668
699 Ga0070694_100336752
700 Ga0070663_100189828
701 Ga0070663_100336432
702 Ga0070663_101360029
703 Ga0070663_101485221
704 Ga0070678_100033036
705 Ga0070662_100039170
706 Ga0070662_100088002
707 Ga0070662_100100539
708 Ga0070662_100658417
709 Ga0070662_101414908
710 Ga0070662_101605115
711 Ga0070681_10099847
712 Ga0070681_10237279
713 Ga0068867_100978014
714 Ga0070679_100036574
715 Ga0070679_100089240
716 Ga0070679_100632002
717 Ga0070684_100284642
718 Ga0070684_100620578
719 Ga0068853_100066003
720 Ga0068853_100076618
721 Ga0068853_100142555
722 Ga0068853_100592034
723 Ga0068853_101195422
724 Ga0070672_100184595
725 Ga0070672_100492361
726 Ga0070686_100507152
727 Ga0070695_100069833
728 Ga0070696_100009681
729 Ga0070693_100996264
730 Ga0070693_101374567
731 Ga0070665_100014663
732 Ga0070665_100039454
733 Ga0070665_100628465
734 Ga0068855_100030396
735 Ga0068855_100276576
736 Ga0068855_101309524
737 Ga0068855_101434033
738 Ga0070664_100009821
739 Ga0070664_100018718
740 Ga0070664_100248095
741 Ga0070664_100348875
742 Ga0070664_100374372
743 Ga0070664_101046742
744 Ga0068857_100003710
745 Ga0068857_100596231
746 Ga0068857_101054884
747 Ga0068854_100027102
748 Ga0068854_100406332
749 Ga0068854_102283727
750 Ga0068856_100017475
751 Ga0068856_100424546
752 Ga0068856_100625445
753 Ga0068852_100006491
754 Ga0068852_100216214
755 Ga0068852_100288814
756 Ga0068852_100625321
757 Ga0068852_102522461
758 Ga0068859_100320186
759 Ga0068864_100010223
760 Ga0068864_100316845
761 Ga0068864_100445095
762 Ga0068851_10223753
763 Ga0068851_10823510
764 Ga0068851_11015376
765 Ga0068870_10105603
766 Ga0068863_100004350
767 Ga0068863_100056918
768 Ga0068863_101524401
769 Ga0068858_100510931
770 Ga0068858_101676077
771 Ga0068862_100042597
772 Ga0068862_100073529
773 Ga0068862_100149983
774 Ga0068862_100865288
775 Ga0068862_102407586
776 Ga0081539_10055636
777 Ga0081539_10220127
778 Ga0070717_10002119
779 Ga0070716_100010383
780 Ga0070716_100020057
781 Ga0070712_100110851
782 Ga0075366_10379903
783 Ga0097621_100616686
784 Ga0068865_100170789
785 Ga0097620_100320202
786 Ga0097620_102413270
787 Ga0111539_11446873
788 Ga0114129_11177508
789 Ga0105243_10113909
790 Ga0105241_12563693
791 Ga0105242_12369423
792 Ga0105248_10000269
793 Ga0105248_10112065
794 Ga0105248_10204451
795 Ga0105248_13239177
796 Ga0105238_11797942
797 Ga0105249_11413115
798 Ga0105249_11711412
799 Ga0157373_10006789
800 Ga0157373_10045238
801 Ga0157373_10051893
802 Ga0157373_10077439
803 Ga0157373_10090071
804 Ga0157373_10166983
805 Ga0157373_10459967
806 Ga0157371_10061021
807 Ga0157371_10150436
808 Ga0157371_10386391
809 Ga0157371_11458067
810 Ga0157370_10277195
811 Ga0157370_11549798
812 Ga0157369_10061425
813 Ga0157369_10117123
814 Ga0157369_10528169
815 Ga0157374_11290519
816 Ga0157378_10382335
817 Ga0157378_11176845
818 Ga0157378_12897981
819 Ga0163162_11356753
820 Ga0157372_10196711
821 Ga0157372_10616891
822 Ga0157372_10956401
823 Ga0157375_10786171
824 Ga0157375_10808963
825 Ga0157375_11137512
826 Ga0163163_10221612
827 Ga0157380_10057906
828 Ga0157380_12421658
829 Ga0182008_10382171
830 Ga0157377_11109137
831 Ga0206353_11831775
832 Ga0207656_10596364
833 Ga0207688_10056038
834 Ga0207688_10078654
835 Ga0207647_10270775
836 Ga0207699_10086349
837 Ga0207645_10116174
838 Ga0207645_10141703
839 Ga0207643_10343333
840 Ga0207705_10002865
841 Ga0207705_10006627
842 Ga0207705_10034264
843 Ga0207705_10077100
844 Ga0207705_10270248
845 Ga0207705_10396756
846 Ga0207705_10402999
847 Ga0207705_10439532
848 Ga0207705_10728635
849 Ga0207705_10820160
850 Ga0207684_10426642
851 Ga0207707_10074109
852 Ga0207707_10083263
853 Ga0207695_10449577
854 Ga0207693_10009724
855 Ga0207660_10014545
856 Ga0207660_10035857
857 Ga0207660_10357318
858 Ga0207660_11347718
859 Ga0207657_10017082
860 Ga0207657_10062300
861 Ga0207657_10067818
862 Ga0207657_10083328
863 Ga0207657_10089591
864 Ga0207657_10101423
865 Ga0207657_10146000
866 Ga0207657_10388992
867 Ga0207649_10092942
868 Ga0207649_10197653
869 Ga0207649_10369059
870 Ga0207649_10460160
871 Ga0207649_11324458
872 Ga0207649_11609890
873 Ga0207652_10031171
874 Ga0207652_10068868
875 Ga0207652_10118149
876 Ga0207652_10245083
877 Ga0207652_10259583
878 Ga0207681_10010549
879 Ga0207681_10362315
880 Ga0207681_11251142
881 Ga0207681_11253459
882 Ga0207650_10008242
883 Ga0207650_10071950
884 Ga0207650_10152100
885 Ga0207650_11055477
886 Ga0207659_10319797
887 Ga0207659_10933145
888 Ga0207659_11442181
889 Ga0207664_10068570
890 Ga0207664_10178659
891 Ga0207664_10730126
892 Ga0207644_10001611
893 Ga0207644_10051098
894 Ga0207644_10928899
895 Ga0207690_10012157
896 Ga0207690_10040371
897 Ga0207690_10052918
898 Ga0207690_10054901
899 Ga0207690_10061946
900 Ga0207690_10062295
901 Ga0207690_10302846
902 Ga0207690_10439882
903 Ga0207690_11309226
904 Ga0207706_10020377
905 Ga0207706_10147095
906 Ga0207706_10184794
907 Ga0207706_10197970
908 Ga0207706_10729710
909 Ga0207686_11368795
910 Ga0207709_10231736
911 Ga0207669_10116366
912 Ga0207704_11187490
913 Ga0207665_10006614
914 Ga0207665_10050476
915 Ga0207691_10195301
916 Ga0207691_10203949
917 Ga0207711_10000122
918 Ga0207711_11955382
919 Ga0207689_11599615
920 Ga0207661_10456630
921 Ga0207661_10733223
922 Ga0207661_11350328
923 Ga0207679_10015212
924 Ga0207679_10024018
925 Ga0207679_10412228
926 Ga0207679_11194253
927 Ga0207679_11650116
928 Ga0207667_10029135
929 Ga0207667_10552659
930 Ga0207667_10589663
931 Ga0207651_10016424
932 Ga0207651_10898838
933 Ga0207651_11099582
934 Ga0207712_10581824
935 Ga0207668_10687184
936 Ga0207640_10070651
937 Ga0207640_10102821
938 Ga0207640_10378307
939 Ga0207658_10320201
940 Ga0207658_10889049
941 Ga0207703_11553660
942 Ga0207639_10176423
943 Ga0207639_10242132
944 Ga0207639_10311636
945 Ga0207639_11913326
946 Ga0207678_10084067
947 Ga0207678_10209335
948 Ga0207678_10264886
949 Ga0207708_11103726
950 Ga0207702_10250319
951 Ga0207702_10701324
952 Ga0207702_11005292
953 Ga0207641_10131764
954 Ga0207648_10028843
955 Ga0207676_10008045
956 Ga0207676_10236536
957 Ga0207676_10616126
958 Ga0207676_11498879
959 Ga0207674_10000082
960 Ga0207674_10246084
961 Ga0207674_11423828
962 Ga0207675_100125814
963 Ga0207683_10066552
964 Ga0207683_11044427
965 Ga0207698_10000203
966 Ga0207698_10051080
967 Ga0207698_10462815
968 Ga0207698_10500768
969 Ga0207698_10514911
970 Ga0209974_10344831
971 Ga0268266_10011217
972 Ga0268266_10434809
973 Ga0268266_11994217
974 Ga0268265_10020943
975 Ga0268265_10032684
976 Ga0268265_10196518
977 Ga0268265_10312102
978 Ga0268265_11914184
979 Ga0307408_100061678
980 Ga0307408_100859703
981 Ga0307408_101357745
982 Ga0307405_10060147
983 Ga0307413_10060123
984 Ga0307413_10160633
985 Ga0307413_10375038
986 Ga0307410_10009788
987 Ga0307410_10055928
988 Ga0307410_10111177
989 Ga0307410_10507684
990 Ga0307406_10088050
991 Ga0307406_10269085
992 Ga0307406_10654123
993 Ga0307406_10951492
994 Ga0307407_10005291
995 Ga0307407_10093767
996 Ga0307407_10227708
997 Ga0307407_10603502
998 Ga0307407_11305366
999 Ga0307412_10106151
1000 Ga0307412_10278045
1001 Ga0307412_10346145
1002 Ga0307409_100024943
1003 Ga0307409_100093066
1004 Ga0307409_100240441
1005 Ga0307409_100326875
1006 Ga0307409_100554655
1007 Ga0307409_101054176
1008 Ga0307409_101363221
1009 Ga0307409_101386317
1010 Ga0307409_101685209
1011 Ga0307416_100065933
1012 Ga0307416_100725859
1013 Ga0307416_100975902
1014 Ga0307416_101103266
1015 Ga0307416_101414158
1016 Ga0307416_102182960
1017 Ga0307414_10199318
1018 Ga0307414_10218300
1019 Ga0307414_11626450
1020 Ga0307414_12132287
1021 Ga0307411_10018271
1022 Ga0307411_10491138
1023 Ga0307411_10968131
1024 Ga0307411_11494125
1025 Ga0307415_100015587
1026 Ga0307415_100033818
1027 Ga0307415_100126616
1028 Ga0307415_100302493
1029 Ga0307415_101712260
1030 Ga0373943_0589245
1031 Ga0373946_0110934
1032 Ga0373955_0187119
1033 Ga0373962_0334744
1034 Ga0373935_0064921
1035 Ga0373935_0982406
1036 Ga0373935_1316671
1037 Ga0373937_0427629
1038 Ga0395899_0047878
1039 Ga0395899_0133511
1040 Ga0395899_0133804
1041 Ga0395899_0139283
1042 Ga0395899_0651918
1043 Ga0395900_0002427
1044 Ga0395900_0027977
1045 Ga0395900_0097316
1046 Ga0395900_0212422
1047 Ga0395900_0610656
1048 Ga0395900_0709933
1049 Ga0395900_0743744
1050 Ga0395900_1079985
1051 Ga0395900_1133917
1052 Ga0395900_1439078
1053 Ga0395898_0002431
1054 Ga0395898_0032507
1055 Ga0395898_0245103
1056 Ga0395898_0439074
1057 Ga0395898_1211152
1058 Ga0395898_1912150
1059 Ga0395905_0001242
1060 Ga0395905_0002743
1061 Ga0395905_0037489
1062 Ga0395905_0046416
1063 Ga0395905_0167843
1064 Ga0395905_0181987
1065 Ga0395905_0325048
1066 Ga0395905_0334940
1067 Ga0395905_0465559
1068 Ga0395905_0516925
1069 Ga0395905_0537629
1070 Ga0395905_0681076
1071 Ga0395905_0702557
1072 Ga0395905_1484620
1073 Ga0395905_1759423
1074 Ga0395901_0002715
1075 Ga0395901_0172595
1076 Ga0395901_0283557
1077 Ga0395901_0616470
1078 Ga0395901_0855337
1079 Ga0395901_1641827
1080 Ga0395901_1792848
1081 Ga0395901_1936332
1082 Ga0439438_032441
1083 Ga0439461_0040676
1084 Ga0439465_0059716
1085 Ga0451789_0225514
1086 Ga0451853_3865687
1087 Ga0439448_0003844
1088 Ga0439432_127386
1089 Ga0439449_0015685
1090 Ga0439455_0018375
1091 Ga0450890_007518
1092 Ga0450891_017721
1093 Ga0450902_019378
1094 Ga0450903_037701
1095 Ga0450905_017556
1096 Ga0450889_000285
1097 Ga0439458_0002933
1098 Ga0439464_0000131
1099 Ga0450916_101765
1100 Ga0466969_0583977
1101 Ga0466972_0300685
1102 Ga0466972_0369111
1103 Ga0466966_0438022
1104 Ga0466961_0038669
1105 Ga0466961_0434637
1106 Ga0466961_0721700
1107 Ga0466963_0203711
1108 Ga0466963_0342952
1109 Ga0466963_0612992
1110 Ga0466964_0026302
1111 Ga0466971_0016934
1112 Ga0466970_0111173
1113 Ga0466970_0191099
1114 Ga0466970_0487756
1115 Ga0466957_0084317
1116 Ga0466957_0108437
1117 Ga0466957_0891118
1118 Ga0466957_0943392
1119 Ga0466960_0242133
1120 Ga0466960_0944864
1121 Ga0466959_0405351
1122 Ga0466959_0440331
1123 Ga0466959_0684675
1124 Ga0466967_0006340
1125 Ga0466967_0190591
1126 Ga0466967_0291665
1127 Ga0466967_0327230
1128 Ga0466967_1147145
1129 Ga0466967_1420971
1130 Ga0466967_1434241
1131 Ga0495629_0499119
1132 Ga0495580_0478031
1133 Ga0495583_0161906
1134 Ga0495606_0304694
1135 Ga0495616_0154785
1136 Ga0495620_0074048
1137 Ga0495632_0183489
1138 Ga0495663_0099994
1139 Ga0495642_0182351
1140 Ga0495598_0001748
1141 Ga0495621_0000198
1142 Ga0495597_0387572
1143 Ga0495668_0016192
1144 Ga0495625_0310812
1145 Ga0495669_0004189
1146 Ga0495669_0008551
1147 Ga0495669_0011263
1148 Ga0495669_0123634
1149 Ga0495670_0010912
1150 Ga0495683_0206149
1151 Ga0495677_0045083
1152 Ga0495677_0240847
1153 Ga0495685_110842
1154 Ga0495681_0203528
1155 Ga0496100_0025228
1156 Ga0496101_0008590
1157 Ga0496101_0594331
1158 Ga0496102_1357178
1159 Ga0496106_0001364
1160 Ga0496106_0280436
1161 Ga0496106_1333566
1162 Ga0496107_0001881
1163 Ga0496107_0039901
1164 Ga0496107_0141740
1165 Ga0496108_0019261
1166 Ga0496108_0329362
1167 Ga0496109_0000659
1168 Ga0496109_0341808
1169 Ga0496109_0440838
1170 Ga0496109_1430287
1171 Ga0496110_0028507
1172 Ga0496110_0199647
1173 Ga0496111_0002251
1174 Ga0496112_0001821
1175 Ga0496112_0011866
1176 Ga0496113_0007945
1177 Ga0496113_0200796
1178 Ga0501298_167691
1179 Ga0501067_0249282
1180 Ga0501069_0127871
1181 Ga0501069_0409058
1182 Ga0501199_054296
1183 Ga0501202_030389
1184 Ga0501209_271877
1185 Ga0501216_192933
1186 Ga0501217_031354
1187 Ga0501224_006924
1188 Ga0501224_024590
1189 Ga0501233_267665
1190 Ga0501235_043427
1191 Ga0501239_001882
1192 Ga0501240_033358
1193 Ga0501247_008998
1194 Ga0501248_019384
1195 Ga0501252_067650
1196 Ga0501256_049911
1197 Ga0501257_137084
1198 Ga0501221_206081
1199 Ga0501225_0028368
1200 Ga0501234_038313
1201 Ga0501232_016278
1202 Ga0501262_042800
1203 Ga0501267_009032
1204 Ga0501268_010297
1205 Ga0501268_069147
1206 Ga0501270_132048
1207 Ga0501279_020226
1208 nmdc:mga00v17_326267_c1
1209 nmdc:mga0k408_349259_c1
1210 nmdc:mga09592_550383_c1
1211 nmdc:mga08y16_102979_c1
1212 nmdc:mga08y16_1202552_c1
1213 Ga0466962_0017249
1214 Ga0466962_0424250

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map