F468612

General Info

Members Datasets Scaffolds Average Seq Length
606 306 1212 251

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0760973|Ga0436365_0760973_603_1394
Length 263
Sequence MRVHLSKGAGTMSTVTAPASAHREPELLGQTVVVIGGSAGIGFETARRARAEGAKVILTGRKAERLQHAGSELDALSTAAFDAADPVALGRFFGDLPTIDHVMVTAGRPYYGSLADMDFAKIRDLIGEHILLALYVARNAATKVRPGGTLIFMGGTGGRRPAIGMSIASAGTAALPALIANLALEIAPVRVNLIAAGFVDTPLSAELLGDQLEKRRNQLRTTLPIGRVVGPADVAALAVHIMTNTALTGATYDIDGGQQFVPA

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
168 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
174 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
190 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
191 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
192 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
193 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
194 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
195 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
209 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
213 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
214 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
215 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
218 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
219 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
220 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
278 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
279 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
280 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
297 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
298 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
299 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
300 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
301 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
306 2862507626 Streptomyces sp. NWU339 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.66
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 8.25
Rhizosphere 85.15
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0760973 3300039437 Bacteria 1426
2 JGI24737J22298_10087042 3300001990 Bacteria 928
3 JGI24743J22301_10036976 3300001991 Bacteria 972
4 JGI25407J50210_10021380 3300003373 Bacteria 1682
5 Ga0070683_100500538 3300005329 Bacteria 1161
6 Ga0070690_100252816 3300005330 Bacteria 1247
7 Ga0068869_100116852 3300005334 Bacteria 2035
8 Ga0070682_100313006 3300005337 Bacteria 1156
9 Ga0070682_100418777 3300005337 Bacteria 1017
10 Ga0068868_100075054 3300005338 Bacteria 2702
11 Ga0068868_100132542 3300005338 Bacteria 2040
12 Ga0068868_100141758 3300005338 Bacteria 1973
13 Ga0068868_100197167 3300005338 Bacteria 1677
14 Ga0070660_100059664 3300005339 Bacteria 2959
15 Ga0070689_100055356 3300005340 Bacteria 3074
16 Ga0070691_10018824 3300005341 Bacteria 3184
17 Ga0070687_100109300 3300005343 Bacteria 1562
18 Ga0070692_10014173 3300005345 Bacteria 3735
19 Ga0070692_10063513 3300005345 Bacteria 1951
20 Ga0070668_100048519 3300005347 Bacteria 3266
21 Ga0070668_100102631 3300005347 Bacteria 2268
22 Ga0070668_100405158 3300005347 Bacteria 1165
23 Ga0070669_100234441 3300005353 Bacteria 1456
24 Ga0070675_100090680 3300005354 Bacteria 2560
25 Ga0070671_100057527 3300005355 Bacteria 3236
26 Ga0070674_100292227 3300005356 Bacteria 1296
27 Ga0070673_100020662 3300005364 Bacteria 4753
28 Ga0070673_100468981 3300005364 Bacteria 1135
29 Ga0070688_100010158 3300005365 Bacteria 5181
30 Ga0070688_100124542 3300005365 Bacteria 1731
31 Ga0070659_100125563 3300005366 Bacteria 2081
32 Ga0070709_10002020 3300005434 Bacteria 11027
33 Ga0070714_100071706 3300005435 Bacteria 2996
34 Ga0070714_100080455 3300005435 Bacteria 2835
35 Ga0070714_100087411 3300005435 Bacteria 2726
36 Ga0070714_100272054 3300005435 Bacteria 1571
37 Ga0070714_100286438 3300005435 Bacteria 1532
38 Ga0070713_100121777 3300005436 Bacteria 2289
39 Ga0070710_10004312 3300005437 Bacteria 6743
40 Ga0070710_10026305 3300005437 Bacteria 3090
41 Ga0070710_10032460 3300005437 Bacteria 2828
42 Ga0070710_10034270 3300005437 Bacteria 2762
43 Ga0070710_10502996 3300005437 Bacteria 830
44 Ga0070711_100001280 3300005439 Bacteria 13667
45 Ga0070711_100001651 3300005439 Bacteria 12335
46 Ga0070711_100023876 3300005439 Bacteria 3983
47 Ga0070705_100096014 3300005440 Bacteria 1860
48 Ga0070700_100230205 3300005441 Bacteria 1318
49 Ga0070708_100001428 3300005445 Bacteria 18231
50 Ga0070678_100211220 3300005456 Bacteria 1608
51 Ga0070678_100253141 3300005456 Bacteria 1477
52 Ga0070678_100346196 3300005456 Bacteria 1276
53 Ga0070678_100635476 3300005456 Bacteria 956
54 Ga0070662_100103506 3300005457 Bacteria 2159
55 Ga0068867_100317055 3300005459 Bacteria 1290
56 Ga0068867_100509950 3300005459 Bacteria 1035
57 Ga0070685_10177541 3300005466 Bacteria 1369
58 Ga0070706_100000113 3300005467 Bacteria 98415
59 Ga0070706_100114324 3300005467 Bacteria 2513
60 Ga0070706_100159830 3300005467 Bacteria 2104
61 Ga0070707_100071575 3300005468 Bacteria 3340
62 Ga0070707_100133383 3300005468 Bacteria 2415
63 Ga0070707_100174564 3300005468 Bacteria 2094
64 Ga0070707_100335028 3300005468 Bacteria 1470
65 Ga0070699_100003900 3300005518 Bacteria 13178
66 Ga0070699_100097275 3300005518 Bacteria 2579
67 Ga0070699_100118907 3300005518 Bacteria 2323
68 Ga0070699_100328818 3300005518 Bacteria 1374
69 Ga0070697_100022401 3300005536 Bacteria 5014
70 Ga0070697_100050966 3300005536 Bacteria 3362
71 Ga0070697_100120329 3300005536 Bacteria 2196
72 Ga0070697_100282841 3300005536 Bacteria 1423
73 Ga0068853_100159794 3300005539 Bacteria 2033
74 Ga0068853_100162601 3300005539 Bacteria 2015
75 Ga0068853_100658066 3300005539 Unclassified 997
76 Ga0070672_100181612 3300005543 Bacteria 1753
77 Ga0070686_100023288 3300005544 Bacteria 3699
78 Ga0070695_100084969 3300005545 Bacteria 2100
79 Ga0070696_100129374 3300005546 Bacteria 1836
80 Ga0070696_100292767 3300005546 Bacteria 1244
81 Ga0070696_100303342 3300005546 Bacteria 1224
82 Ga0070696_100316279 3300005546 Bacteria 1200
83 Ga0070665_100084007 3300005548 Bacteria 3189
84 Ga0070665_100118906 3300005548 Bacteria 2645
85 Ga0070665_100147693 3300005548 Bacteria 2354
86 Ga0070665_100156365 3300005548 Bacteria 2282
87 Ga0070704_100015851 3300005549 Bacteria 4745
88 Ga0070704_100184416 3300005549 Bacteria 1672
89 Ga0070704_100355125 3300005549 Bacteria 1238
90 Ga0068855_100047702 3300005563 Bacteria 5060
91 Ga0068855_100104481 3300005563 Bacteria 3258
92 Ga0068855_100410635 3300005563 Bacteria 1482
93 Ga0070664_100609452 3300005564 Bacteria 1013
94 Ga0068854_100127796 3300005578 Bacteria 1937
95 Ga0068854_100274827 3300005578 Bacteria 1354
96 Ga0068856_100086643 3300005614 Bacteria 3112
97 Ga0070702_100004209 3300005615 Bacteria 6545
98 Ga0068852_100128490 3300005616 Bacteria 2331
99 Ga0068859_100065398 3300005617 Bacteria 3670
100 Ga0068859_100544121 3300005617 Bacteria 1256
101 Ga0068859_100615610 3300005617 Bacteria 1179
102 Ga0068859_100853690 3300005617 Bacteria 996
103 Ga0068864_100055597 3300005618 Bacteria 3418
104 Ga0068864_100529905 3300005618 Bacteria 1136
105 Ga0068864_100583956 3300005618 Bacteria 1083
106 Ga0068861_100063106 3300005719 Bacteria 2847
107 Ga0068861_100139577 3300005719 Bacteria 1977
108 Ga0068851_10052306 3300005834 Bacteria 2077
109 Ga0068858_100127874 3300005842 Bacteria 2381
110 Ga0068858_100152464 3300005842 Bacteria 2173
111 Ga0068860_100609523 3300005843 Bacteria 1098
112 Ga0068860_100738375 3300005843 Bacteria 996
113 Ga0068862_100254193 3300005844 Bacteria 1602
114 Ga0081455_10028453 3300005937 Bacteria 5107
115 Ga0081455_10135221 3300005937 Bacteria 1922
116 Ga0081538_10000164 3300005981 Bacteria 70649
117 Ga0081538_10016872 3300005981 Bacteria 5571
118 Ga0081540_1000899 3300005983 Bacteria 26887
119 Ga0081540_1003032 3300005983 Bacteria 13460
120 Ga0081540_1006217 3300005983 Bacteria 8753
121 Ga0081539_10001103 3300005985 Bacteria 49011
122 Ga0070717_10029110 3300006028 Bacteria 4428
123 Ga0070717_10061970 3300006028 Bacteria 3101
124 Ga0070717_10134871 3300006028 Bacteria 2125
125 Ga0070717_10168212 3300006028 Bacteria 1905
126 Ga0075365_10013426 3300006038 Bacteria 4898
127 Ga0070715_10000123 3300006163 Bacteria 18279
128 Ga0070715_10022835 3300006163 Bacteria 2443
129 Ga0070715_10148359 3300006163 Bacteria 1146
130 Ga0070716_100003640 3300006173 Bacteria 7288
131 Ga0070716_100003932 3300006173 Bacteria 7050
132 Ga0070716_100005576 3300006173 Bacteria 6108
133 Ga0070716_100318577 3300006173 Bacteria 1089
134 Ga0070712_100007256 3300006175 Bacteria 6917
135 Ga0070712_100057437 3300006175 Bacteria 2734
136 Ga0070712_100134529 3300006175 Bacteria 1878
137 Ga0070712_100171288 3300006175 Bacteria 1685
138 Ga0068871_100395030 3300006358 Bacteria 1231
139 Ga0075428_100028887 3300006844 Bacteria 6137
140 Ga0075428_100064273 3300006844 Bacteria 4018
141 Ga0075428_100171207 3300006844 Bacteria 2353
142 Ga0075430_100057846 3300006846 Bacteria 3260
143 Ga0075431_100409703 3300006847 Unclassified 1356
144 Ga0075431_100538854 3300006847 Bacteria 1155
145 Ga0075433_10025267 3300006852 Bacteria 5019
146 Ga0075433_10232848 3300006852 Bacteria 1636
147 Ga0075433_10334884 3300006852 Bacteria 1338
148 Ga0075434_100083111 3300006871 Bacteria 3199
149 Ga0075434_100162188 3300006871 Bacteria 2255
150 Ga0068865_100010811 3300006881 Bacteria 5694
151 Ga0068865_100070799 3300006881 Bacteria 2472
152 Ga0068865_100381923 3300006881 Bacteria 1149
153 Ga0075436_100312687 3300006914 Bacteria 1127
154 Ga0097620_100065398 3300006931 Bacteria 3670
155 Ga0097620_100544111 3300006931 Bacteria 1256
156 Ga0097620_100615591 3300006931 Bacteria 1179
157 Ga0097620_100853679 3300006931 Bacteria 996
158 Ga0075435_100028064 3300007076 Bacteria 4411
159 Ga0075435_100065498 3300007076 Bacteria 2954
160 Ga0075435_100236066 3300007076 Bacteria 1554
161 Ga0099794_10035260 3300007265 Bacteria 2360
162 Ga0105240_10015460 3300009093 Bacteria 10376
163 Ga0105240_10097667 3300009093 Bacteria 3579
164 Ga0105240_10878736 3300009093 Bacteria 966
165 Ga0111539_10050481 3300009094 Bacteria 4956
166 Ga0105245_10000349 3300009098 Bacteria 43123
167 Ga0105245_10034746 3300009098 Bacteria 4472
168 Ga0105245_10046963 3300009098 Bacteria 3859
169 Ga0105245_10145587 3300009098 Bacteria 2235
170 Ga0105245_10927385 3300009098 Bacteria 913
171 Ga0114129_10032793 3300009147 Bacteria 7339
172 Ga0114129_10129814 3300009147 Bacteria 3462
173 Ga0114129_10547322 3300009147 Bacteria 1506
174 Ga0114129_10603029 3300009147 Bacteria 1422
175 Ga0105243_10119360 3300009148 Bacteria 2220
176 Ga0105243_10127802 3300009148 Bacteria 2152
177 Ga0105242_10030706 3300009176 Bacteria 4291
178 Ga0105242_10068219 3300009176 Bacteria 2942
179 Ga0105242_10427234 3300009176 Bacteria 1243
180 Ga0105248_10186482 3300009177 Bacteria 2337
181 Ga0105237_10254542 3300009545 Bacteria 1758
182 Ga0105238_10125123 3300009551 Bacteria 2550
183 Ga0105238_10259858 3300009551 Bacteria 1716
184 Ga0105249_10023116 3300009553 Bacteria 5575
185 Ga0105249_10088129 3300009553 Bacteria 2898
186 Ga0105249_10500778 3300009553 Bacteria 1260
187 Ga0099796_10035647 3300010159 Bacteria 1652
188 Ga0099796_10136820 3300010159 Bacteria 954
189 Ga0105239_10015949 3300010375 Bacteria 8315
190 Ga0105239_10210188 3300010375 Bacteria 2181
191 Ga0105239_10223937 3300010375 Bacteria 2109
192 Ga0105239_10284295 3300010375 Bacteria 1862
193 Ga0105239_10775311 3300010375 Bacteria 1098
194 Ga0105246_10194023 3300011119 Bacteria 1574
195 Ga0105246_10194269 3300011119 Bacteria 1573
196 Ga0105246_10542655 3300011119 Bacteria 995
197 Ga0157371_10140646 3300013102 Bacteria 1719
198 Ga0157370_10111428 3300013104 Bacteria 2558
199 Ga0157369_10004377 3300013105 Bacteria 16674
200 Ga0157369_10276147 3300013105 Bacteria 1750
201 Ga0157374_10010251 3300013296 Bacteria 8059
202 Ga0157374_10122827 3300013296 Bacteria 2508
203 Ga0157374_10391945 3300013296 Bacteria 1384
204 Ga0157374_10483519 3300013296 Bacteria 1241
205 Ga0157378_10269479 3300013297 Bacteria 1637
206 Ga0163162_10110853 3300013306 Bacteria 2841
207 Ga0163162_10194392 3300013306 Bacteria 2157
208 Ga0163162_10364587 3300013306 Bacteria 1578
209 Ga0157372_10555431 3300013307 Bacteria 1338
210 Ga0157372_10998883 3300013307 Bacteria 969
211 Ga0157375_10029955 3300013308 Bacteria 5125
212 Ga0157375_10039470 3300013308 Bacteria 4545
213 Ga0157375_10485377 3300013308 Bacteria 1400
214 Ga0163163_10006935 3300014325 Bacteria 9950
215 Ga0163163_10329523 3300014325 Bacteria 1581
216 Ga0157380_10029651 3300014326 Bacteria 4183
217 Ga0157380_10171748 3300014326 Bacteria 1895
218 Ga0157377_10050221 3300014745 Bacteria 2348
219 Ga0157377_10297977 3300014745 Bacteria 1063
220 Ga0157379_10019136 3300014968 Bacteria 6045
221 Ga0157379_10177276 3300014968 Bacteria 1925
222 Ga0157376_10079947 3300014969 Bacteria 2803
223 Ga0157376_10458362 3300014969 Bacteria 1245
224 Ga0163161_10221873 3300017792 Bacteria 1464
225 Ga0163161_10608135 3300017792 Bacteria 902
226 Ga0213872_10111300 3300021361 Bacteria 1216
227 Ga0213874_10006780 3300021377 Bacteria 2724
228 Ga0213874_10011735 3300021377 Bacteria 2229
229 Ga0213876_10031936 3300021384 Bacteria 2777
230 Ga0213876_10044747 3300021384 Bacteria 2340
231 Ga0213875_10003144 3300021388 Bacteria 9493
232 Ga0224572_1030175 3300024225 Bacteria 1036
233 Ga0207426_1000338 3300025302 Bacteria 88019
234 Ga0207692_10002398 3300025898 Bacteria 7196
235 Ga0207692_10017043 3300025898 Bacteria 3232
236 Ga0207692_10025377 3300025898 Bacteria 2767
237 Ga0207642_10195787 3300025899 Bacteria 1112
238 Ga0207710_10018937 3300025900 Bacteria 2933
239 Ga0207688_10007600 3300025901 Bacteria 5900
240 Ga0207688_10010699 3300025901 Bacteria 4992
241 Ga0207688_10011602 3300025901 Bacteria 4793
242 Ga0207688_10147630 3300025901 Bacteria 1387
243 Ga0207680_10298475 3300025903 Bacteria 1122
244 Ga0207647_10015424 3300025904 Bacteria 5239
245 Ga0207685_10001830 3300025905 Bacteria 4651
246 Ga0207685_10202908 3300025905 Bacteria 933
247 Ga0207699_10000732 3300025906 Bacteria 15674
248 Ga0207699_10153502 3300025906 Bacteria 1526
249 Ga0207645_10060253 3300025907 Bacteria 2423
250 Ga0207684_10000057 3300025910 Bacteria 211445
251 Ga0207654_10038903 3300025911 Bacteria 2672
252 Ga0207707_10067474 3300025912 Bacteria 3116
253 Ga0207695_10035518 3300025913 Bacteria 5404
254 Ga0207671_10033788 3300025914 Bacteria 3804
255 Ga0207671_10046031 3300025914 Bacteria 3227
256 Ga0207693_10000858 3300025915 Bacteria 27136
257 Ga0207693_10003884 3300025915 Bacteria 12729
258 Ga0207693_10014424 3300025915 Bacteria 6355
259 Ga0207693_10025047 3300025915 Bacteria 4733
260 Ga0207693_10068065 3300025915 Bacteria 2787
261 Ga0207693_10186708 3300025915 Bacteria 1631
262 Ga0207693_10310510 3300025915 Bacteria 1235
263 Ga0207663_10015976 3300025916 Bacteria 4153
264 Ga0207662_10036669 3300025918 Bacteria 2867
265 Ga0207662_10184002 3300025918 Bacteria 1346
266 Ga0207662_10280581 3300025918 Bacteria 1102
267 Ga0207657_10108524 3300025919 Bacteria 2294
268 Ga0207646_10099035 3300025922 Bacteria 2613
269 Ga0207646_10137208 3300025922 Bacteria 2202
270 Ga0207646_10249714 3300025922 Bacteria 1603
271 Ga0207694_10392551 3300025924 Bacteria 1153
272 Ga0207694_10406566 3300025924 Bacteria 1132
273 Ga0207659_10056995 3300025926 Bacteria 2800
274 Ga0207687_10102959 3300025927 Bacteria 2104
275 Ga0207687_10150326 3300025927 Bacteria 1776
276 Ga0207687_10425536 3300025927 Bacteria 1096
277 Ga0207700_10000768 3300025928 Bacteria 18533
278 Ga0207700_10051824 3300025928 Bacteria 3065
279 Ga0207700_10147041 3300025928 Bacteria 1943
280 Ga0207664_10003433 3300025929 Bacteria 10565
281 Ga0207664_10041843 3300025929 Bacteria 3572
282 Ga0207664_10100504 3300025929 Bacteria 2388
283 Ga0207664_10184243 3300025929 Bacteria 1794
284 Ga0207644_10187339 3300025931 Bacteria 1625
285 Ga0207690_10130796 3300025932 Unclassified 1837
286 Ga0207690_10199922 3300025932 Bacteria 1517
287 Ga0207706_10016552 3300025933 Bacteria 6657
288 Ga0207686_10638660 3300025934 Bacteria 841
289 Ga0207709_10017698 3300025935 Bacteria 3981
290 Ga0207709_10052828 3300025935 Bacteria 2498
291 Ga0207670_10104726 3300025936 Bacteria 2027
292 Ga0207670_10249832 3300025936 Bacteria 1370
293 Ga0207669_10088692 3300025937 Bacteria 2007
294 Ga0207669_10100209 3300025937 Bacteria 1913
295 Ga0207704_10012876 3300025938 Bacteria 4165
296 Ga0207704_10380826 3300025938 Bacteria 1107
297 Ga0207665_10000295 3300025939 Bacteria 34463
298 Ga0207665_10001054 3300025939 Bacteria 18538
299 Ga0207665_10002473 3300025939 Bacteria 12456
300 Ga0207691_10125139 3300025940 Bacteria 2275
301 Ga0207691_10334475 3300025940 Bacteria 1297
302 Ga0207711_10190376 3300025941 Bacteria 1869
303 Ga0207689_10007773 3300025942 Bacteria 9382
304 Ga0207689_10025096 3300025942 Bacteria 4997
305 Ga0207661_10132093 3300025944 Bacteria 2140
306 Ga0207679_10605668 3300025945 Bacteria 988
307 Ga0207667_10045205 3300025949 Bacteria 4665
308 Ga0207667_10530235 3300025949 Bacteria 1192
309 Ga0207712_10218062 3300025961 Bacteria 1524
310 Ga0207712_10551176 3300025961 Bacteria 992
311 Ga0207668_10088598 3300025972 Bacteria 2267
312 Ga0207668_10224748 3300025972 Bacteria 1510
313 Ga0207677_10088023 3300026023 Bacteria 2250
314 Ga0207677_10140191 3300026023 Bacteria 1850
315 Ga0207677_10150718 3300026023 Bacteria 1794
316 Ga0207703_10069054 3300026035 Bacteria 2913
317 Ga0207703_10130216 3300026035 Bacteria 2172
318 Ga0207703_10148503 3300026035 Bacteria 2041
319 Ga0207639_10249534 3300026041 Bacteria 1547
320 Ga0207678_10041690 3300026067 Bacteria 3980
321 Ga0207708_10016011 3300026075 Bacteria 5630
322 Ga0207708_10046739 3300026075 Bacteria 3296
323 Ga0207708_10073635 3300026075 Bacteria 2618
324 Ga0207708_10085518 3300026075 Bacteria 2426
325 Ga0207702_10012962 3300026078 Bacteria 6935
326 Ga0207702_10144471 3300026078 Bacteria 2157
327 Ga0207648_10257323 3300026089 Bacteria 1557
328 Ga0207675_100004804 3300026118 Bacteria 13013
329 Ga0207675_100048874 3300026118 Bacteria 3948
330 Ga0207675_100218762 3300026118 Bacteria 1834
331 Ga0207683_10012504 3300026121 Bacteria 7241
332 Ga0207683_10099480 3300026121 Bacteria 2595
333 Ga0207698_10950969 3300026142 Bacteria 868
334 Ga0207428_10238587 3300027907 Bacteria 1359
335 Ga0268266_10036496 3300028379 Bacteria 4184
336 Ga0268266_10145780 3300028379 Bacteria 2129
337 Ga0268264_10931476 3300028381 Bacteria 873
338 Ga0265319_1002339 3300028563 Bacteria 10442
339 Ga0265318_10000871 3300028577 Bacteria 19786
340 Ga0265336_10020437 3300028666 Bacteria 2124
341 Ga0265336_10025198 3300028666 Bacteria 1875
342 Ga0265338_10463666 3300028800 Bacteria 896
343 Ga0265762_1000138 3300030760 Bacteria 11024
344 Ga0265330_10002272 3300031235 Bacteria 10571
345 Ga0265332_10003481 3300031238 Bacteria 7581
346 Ga0265332_10106313 3300031238 Bacteria 1183
347 Ga0265328_10004434 3300031239 Bacteria 6097
348 Ga0265328_10016783 3300031239 Bacteria 2844
349 Ga0265328_10048642 3300031239 Bacteria 1558
350 Ga0265328_10057943 3300031239 Bacteria 1423
351 Ga0265320_10001267 3300031240 Bacteria 18515
352 Ga0265320_10004651 3300031240 Bacteria 8962
353 Ga0265320_10030216 3300031240 Bacteria 2796
354 Ga0265325_10023802 3300031241 Bacteria 3338
355 Ga0265325_10063866 3300031241 Bacteria 1862
356 Ga0265329_10008572 3300031242 Bacteria 3868
357 Ga0265329_10024398 3300031242 Bacteria 2008
358 Ga0265340_10005525 3300031247 Bacteria 7013
359 Ga0265340_10029282 3300031247 Bacteria 2766
360 Ga0265340_10037048 3300031247 Bacteria 2417
361 Ga0265340_10112655 3300031247 Bacteria 1256
362 Ga0265339_10010236 3300031249 Bacteria 5836
363 Ga0265339_10018415 3300031249 Bacteria 4117
364 Ga0265339_10059372 3300031249 Bacteria 2063
365 Ga0265339_10073120 3300031249 Bacteria 1823
366 Ga0265339_10089697 3300031249 Bacteria 1614
367 Ga0265331_10002952 3300031250 Bacteria 11209
368 Ga0265331_10023865 3300031250 Bacteria 3100
369 Ga0265316_10003325 3300031344 Bacteria 16292
370 Ga0265316_10003640 3300031344 Bacteria 15522
371 Ga0307513_10000449 3300031456 Bacteria 59327
372 Ga0265313_10000743 3300031595 Bacteria 33467
373 Ga0307508_10007883 3300031616 Bacteria 9881
374 Ga0265314_10013381 3300031711 Bacteria 6629
375 Ga0265314_10027869 3300031711 Bacteria 4221
376 Ga0265314_10045859 3300031711 Bacteria 3087
377 Ga0265342_10002332 3300031712 Bacteria 16491
378 Ga0265342_10007189 3300031712 Bacteria 8190
379 Ga0265342_10037894 3300031712 Bacteria 2938
380 Ga0265342_10188694 3300031712 Bacteria 1126
381 Ga0307516_10031016 3300031730 Bacteria 5392
382 Ga0307406_10397178 3300031901 Bacteria 1092
383 Ga0307414_10187301 3300032004 Bacteria 1671
384 Ga0373959_0014325 3300034820 Bacteria 1442
385 Ga0373928_0004556 3300035084 Bacteria 2642
386 Ga0373934_0129680 3300035086 Bacteria 1028
387 Ga0373934_0138212 3300035086 Bacteria 996
388 Ga0373949_0035469 3300035090 Bacteria 1206
389 Ga0373951_0006499 3300035091 Bacteria 2674
390 Ga0373932_0046855 3300035112 Bacteria 1269
391 Ga0373939_0011932 3300035114 Bacteria 2205
392 Ga0373939_0067180 3300035114 Bacteria 1158
393 Ga0373945_0101275 3300035116 Bacteria 1127
394 Ga0373945_0160471 3300035116 Bacteria 916
395 Ga0373956_0221616 3300035119 Bacteria 898
396 Ga0373943_0081024 3300035170 Bacteria 1664
397 Ga0373943_0271006 3300035170 Bacteria 958
398 Ga0373955_0176223 3300035172 Bacteria 1267
399 Ga0373931_0030022 3300035691 Bacteria 2796
400 Ga0373931_0052020 3300035691 Bacteria 2183
401 Ga0373935_0052078 3300035692 Bacteria 2601
402 Ga0373935_0221372 3300035692 Bacteria 1315
403 Ga0373927_0014442 3300035695 Bacteria 5226
404 Ga0373927_0101562 3300035695 Bacteria 1871
405 Ga0373927_0257860 3300035695 Bacteria 1146
406 Ga0373947_0048363 3300035725 Bacteria 2552
407 Ga0373947_0101569 3300035725 Bacteria 1808
408 Ga0373937_0001838 3300036401 Bacteria 17833
409 Ga0373937_0589901 3300036401 Bacteria 1055
410 Ga0373937_0691817 3300036401 Bacteria 966
411 Ga0373937_0845381 3300036401 Bacteria 864
412 Ga0372808_007765 3300036459 Bacteria 1474
413 Ga0373925_0023788 3300037068 Bacteria 4469
414 Ga0373925_0182976 3300037068 Bacteria 1660
415 Ga0436364_0431017 3300037853 Bacteria 22054
416 Ga0436364_0968611 3300037853 Bacteria 2956
417 Ga0436364_1200640 3300037853 Bacteria 136867
418 Ga0436365_0094053 3300039437 Bacteria 6733
419 Ga0436365_0945109 3300039437 Bacteria 32440
420 Ga0436365_0946849 3300039437 Bacteria 13502
421 Ga0436365_1067840 3300039437 Bacteria 2507
422 Ga0436365_1415757 3300039437 Bacteria 2855
423 Ga0436360_0414801 3300039438 Bacteria 1069
424 Ga0436360_1018729 3300039438 Bacteria 5018
425 Ga0436360_1025225 3300039438 Bacteria 1498
426 Ga0436360_1192393 3300039438 Bacteria 1299
427 Ga0436361_0506920 3300039447 Bacteria 3468
428 Ga0436361_0866371 3300039447 Bacteria 1604
429 Ga0436363_0334779 3300039450 Bacteria 1228
430 Ga0436363_0404864 3300039450 Bacteria 2992
431 Ga0436363_0580471 3300039450 Bacteria 3464
432 Ga0436363_0582276 3300039450 Bacteria 5531
433 Ga0436363_1009783 3300039450 Bacteria 2466
434 Ga0436363_1062642 3300039450 Bacteria 2010
435 Ga0436362_1177447 3300039453 Bacteria 2187
436 Ga0451787_583270 3300041441 Bacteria 1424
437 Ga0451791_0638525 3300041451 Bacteria 2411
438 Ga0451793_0197349 3300041452 Bacteria 4854
439 Ga0451843_0015741 3300041509 Bacteria 6943
440 Ga0451853_0099109 3300041512 Bacteria 3530
441 Ga0439463_006034 3300042016 Bacteria 3009
442 Ga0439460_0024055 3300042461 Bacteria 1684
443 Ga0451577_0076948 3300042876 Bacteria 2975
444 Ga0466960_0052677 3300044901 Bacteria 1970
445 Ga0451576_0425368 3300045051 Bacteria 1393
446 Ga0466967_0012490 3300045976 Bacteria 6501
447 Ga0466967_0427267 3300045976 Bacteria 1292
448 Ga0466967_0806045 3300045976 Bacteria 932
449 Ga0495603_0032568 3300046455 Bacteria 3136
450 Ga0495629_0052472 3300046459 Bacteria 2853
451 Ga0495641_0004202 3300046461 Bacteria 10325
452 Ga0495651_0005398 3300046462 Bacteria 9753
453 Ga0495651_0114822 3300046462 Bacteria 1986
454 Ga0495651_0186465 3300046462 Bacteria 1463
455 Ga0495653_0106703 3300046463 Bacteria 2019
456 Ga0495653_0181602 3300046463 Bacteria 1443
457 Ga0495580_0025554 3300046472 Bacteria 4316
458 Ga0495580_0114405 3300046472 Bacteria 1874
459 Ga0495580_0144962 3300046472 Bacteria 1646
460 Ga0495580_0234313 3300046472 Bacteria 1260
461 Ga0495582_0139035 3300046473 Bacteria 1375
462 Ga0495594_0076961 3300046499 Bacteria 1861
463 Ga0495610_0033972 3300046512 Bacteria 2630
464 Ga0495618_0046320 3300046514 Bacteria 2745
465 Ga0495628_0007761 3300046516 Bacteria 9249
466 Ga0495630_0099503 3300046517 Bacteria 2200
467 Ga0495666_0049010 3300046526 Bacteria 2032
468 Ga0495652_0244736 3300046529 Bacteria 1332
469 Ga0495665_0006101 3300046531 Bacteria 6505
470 Ga0495665_0042252 3300046531 Bacteria 2427
471 Ga0495665_0087041 3300046531 Bacteria 1642
472 Ga0495640_0034368 3300046533 Bacteria 3596
473 Ga0495640_0098518 3300046533 Bacteria 1921
474 Ga0495587_0046236 3300046536 Bacteria 2584
475 Ga0495587_0068817 3300046536 Bacteria 2062
476 Ga0495587_0144636 3300046536 Bacteria 1356
477 Ga0495645_0006956 3300046543 Bacteria 7861
478 Ga0495645_0011793 3300046543 Bacteria 6157
479 Ga0495645_0103048 3300046543 Bacteria 2028
480 Ga0495645_0119599 3300046543 Bacteria 1856
481 Ga0495634_0022854 3300046642 Bacteria 4403
482 Ga0495634_0047610 3300046642 Bacteria 2888
483 Ga0495634_0069905 3300046642 Bacteria 2315
484 Ga0495634_0207631 3300046642 Bacteria 1214
485 Ga0495611_0025053 3300046648 Bacteria 2598
486 Ga0495599_0021035 3300046678 Bacteria 4067
487 Ga0495623_0162202 3300046679 Bacteria 1313
488 Ga0495646_0133421 3300046680 Bacteria 1396
489 Ga0495647_0046113 3300046681 Bacteria 1677
490 Ga0495613_0028247 3300046689 Bacteria 4172
491 Ga0495613_0051462 3300046689 Bacteria 3034
492 Ga0495613_0096527 3300046689 Bacteria 2137
493 Ga0495649_0286830 3300046694 Bacteria 840
494 Ga0495600_0013425 3300046809 Bacteria 5148
495 Ga0495600_0019378 3300046809 Bacteria 4345
496 Ga0495600_0059905 3300046809 Bacteria 2486
497 Ga0495600_0096063 3300046809 Bacteria 1932
498 Ga0495600_0393790 3300046809 Bacteria 863
499 Ga0495581_0044966 3300047315 Bacteria 2553
500 Ga0495581_0238040 3300047315 Bacteria 1064
501 Ga0495604_0004052 3300047317 Bacteria 11642
502 Ga0495604_0037241 3300047317 Bacteria 3831
503 Ga0495604_0085546 3300047317 Bacteria 2353
504 Ga0495674_0035803 3300047319 Bacteria 4475
505 Ga0495674_0060002 3300047319 Bacteria 3320
506 Ga0495674_0390688 3300047319 Bacteria 1124
507 Ga0495672_0006403 3300047320 Bacteria 9137
508 Ga0495672_0094369 3300047320 Bacteria 1636
509 Ga0495680_0026971 3300047322 Bacteria 4727
510 Ga0495680_0043197 3300047322 Bacteria 3570
511 Ga0495683_0084632 3300047323 Bacteria 1543
512 Ga0495675_0149599 3300047444 Bacteria 1443
513 Ga0495684_0032729 3300047471 Bacteria 3994
514 Ga0495684_0033038 3300047471 Bacteria 3972
515 Ga0495686_0062166 3300047472 Bacteria 2317
516 Ga0495593_0099602 3300047673 Bacteria 1491
517 Ga0495602_0234093 3300048088 Bacteria 1378
518 Ga0495614_0046273 3300048089 Bacteria 1865
519 Ga0496100_0004921 3300048903 Bacteria 7137
520 Ga0496100_0073496 3300048903 Bacteria 2288
521 Ga0496100_0199019 3300048903 Bacteria 1459
522 Ga0496102_0006074 3300048905 Bacteria 10297
523 Ga0496102_0018239 3300048905 Bacteria 6163
524 Ga0496102_0036536 3300048905 Bacteria 4426
525 Ga0496102_0039365 3300048905 Bacteria 4271
526 Ga0496102_0268974 3300048905 Bacteria 1607
527 Ga0496102_0585336 3300048905 Bacteria 1039
528 Ga0496103_0019360 3300048906 Bacteria 4087
529 Ga0496103_0035917 3300048906 Bacteria 3034
530 Ga0496104_0033075 3300048907 Bacteria 4814
531 Ga0496104_0135873 3300048907 Bacteria 2362
532 Ga0496104_0147075 3300048907 Bacteria 2263
533 Ga0496105_0007376 3300048908 Bacteria 8511
534 Ga0496105_0090577 3300048908 Bacteria 2526
535 Ga0496105_0102174 3300048908 Bacteria 2367
536 Ga0496106_0237673 3300048909 Bacteria 1455
537 Ga0496106_0305697 3300048909 Bacteria 1276
538 Ga0496106_0327949 3300048909 Bacteria 1229
539 Ga0496106_0412372 3300048909 Bacteria 1086
540 Ga0496106_0549645 3300048909 Bacteria 926
541 Ga0496107_0000328 3300048910 Bacteria 25679
542 Ga0496107_0035025 3300048910 Bacteria 3599
543 Ga0496107_0123012 3300048910 Bacteria 1912
544 Ga0496107_0123081 3300048910 Bacteria 1911
545 Ga0496108_0026959 3300048911 Bacteria 4742
546 Ga0496108_0115242 3300048911 Bacteria 2301
547 Ga0496108_0157745 3300048911 Bacteria 1960
548 Ga0496109_0053145 3300048912 Bacteria 3693
549 Ga0496109_0142220 3300048912 Bacteria 2244
550 Ga0496110_0129717 3300048913 Bacteria 2276
551 Ga0496111_0023969 3300048914 Bacteria 4290
552 Ga0496111_0067686 3300048914 Bacteria 2594
553 Ga0496111_0212547 3300048914 Bacteria 1437
554 Ga0496112_0139510 3300048915 Bacteria 2393
555 Ga0496112_0298003 3300048915 Bacteria 1558
556 Ga0496113_0054946 3300048916 Bacteria 2983
557 Ga0496113_0064822 3300048916 Bacteria 2763
558 Ga0496114_0018574 3300048917 Bacteria 5624
559 Ga0496114_0226933 3300048917 Bacteria 1640
560 Ga0496115_0010394 3300048918 Bacteria 6952
561 Ga0496115_0105272 3300048918 Bacteria 2315
562 Ga0496115_0165134 3300048918 Bacteria 1831
563 Ga0496115_0195264 3300048918 Bacteria 1672
564 Ga0496115_0290022 3300048918 Bacteria 1342
565 Ga0496115_0377917 3300048918 Bacteria 1153
566 Ga0496119_0000252 3300048922 Bacteria 75901
567 Ga0496121_0220272 3300048924 Bacteria 1337
568 Ga0496122_0001427 3300048925 Bacteria 38717
569 Ga0496123_0002152 3300048926 Bacteria 25168
570 Ga0496126_0001732 3300048929 Bacteria 32376
571 Ga0501033_0025654 3300049570 Bacteria 4440
572 Ga0501047_0349671 3300049581 Bacteria 1315
573 Ga0501068_0014358 3300049584 Bacteria 4526
574 Ga0501068_0263346 3300049584 Bacteria 1100
575 Ga0501044_0002478 3300049823 Bacteria 21065
576 nmdc:mga05p37_296225_c1 3300050507 Bacteria 1924
577 nmdc:mga05p37_339820_c1 3300050507 Bacteria 1771
578 nmdc:mga05p37_343183_c1 3300050507 Bacteria 1760
579 nmdc:mga09592_403330_c1 3300050508 Bacteria 1182
580 nmdc:mga0qj67_382849_c1 3300050509 Bacteria 1136
581 nmdc:mga0qj67_74622_c1 3300050509 Bacteria 2710
582 nmdc:mga08y16_111437_c1 3300050511 Bacteria 2848
583 nmdc:mga08y16_150711_c1 3300050511 Bacteria 2417
584 nmdc:mga0n895_17826_c1 3300050512 Bacteria 6556
585 nmdc:mga0n895_44849_c1 3300050512 Bacteria 4312
586 nmdc:mga0n895_513930_c1 3300050512 Bacteria 1206
587 nmdc:mga0rr50_191375_c1 3300050513 Bacteria 1677
588 nmdc:mga0rr50_390287_c1 3300050513 Bacteria 1175
589 nmdc:mga0rr50_619426_c1 3300050513 Bacteria 923
590 nmdc:mga0a205_217208_c1 3300050515 Bacteria 1799
591 nmdc:mga0a205_76319_c1 3300050515 Bacteria 3238
592 Ga0495601_0092828 3300053077 Bacteria 1944
593 Ga0495601_0160253 3300053077 Bacteria 1470
594 Ga0495595_0273182 3300053084 Bacteria 848
595 Ga0495619_0181867 3300053085 Bacteria 1455
596 Ga0500556_0000036 3300053104 Bacteria 144864
597 Ga0500652_001999 3300053131 Bacteria 6142
598 Ga0500573_0009071 3300053140 Bacteria 5503
599 Ga0500590_051182 3300053148 Bacteria 2099
600 Ga0500616_0051573 3300053153 Bacteria 2167
601 Ga0500627_0096532 3300053158 Bacteria 1325
602 Ga0501084_0385589 3300054114 Bacteria 1184
603 Ga0587083_0018492 3300059505 Bacteria 1261
604 Ga0587071_029063 3300060344 Bacteria 1055
605 2515853407 2515154155 Bacteria 7985436
606 2862516704 2862507626 Bacteria 9425308
607 Ga0436365_0760973
608 JGI24737J22298_10087042
609 JGI24743J22301_10036976
610 JGI25407J50210_10021380
611 Ga0070683_100500538
612 Ga0070690_100252816
613 Ga0068869_100116852
614 Ga0070682_100313006
615 Ga0070682_100418777
616 Ga0068868_100075054
617 Ga0068868_100132542
618 Ga0068868_100141758
619 Ga0068868_100197167
620 Ga0070660_100059664
621 Ga0070689_100055356
622 Ga0070691_10018824
623 Ga0070687_100109300
624 Ga0070692_10014173
625 Ga0070692_10063513
626 Ga0070668_100048519
627 Ga0070668_100102631
628 Ga0070668_100405158
629 Ga0070669_100234441
630 Ga0070675_100090680
631 Ga0070671_100057527
632 Ga0070674_100292227
633 Ga0070673_100020662
634 Ga0070673_100468981
635 Ga0070688_100010158
636 Ga0070688_100124542
637 Ga0070659_100125563
638 Ga0070709_10002020
639 Ga0070714_100071706
640 Ga0070714_100080455
641 Ga0070714_100087411
642 Ga0070714_100272054
643 Ga0070714_100286438
644 Ga0070713_100121777
645 Ga0070710_10004312
646 Ga0070710_10026305
647 Ga0070710_10032460
648 Ga0070710_10034270
649 Ga0070710_10502996
650 Ga0070711_100001280
651 Ga0070711_100001651
652 Ga0070711_100023876
653 Ga0070705_100096014
654 Ga0070700_100230205
655 Ga0070708_100001428
656 Ga0070678_100211220
657 Ga0070678_100253141
658 Ga0070678_100346196
659 Ga0070678_100635476
660 Ga0070662_100103506
661 Ga0068867_100317055
662 Ga0068867_100509950
663 Ga0070685_10177541
664 Ga0070706_100000113
665 Ga0070706_100114324
666 Ga0070706_100159830
667 Ga0070707_100071575
668 Ga0070707_100133383
669 Ga0070707_100174564
670 Ga0070707_100335028
671 Ga0070699_100003900
672 Ga0070699_100097275
673 Ga0070699_100118907
674 Ga0070699_100328818
675 Ga0070697_100022401
676 Ga0070697_100050966
677 Ga0070697_100120329
678 Ga0070697_100282841
679 Ga0068853_100159794
680 Ga0068853_100162601
681 Ga0068853_100658066
682 Ga0070672_100181612
683 Ga0070686_100023288
684 Ga0070695_100084969
685 Ga0070696_100129374
686 Ga0070696_100292767
687 Ga0070696_100303342
688 Ga0070696_100316279
689 Ga0070665_100084007
690 Ga0070665_100118906
691 Ga0070665_100147693
692 Ga0070665_100156365
693 Ga0070704_100015851
694 Ga0070704_100184416
695 Ga0070704_100355125
696 Ga0068855_100047702
697 Ga0068855_100104481
698 Ga0068855_100410635
699 Ga0070664_100609452
700 Ga0068854_100127796
701 Ga0068854_100274827
702 Ga0068856_100086643
703 Ga0070702_100004209
704 Ga0068852_100128490
705 Ga0068859_100065398
706 Ga0068859_100544121
707 Ga0068859_100615610
708 Ga0068859_100853690
709 Ga0068864_100055597
710 Ga0068864_100529905
711 Ga0068864_100583956
712 Ga0068861_100063106
713 Ga0068861_100139577
714 Ga0068851_10052306
715 Ga0068858_100127874
716 Ga0068858_100152464
717 Ga0068860_100609523
718 Ga0068860_100738375
719 Ga0068862_100254193
720 Ga0081455_10028453
721 Ga0081455_10135221
722 Ga0081538_10000164
723 Ga0081538_10016872
724 Ga0081540_1000899
725 Ga0081540_1003032
726 Ga0081540_1006217
727 Ga0081539_10001103
728 Ga0070717_10029110
729 Ga0070717_10061970
730 Ga0070717_10134871
731 Ga0070717_10168212
732 Ga0075365_10013426
733 Ga0070715_10000123
734 Ga0070715_10022835
735 Ga0070715_10148359
736 Ga0070716_100003640
737 Ga0070716_100003932
738 Ga0070716_100005576
739 Ga0070716_100318577
740 Ga0070712_100007256
741 Ga0070712_100057437
742 Ga0070712_100134529
743 Ga0070712_100171288
744 Ga0068871_100395030
745 Ga0075428_100028887
746 Ga0075428_100064273
747 Ga0075428_100171207
748 Ga0075430_100057846
749 Ga0075431_100409703
750 Ga0075431_100538854
751 Ga0075433_10025267
752 Ga0075433_10232848
753 Ga0075433_10334884
754 Ga0075434_100083111
755 Ga0075434_100162188
756 Ga0068865_100010811
757 Ga0068865_100070799
758 Ga0068865_100381923
759 Ga0075436_100312687
760 Ga0097620_100065398
761 Ga0097620_100544111
762 Ga0097620_100615591
763 Ga0097620_100853679
764 Ga0075435_100028064
765 Ga0075435_100065498
766 Ga0075435_100236066
767 Ga0099794_10035260
768 Ga0105240_10015460
769 Ga0105240_10097667
770 Ga0105240_10878736
771 Ga0111539_10050481
772 Ga0105245_10000349
773 Ga0105245_10034746
774 Ga0105245_10046963
775 Ga0105245_10145587
776 Ga0105245_10927385
777 Ga0114129_10032793
778 Ga0114129_10129814
779 Ga0114129_10547322
780 Ga0114129_10603029
781 Ga0105243_10119360
782 Ga0105243_10127802
783 Ga0105242_10030706
784 Ga0105242_10068219
785 Ga0105242_10427234
786 Ga0105248_10186482
787 Ga0105237_10254542
788 Ga0105238_10125123
789 Ga0105238_10259858
790 Ga0105249_10023116
791 Ga0105249_10088129
792 Ga0105249_10500778
793 Ga0099796_10035647
794 Ga0099796_10136820
795 Ga0105239_10015949
796 Ga0105239_10210188
797 Ga0105239_10223937
798 Ga0105239_10284295
799 Ga0105239_10775311
800 Ga0105246_10194023
801 Ga0105246_10194269
802 Ga0105246_10542655
803 Ga0157371_10140646
804 Ga0157370_10111428
805 Ga0157369_10004377
806 Ga0157369_10276147
807 Ga0157374_10010251
808 Ga0157374_10122827
809 Ga0157374_10391945
810 Ga0157374_10483519
811 Ga0157378_10269479
812 Ga0163162_10110853
813 Ga0163162_10194392
814 Ga0163162_10364587
815 Ga0157372_10555431
816 Ga0157372_10998883
817 Ga0157375_10029955
818 Ga0157375_10039470
819 Ga0157375_10485377
820 Ga0163163_10006935
821 Ga0163163_10329523
822 Ga0157380_10029651
823 Ga0157380_10171748
824 Ga0157377_10050221
825 Ga0157377_10297977
826 Ga0157379_10019136
827 Ga0157379_10177276
828 Ga0157376_10079947
829 Ga0157376_10458362
830 Ga0163161_10221873
831 Ga0163161_10608135
832 Ga0213872_10111300
833 Ga0213874_10006780
834 Ga0213874_10011735
835 Ga0213876_10031936
836 Ga0213876_10044747
837 Ga0213875_10003144
838 Ga0224572_1030175
839 Ga0207426_1000338
840 Ga0207692_10002398
841 Ga0207692_10017043
842 Ga0207692_10025377
843 Ga0207642_10195787
844 Ga0207710_10018937
845 Ga0207688_10007600
846 Ga0207688_10010699
847 Ga0207688_10011602
848 Ga0207688_10147630
849 Ga0207680_10298475
850 Ga0207647_10015424
851 Ga0207685_10001830
852 Ga0207685_10202908
853 Ga0207699_10000732
854 Ga0207699_10153502
855 Ga0207645_10060253
856 Ga0207684_10000057
857 Ga0207654_10038903
858 Ga0207707_10067474
859 Ga0207695_10035518
860 Ga0207671_10033788
861 Ga0207671_10046031
862 Ga0207693_10000858
863 Ga0207693_10003884
864 Ga0207693_10014424
865 Ga0207693_10025047
866 Ga0207693_10068065
867 Ga0207693_10186708
868 Ga0207693_10310510
869 Ga0207663_10015976
870 Ga0207662_10036669
871 Ga0207662_10184002
872 Ga0207662_10280581
873 Ga0207657_10108524
874 Ga0207646_10099035
875 Ga0207646_10137208
876 Ga0207646_10249714
877 Ga0207694_10392551
878 Ga0207694_10406566
879 Ga0207659_10056995
880 Ga0207687_10102959
881 Ga0207687_10150326
882 Ga0207687_10425536
883 Ga0207700_10000768
884 Ga0207700_10051824
885 Ga0207700_10147041
886 Ga0207664_10003433
887 Ga0207664_10041843
888 Ga0207664_10100504
889 Ga0207664_10184243
890 Ga0207644_10187339
891 Ga0207690_10130796
892 Ga0207690_10199922
893 Ga0207706_10016552
894 Ga0207686_10638660
895 Ga0207709_10017698
896 Ga0207709_10052828
897 Ga0207670_10104726
898 Ga0207670_10249832
899 Ga0207669_10088692
900 Ga0207669_10100209
901 Ga0207704_10012876
902 Ga0207704_10380826
903 Ga0207665_10000295
904 Ga0207665_10001054
905 Ga0207665_10002473
906 Ga0207691_10125139
907 Ga0207691_10334475
908 Ga0207711_10190376
909 Ga0207689_10007773
910 Ga0207689_10025096
911 Ga0207661_10132093
912 Ga0207679_10605668
913 Ga0207667_10045205
914 Ga0207667_10530235
915 Ga0207712_10218062
916 Ga0207712_10551176
917 Ga0207668_10088598
918 Ga0207668_10224748
919 Ga0207677_10088023
920 Ga0207677_10140191
921 Ga0207677_10150718
922 Ga0207703_10069054
923 Ga0207703_10130216
924 Ga0207703_10148503
925 Ga0207639_10249534
926 Ga0207678_10041690
927 Ga0207708_10016011
928 Ga0207708_10046739
929 Ga0207708_10073635
930 Ga0207708_10085518
931 Ga0207702_10012962
932 Ga0207702_10144471
933 Ga0207648_10257323
934 Ga0207675_100004804
935 Ga0207675_100048874
936 Ga0207675_100218762
937 Ga0207683_10012504
938 Ga0207683_10099480
939 Ga0207698_10950969
940 Ga0207428_10238587
941 Ga0268266_10036496
942 Ga0268266_10145780
943 Ga0268264_10931476
944 Ga0265319_1002339
945 Ga0265318_10000871
946 Ga0265336_10020437
947 Ga0265336_10025198
948 Ga0265338_10463666
949 Ga0265762_1000138
950 Ga0265330_10002272
951 Ga0265332_10003481
952 Ga0265332_10106313
953 Ga0265328_10004434
954 Ga0265328_10016783
955 Ga0265328_10048642
956 Ga0265328_10057943
957 Ga0265320_10001267
958 Ga0265320_10004651
959 Ga0265320_10030216
960 Ga0265325_10023802
961 Ga0265325_10063866
962 Ga0265329_10008572
963 Ga0265329_10024398
964 Ga0265340_10005525
965 Ga0265340_10029282
966 Ga0265340_10037048
967 Ga0265340_10112655
968 Ga0265339_10010236
969 Ga0265339_10018415
970 Ga0265339_10059372
971 Ga0265339_10073120
972 Ga0265339_10089697
973 Ga0265331_10002952
974 Ga0265331_10023865
975 Ga0265316_10003325
976 Ga0265316_10003640
977 Ga0307513_10000449
978 Ga0265313_10000743
979 Ga0307508_10007883
980 Ga0265314_10013381
981 Ga0265314_10027869
982 Ga0265314_10045859
983 Ga0265342_10002332
984 Ga0265342_10007189
985 Ga0265342_10037894
986 Ga0265342_10188694
987 Ga0307516_10031016
988 Ga0307406_10397178
989 Ga0307414_10187301
990 Ga0373959_0014325
991 Ga0373928_0004556
992 Ga0373934_0129680
993 Ga0373934_0138212
994 Ga0373949_0035469
995 Ga0373951_0006499
996 Ga0373932_0046855
997 Ga0373939_0011932
998 Ga0373939_0067180
999 Ga0373945_0101275
1000 Ga0373945_0160471
1001 Ga0373956_0221616
1002 Ga0373943_0081024
1003 Ga0373943_0271006
1004 Ga0373955_0176223
1005 Ga0373931_0030022
1006 Ga0373931_0052020
1007 Ga0373935_0052078
1008 Ga0373935_0221372
1009 Ga0373927_0014442
1010 Ga0373927_0101562
1011 Ga0373927_0257860
1012 Ga0373947_0048363
1013 Ga0373947_0101569
1014 Ga0373937_0001838
1015 Ga0373937_0589901
1016 Ga0373937_0691817
1017 Ga0373937_0845381
1018 Ga0372808_007765
1019 Ga0373925_0023788
1020 Ga0373925_0182976
1021 Ga0436364_0431017
1022 Ga0436364_0968611
1023 Ga0436364_1200640
1024 Ga0436365_0094053
1025 Ga0436365_0945109
1026 Ga0436365_0946849
1027 Ga0436365_1067840
1028 Ga0436365_1415757
1029 Ga0436360_0414801
1030 Ga0436360_1018729
1031 Ga0436360_1025225
1032 Ga0436360_1192393
1033 Ga0436361_0506920
1034 Ga0436361_0866371
1035 Ga0436363_0334779
1036 Ga0436363_0404864
1037 Ga0436363_0580471
1038 Ga0436363_0582276
1039 Ga0436363_1009783
1040 Ga0436363_1062642
1041 Ga0436362_1177447
1042 Ga0451787_583270
1043 Ga0451791_0638525
1044 Ga0451793_0197349
1045 Ga0451843_0015741
1046 Ga0451853_0099109
1047 Ga0439463_006034
1048 Ga0439460_0024055
1049 Ga0451577_0076948
1050 Ga0466960_0052677
1051 Ga0451576_0425368
1052 Ga0466967_0012490
1053 Ga0466967_0427267
1054 Ga0466967_0806045
1055 Ga0495603_0032568
1056 Ga0495629_0052472
1057 Ga0495641_0004202
1058 Ga0495651_0005398
1059 Ga0495651_0114822
1060 Ga0495651_0186465
1061 Ga0495653_0106703
1062 Ga0495653_0181602
1063 Ga0495580_0025554
1064 Ga0495580_0114405
1065 Ga0495580_0144962
1066 Ga0495580_0234313
1067 Ga0495582_0139035
1068 Ga0495594_0076961
1069 Ga0495610_0033972
1070 Ga0495618_0046320
1071 Ga0495628_0007761
1072 Ga0495630_0099503
1073 Ga0495666_0049010
1074 Ga0495652_0244736
1075 Ga0495665_0006101
1076 Ga0495665_0042252
1077 Ga0495665_0087041
1078 Ga0495640_0034368
1079 Ga0495640_0098518
1080 Ga0495587_0046236
1081 Ga0495587_0068817
1082 Ga0495587_0144636
1083 Ga0495645_0006956
1084 Ga0495645_0011793
1085 Ga0495645_0103048
1086 Ga0495645_0119599
1087 Ga0495634_0022854
1088 Ga0495634_0047610
1089 Ga0495634_0069905
1090 Ga0495634_0207631
1091 Ga0495611_0025053
1092 Ga0495599_0021035
1093 Ga0495623_0162202
1094 Ga0495646_0133421
1095 Ga0495647_0046113
1096 Ga0495613_0028247
1097 Ga0495613_0051462
1098 Ga0495613_0096527
1099 Ga0495649_0286830
1100 Ga0495600_0013425
1101 Ga0495600_0019378
1102 Ga0495600_0059905
1103 Ga0495600_0096063
1104 Ga0495600_0393790
1105 Ga0495581_0044966
1106 Ga0495581_0238040
1107 Ga0495604_0004052
1108 Ga0495604_0037241
1109 Ga0495604_0085546
1110 Ga0495674_0035803
1111 Ga0495674_0060002
1112 Ga0495674_0390688
1113 Ga0495672_0006403
1114 Ga0495672_0094369
1115 Ga0495680_0026971
1116 Ga0495680_0043197
1117 Ga0495683_0084632
1118 Ga0495675_0149599
1119 Ga0495684_0032729
1120 Ga0495684_0033038
1121 Ga0495686_0062166
1122 Ga0495593_0099602
1123 Ga0495602_0234093
1124 Ga0495614_0046273
1125 Ga0496100_0004921
1126 Ga0496100_0073496
1127 Ga0496100_0199019
1128 Ga0496102_0006074
1129 Ga0496102_0018239
1130 Ga0496102_0036536
1131 Ga0496102_0039365
1132 Ga0496102_0268974
1133 Ga0496102_0585336
1134 Ga0496103_0019360
1135 Ga0496103_0035917
1136 Ga0496104_0033075
1137 Ga0496104_0135873
1138 Ga0496104_0147075
1139 Ga0496105_0007376
1140 Ga0496105_0090577
1141 Ga0496105_0102174
1142 Ga0496106_0237673
1143 Ga0496106_0305697
1144 Ga0496106_0327949
1145 Ga0496106_0412372
1146 Ga0496106_0549645
1147 Ga0496107_0000328
1148 Ga0496107_0035025
1149 Ga0496107_0123012
1150 Ga0496107_0123081
1151 Ga0496108_0026959
1152 Ga0496108_0115242
1153 Ga0496108_0157745
1154 Ga0496109_0053145
1155 Ga0496109_0142220
1156 Ga0496110_0129717
1157 Ga0496111_0023969
1158 Ga0496111_0067686
1159 Ga0496111_0212547
1160 Ga0496112_0139510
1161 Ga0496112_0298003
1162 Ga0496113_0054946
1163 Ga0496113_0064822
1164 Ga0496114_0018574
1165 Ga0496114_0226933
1166 Ga0496115_0010394
1167 Ga0496115_0105272
1168 Ga0496115_0165134
1169 Ga0496115_0195264
1170 Ga0496115_0290022
1171 Ga0496115_0377917
1172 Ga0496119_0000252
1173 Ga0496121_0220272
1174 Ga0496122_0001427
1175 Ga0496123_0002152
1176 Ga0496126_0001732
1177 Ga0501033_0025654
1178 Ga0501047_0349671
1179 Ga0501068_0014358
1180 Ga0501068_0263346
1181 Ga0501044_0002478
1182 nmdc:mga05p37_296225_c1
1183 nmdc:mga05p37_339820_c1
1184 nmdc:mga05p37_343183_c1
1185 nmdc:mga09592_403330_c1
1186 nmdc:mga0qj67_382849_c1
1187 nmdc:mga0qj67_74622_c1
1188 nmdc:mga08y16_111437_c1
1189 nmdc:mga08y16_150711_c1
1190 nmdc:mga0n895_17826_c1
1191 nmdc:mga0n895_44849_c1
1192 nmdc:mga0n895_513930_c1
1193 nmdc:mga0rr50_191375_c1
1194 nmdc:mga0rr50_390287_c1
1195 nmdc:mga0rr50_619426_c1
1196 nmdc:mga0a205_217208_c1
1197 nmdc:mga0a205_76319_c1
1198 Ga0495601_0092828
1199 Ga0495601_0160253
1200 Ga0495595_0273182
1201 Ga0495619_0181867
1202 Ga0500556_0000036
1203 Ga0500652_001999
1204 Ga0500573_0009071
1205 Ga0500590_051182
1206 Ga0500616_0051573
1207 Ga0500627_0096532
1208 Ga0501084_0385589
1209 Ga0587083_0018492
1210 Ga0587071_029063
1211 2515853407
1212 2862516704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

30

212

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

36

259

0.94

PF23441

24

261

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nkh-assembly1.cif.gz_C structure of malc reductase/diels-alderase from malbranchea aurantiaca 0.91 14 248
6nkk-assembly1.cif.gz_C structure of phqe reductase/diels-alderase from penicillium fellutanum in complex with nadp+ and premalbrancheamide 0.9025 15 251
6nkm-assembly1.cif.gz_D structure of phqe d166n reductase/diels-alderase from penicillium fellutanum in complex with nadp+ and substrate 0.9015 16 251
6nkh-assembly1.cif.gz_B structure of malc reductase/diels-alderase from malbranchea aurantiaca 0.9011 15 248
8hfk-assembly1.cif.gz_C crystal structure of cbar mutant (h162f) in complex with nadp+ and halogenated aryl ketone 0.9007 13 247
ID Description Score Start End Superfamily
af_P0AEK4_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8971 16 247 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8946 12 83 3.40.50.720
af_C6TLW3_3_253_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8929 11 248 3.40.50.720
af_I6YCF0_1_258_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8906 14 244 3.40.50.720
1ja9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8896 15 247 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7K0TJZ9-F1-model_v4 SDR family oxidoreductase 0.928 12 247 GO:0016491
AF-A0A1F9A1F4-F1-model_v4 Short-chain dehydrogenase 0.9234 15 251 GO:0016491
AF-A0A4Y3VCJ4-F1-model_v4 VOC domain-containing protein 0.9227 1 227 GO:0016491
AF-A0A3N1X668-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9206 16 247 GO:0016491
AF-A0A6B1HHK7-F1-model_v4 deleted 0.9204 12 247

Map