F468611

General Info

Members Datasets Scaffolds Average Seq Length
606 378 550 254

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0214475|Ga0436365_0214475_229_1119
Length 296
Sequence MSHTRWSRIRQEIEWFRHSVRRAVAGSIAPEDRGSPDVRQKEIQLADNKIAIVTGGSRGIGRSTVLALAKRGVRSIFTFHSNRTEAGAVIALAKEAGAPATALQLDTGNIASFAAFAGDVRTALRSMGAERFDYLVNNAGTSSNASLETITEAEMDALYNVHFKGVLFLTQKLVPLMNDGGRIVNVSSGLARFTSPGRIAYGSIKAGVETLTRYMAMELGPRRITANVIAPGAIATDFSGGMVRDNPHVNKMIAERTALGRVGLPDDVGPAIAALLSDELGWVNAQRIEVSGGIHI

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
6 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
7 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
10 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
11 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
12 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
13 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
14 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
15 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
16 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
17 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
18 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
19 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
20 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
21 2734482264 Dyella sp. AD052 Isolate Unclassified
22 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
23 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
24 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
25 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
26 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
27 2738543009 Luteibacter sp. OK325 Isolate Unclassified
28 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
29 2739367700 Dyella sp. YR388 Isolate Unclassified
30 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
31 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
32 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
33 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
34 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
35 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
36 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
37 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
38 2855730933 Achromobacter sp. HZ28 Isolate Nodule
39 2855767633 Achromobacter sp. HZ34 Isolate Nodule
40 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
41 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
42 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
43 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
44 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
45 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
46 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
47 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
48 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
49 2941471342 Luteibacter sp. 621 Isolate Unclassified
50 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
51 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
52 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
53 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
54 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
55 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
56 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
57 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
58 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
59 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
60 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
61 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
62 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
63 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
64 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
65 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
66 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
67 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
68 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
69 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
70 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
71 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
72 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
73 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
74 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
75 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
76 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
77 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
78 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
79 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
80 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
81 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
82 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
83 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
84 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
85 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
86 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
87 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
88 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
89 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
90 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
91 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
92 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
93 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
94 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
95 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
96 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
97 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
98 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
99 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
100 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
101 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
102 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
103 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
104 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
105 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
106 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
107 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
108 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
109 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
110 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
111 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
112 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
113 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
114 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
115 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
116 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
117 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
118 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
119 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
120 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
121 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
122 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
123 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
124 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
125 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
126 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
127 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
129 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
130 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
131 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
132 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
135 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
147 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
152 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
153 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
156 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
157 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
160 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
161 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
162 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
165 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
167 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
168 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
179 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
222 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
227 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
230 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
231 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
232 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
233 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
243 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
244 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
245 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
246 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
247 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
248 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
249 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
250 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
254 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
255 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
256 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
257 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
260 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
266 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
270 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
273 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
274 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
275 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
276 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
277 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
278 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
279 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
280 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
283 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
284 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
285 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
286 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
287 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
288 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
289 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
290 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
291 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
292 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
293 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
294 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
295 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
296 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
297 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
298 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
299 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
300 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
301 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
304 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
305 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
306 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
307 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
308 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
309 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
310 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
311 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
312 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
313 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
314 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
315 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
316 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
317 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
318 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
319 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
320 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
321 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
322 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
323 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
324 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
325 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
326 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
327 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
328 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
329 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
335 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
336 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
337 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
338 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
339 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
340 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
341 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
342 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
343 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
344 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
345 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
346 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
347 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
354 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
355 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
356 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
357 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
358 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
368 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
369 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
370 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
371 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
372 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
373 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
374 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
375 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
376 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
377 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
378 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.76
Metatranscriptomes 0
Isolates 9.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.73
Nodule 1.16
Rhizoplane 1.49
Rhizosphere 72.94
Stem 0
Stem Tuber 0
Unclassified 13.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000693 3300001979 Bacteria 14599
2 JGI24739J22299_10001046 3300001989 Bacteria 10272
3 JGI24738J21930_10000691 3300002075 Bacteria 9709
4 JGI25152J39213_1003013 3300002773 Bacteria 5955
5 JGI25152J39213_1004554 3300002773 Bacteria 4328
6 JGI25159J45721_1003111 3300002987 Bacteria 5988
7 JGI25151J46595_10033277 3300003187 Bacteria 1987
8 JGI25153J46596_10003507 3300003215 Bacteria 8755
9 JGI25153J46596_10010019 3300003215 Bacteria 4328
10 rootH1_10035169 3300003316 Bacteria 59849
11 rootH2_10038272 3300003320 Bacteria 20840
12 rootH2_10169690 3300003320 Bacteria 1355
13 rootL2_10009353 3300003322 Bacteria 5999
14 rootL2_10046952 3300003322 Bacteria 10020
15 rootH1_10012599 3300003323 Bacteria 111210
16 rootH1_10074328 3300003323 Bacteria 3186
17 JGI25160J50197_1026237 3300003354 Bacteria 1611
18 JGI25161J50226_1000121 3300003374 Bacteria 56946
19 Ga0055539_1005125 3300003752 Bacteria 1713
20 Ga0055526_1001233 3300003771 Bacteria 18375
21 Ga0055526_1001525 3300003771 Bacteria 16383
22 Ga0055537_1000027 3300003773 Bacteria 102244
23 Ga0055537_1000451 3300003773 Bacteria 26082
24 Ga0055524_1002341 3300003775 Bacteria 9852
25 Ga0055524_1007749 3300003775 Bacteria 4529
26 Ga0055534_1000019 3300003784 Bacteria 137920
27 Ga0055528_1000048 3300003790 Bacteria 95179
28 Ga0055528_1006534 3300003790 Bacteria 5281
29 Ga0058692_1004357 3300003856 Bacteria 4207
30 Ga0058692_1013222 3300003856 Bacteria 1929
31 Ga0055543_1000176 3300004625 Bacteria 53419
32 Ga0065165_1005757 3300005262 Bacteria 6800
33 Ga0065714_10134458 3300005288 Bacteria 1221
34 Ga0065712_10074544 3300005290 Bacteria 4069
35 Ga0065715_10097412 3300005293 Bacteria 3709
36 Ga0070676_10094966 3300005328 Bacteria 1833
37 Ga0070676_10188620 3300005328 Bacteria 1345
38 Ga0070690_100001305 3300005330 Bacteria 12949
39 Ga0070670_100000133 3300005331 Bacteria 69691
40 Ga0070670_100021796 3300005331 Bacteria 5510
41 Ga0068869_100005387 3300005334 Bacteria 8039
42 Ga0070666_10001004 3300005335 Bacteria 17255
43 Ga0070666_10007647 3300005335 Bacteria 6671
44 Ga0070666_10131368 3300005335 Bacteria 1740
45 Ga0068868_100126369 3300005338 Bacteria 2089
46 Ga0070689_100003506 3300005340 Bacteria 10433
47 Ga0070691_10040529 3300005341 Bacteria 2201
48 Ga0070687_100002238 3300005343 Bacteria 7175
49 Ga0070661_100125675 3300005344 Bacteria 1924
50 Ga0070661_100425268 3300005344 Bacteria 1053
51 Ga0070668_100023659 3300005347 Bacteria 4649
52 Ga0070669_100008171 3300005353 Bacteria 7473
53 Ga0070675_100000236 3300005354 Bacteria 35636
54 Ga0070671_100029861 3300005355 Bacteria 4497
55 Ga0070673_100018756 3300005364 Bacteria 4953
56 Ga0070673_100645355 3300005364 Bacteria 968
57 Ga0070667_100052891 3300005367 Bacteria 3427
58 Ga0070667_100217479 3300005367 Bacteria 1700
59 Ga0070705_100014853 3300005440 Bacteria 4016
60 Ga0070694_100041879 3300005444 Bacteria 3057
61 Ga0070708_100051939 3300005445 Bacteria 3633
62 Ga0070708_100068795 3300005445 Bacteria 3183
63 Ga0070708_100504256 3300005445 Bacteria 1142
64 Ga0070662_100000839 3300005457 Bacteria 18896
65 Ga0070681_10060774 3300005458 Bacteria 3755
66 Ga0070681_10309551 3300005458 Bacteria 1489
67 Ga0068867_100003350 3300005459 Bacteria 11286
68 Ga0068867_100329663 3300005459 Bacteria 1267
69 Ga0070706_100155852 3300005467 Bacteria 2132
70 Ga0070699_100343507 3300005518 Bacteria 1343
71 Ga0070684_100036141 3300005535 Bacteria 4232
72 Ga0068853_100064952 3300005539 Bacteria 3166
73 Ga0068853_100122745 3300005539 Bacteria 2319
74 Ga0068853_100260813 3300005539 Bacteria 1593
75 Ga0070672_100068583 3300005543 Bacteria 2813
76 Ga0070686_100002094 3300005544 Bacteria 11005
77 Ga0070665_100073478 3300005548 Bacteria 3425
78 Ga0070665_100116078 3300005548 Bacteria 2680
79 Ga0070665_100382258 3300005548 Bacteria 1415
80 Ga0070704_100068113 3300005549 Bacteria 2573
81 Ga0068855_100289722 3300005563 Bacteria 1815
82 Ga0068855_100424344 3300005563 Bacteria 1454
83 Ga0070664_100003665 3300005564 Bacteria 12371
84 Ga0068857_100114768 3300005577 Bacteria 2422
85 Ga0068857_100137039 3300005577 Unclassified 2210
86 Ga0068857_100617898 3300005577 Bacteria 1025
87 Ga0068856_100005379 3300005614 Bacteria 12620
88 Ga0068856_100260019 3300005614 Unclassified 1751
89 Ga0070702_100017244 3300005615 Bacteria 3722
90 Ga0068852_100018063 3300005616 Bacteria 5549
91 Ga0068852_100571719 3300005616 Bacteria 1132
92 Ga0068852_100647654 3300005616 Bacteria 1064
93 Ga0068859_100003877 3300005617 Bacteria 15277
94 Ga0068864_100009414 3300005618 Bacteria 8059
95 Ga0068864_100354347 3300005618 Bacteria 1385
96 Ga0068864_100937957 3300005618 Bacteria 856
97 Ga0068861_100010322 3300005719 Bacteria 6479
98 Ga0068870_10017259 3300005840 Bacteria 3465
99 Ga0068863_100013640 3300005841 Bacteria 7839
100 Ga0068858_100043347 3300005842 Bacteria 4172
101 Ga0068860_100102174 3300005843 Bacteria 2735
102 Ga0068862_100000384 3300005844 Bacteria 47655
103 Ga0068862_100000566 3300005844 Bacteria 38602
104 Ga0070717_10330736 3300006028 Bacteria 1359
105 Ga0075366_10054707 3300006195 Bacteria 2370
106 Ga0097621_100071486 3300006237 Bacteria 2867
107 Ga0097621_100343219 3300006237 Bacteria 1326
108 Ga0068871_100155150 3300006358 Bacteria 1955
109 Ga0075430_100054834 3300006846 Bacteria 3353
110 Ga0075431_100138666 3300006847 Bacteria 2507
111 Ga0075431_100517429 3300006847 Bacteria 1183
112 Ga0075429_100014751 3300006880 Bacteria 6772
113 Ga0068865_100331420 3300006881 Bacteria 1227
114 Ga0068865_100567742 3300006881 Bacteria 955
115 Ga0097620_100003879 3300006931 Bacteria 15277
116 Ga0079104_1000036 3300006946 Bacteria 194741
117 Ga0105251_10133278 3300009011 Bacteria 1126
118 Ga0105240_10000723 3300009093 Bacteria 60353
119 Ga0105240_10320154 3300009093 Bacteria 1768
120 Ga0105240_10851404 3300009093 Bacteria 984
121 Ga0105245_10001203 3300009098 Bacteria 23428
122 Ga0105245_10181788 3300009098 Bacteria 2010
123 Ga0105245_10384965 3300009098 Bacteria 1398
124 Ga0114129_10177291 3300009147 Bacteria 2902
125 Ga0105241_10000516 3300009174 Bacteria 29076
126 Ga0105248_10006352 3300009177 Bacteria 12965
127 Ga0105248_10076098 3300009177 Bacteria 3772
128 Ga0105237_10001366 3300009545 Bacteria 32234
129 Ga0105237_10004109 3300009545 Bacteria 16975
130 Ga0105237_10067444 3300009545 Bacteria 3571
131 Ga0105237_10330439 3300009545 Bacteria 1529
132 Ga0105238_10000678 3300009551 Bacteria 35832
133 Ga0105238_10031362 3300009551 Bacteria 5410
134 Ga0105238_10132092 3300009551 Bacteria 2475
135 Ga0105249_10005262 3300009553 Bacteria 11170
136 Ga0105249_10343094 3300009553 Bacteria 1511
137 Ga0105249_10607599 3300009553 Bacteria 1149
138 Ga0105239_10050687 3300010375 Bacteria 4552
139 Ga0105239_10405333 3300010375 Bacteria 1543
140 Ga0105246_10094436 3300011119 Bacteria 2163
141 Ga0157371_10038484 3300013102 Bacteria 3421
142 Ga0157369_10001160 3300013105 Bacteria 32867
143 Ga0157369_10004776 3300013105 Bacteria 15927
144 Ga0163162_10165638 3300013306 Bacteria 2334
145 Ga0163162_10636805 3300013306 Bacteria 1191
146 Ga0157372_10000358 3300013307 Bacteria 50206
147 Ga0157372_10007957 3300013307 Bacteria 11270
148 Ga0163163_10230991 3300014325 Bacteria 1899
149 Ga0157380_10434523 3300014326 Bacteria 1256
150 Ga0182008_10009391 3300014497 Bacteria 5281
151 Ga0182008_10012070 3300014497 Bacteria 4570
152 Ga0157377_10022903 3300014745 Bacteria 3304
153 Ga0157376_10003459 3300014969 Bacteria 10880
154 Ga0182006_1000005 3300015261 Bacteria 621201
155 Ga0182006_1000355 3300015261 Bacteria 38520
156 Ga0182007_10059316 3300015262 Bacteria 1255
157 Ga0183361_10007 3300016635 Bacteria 339575
158 Ga0163161_10532936 3300017792 Bacteria 960
159 Ga0213872_10000013 3300021361 Bacteria 182866
160 Ga0213872_10000282 3300021361 Bacteria 43374
161 Ga0213872_10135481 3300021361 Bacteria 1083
162 Ga0213876_10008842 3300021384 Bacteria 5435
163 Ga0209436_100002 3300025208 Bacteria 222172
164 Ga0209672_100695 3300025228 Bacteria 16861
165 Ga0207427_104033 3300025231 Bacteria 2674
166 Ga0209646_1003510 3300025246 Bacteria 3079
167 Ga0209677_104977 3300025253 Bacteria 3618
168 Ga0209129_1000019 3300025258 Bacteria 460802
169 Ga0209129_1001405 3300025258 Bacteria 13470
170 Ga0209129_1001452 3300025258 Bacteria 13222
171 Ga0209129_1003522 3300025258 Bacteria 6760
172 Ga0209233_1000437 3300025261 Bacteria 29382
173 Ga0209565_1000017 3300025263 Bacteria 462438
174 Ga0209455_1003981 3300025272 Bacteria 5010
175 Ga0209673_1000007 3300025273 Bacteria 634477
176 Ga0209673_1004206 3300025273 Bacteria 7855
177 Ga0209130_1000015 3300025284 Bacteria 409631
178 Ga0209675_1000009 3300025291 Bacteria 562872
179 Ga0209676_1000812 3300025292 Bacteria 40825
180 Ga0209025_1000648 3300025294 Bacteria 60937
181 Ga0209025_1013340 3300025294 Bacteria 5176
182 Ga0209564_1000021 3300025295 Bacteria 571316
183 Ga0209564_1000036 3300025295 Bacteria 423455
184 Ga0209564_1001407 3300025295 Bacteria 24859
185 Ga0209564_1001647 3300025295 Bacteria 21535
186 Ga0209758_1000148 3300025297 Bacteria 166232
187 Ga0209758_1000467 3300025297 Bacteria 66705
188 Ga0209758_1006875 3300025297 Bacteria 7952
189 Ga0209758_1048283 3300025297 Bacteria 1514
190 Ga0209758_1062474 3300025297 Bacteria 1219
191 Ga0209256_1000091 3300025299 Bacteria 210945
192 Ga0209256_1003221 3300025299 Bacteria 11777
193 Ga0207426_1000122 3300025302 Bacteria 218307
194 Ga0207426_1023152 3300025302 Bacteria 2123
195 Ga0209051_1012790 3300025303 Bacteria 4038
196 Ga0207680_10093320 3300025903 Bacteria 1920
197 Ga0207680_10123434 3300025903 Bacteria 1697
198 Ga0207647_10000006 3300025904 Bacteria 214791
199 Ga0207647_10011418 3300025904 Bacteria 6231
200 Ga0207645_10266012 3300025907 Bacteria 1136
201 Ga0207643_10019027 3300025908 Bacteria 3762
202 Ga0207684_10501209 3300025910 Bacteria 1041
203 Ga0207654_10003830 3300025911 Bacteria 7584
204 Ga0207695_10000648 3300025913 Bacteria 69088
205 Ga0207671_10000215 3300025914 Bacteria 87204
206 Ga0207671_10187050 3300025914 Bacteria 1614
207 Ga0207660_10434875 3300025917 Bacteria 1060
208 Ga0207662_10003084 3300025918 Bacteria 8503
209 Ga0207657_10056538 3300025919 Bacteria 3385
210 Ga0207649_10153606 3300025920 Bacteria 1588
211 Ga0207649_10202374 3300025920 Bacteria 1403
212 Ga0207652_10188736 3300025921 Bacteria 1853
213 Ga0207652_10372521 3300025921 Bacteria 1289
214 Ga0207681_10004231 3300025923 Bacteria 8863
215 Ga0207681_10179044 3300025923 Bacteria 1613
216 Ga0207694_10011304 3300025924 Bacteria 6739
217 Ga0207694_10036791 3300025924 Bacteria 3757
218 Ga0207650_10000532 3300025925 Bacteria 31166
219 Ga0207650_10064715 3300025925 Bacteria 2738
220 Ga0207644_10030880 3300025931 Bacteria 3730
221 Ga0207706_10004708 3300025933 Bacteria 12779
222 Ga0207670_10008905 3300025936 Bacteria 5691
223 Ga0207670_10044829 3300025936 Bacteria 2928
224 Ga0207704_10195441 3300025938 Bacteria 1475
225 Ga0207691_10015438 3300025940 Bacteria 7263
226 Ga0207711_10008386 3300025941 Bacteria 8647
227 Ga0207711_10051695 3300025941 Bacteria 3520
228 Ga0207711_10496385 3300025941 Bacteria 1137
229 Ga0207679_10006942 3300025945 Bacteria 7175
230 Ga0207667_10075582 3300025949 Bacteria 3497
231 Ga0207651_10034680 3300025960 Bacteria 3271
232 Ga0207712_10004437 3300025961 Bacteria 8864
233 Ga0207668_10179971 3300025972 Bacteria 1666
234 Ga0207640_10038382 3300025981 Bacteria 3022
235 Ga0207658_10639071 3300025986 Bacteria 958
236 Ga0207677_10033090 3300026023 Bacteria 3331
237 Ga0207677_10330704 3300026023 Bacteria 1270
238 Ga0207703_10137477 3300026035 Bacteria 2117
239 Ga0207639_10046499 3300026041 Bacteria 3275
240 Ga0207639_10050824 3300026041 Bacteria 3150
241 Ga0207639_10248750 3300026041 Bacteria 1549
242 Ga0207678_10000697 3300026067 Bacteria 30609
243 Ga0207678_10003997 3300026067 Bacteria 13264
244 Ga0207678_10090668 3300026067 Bacteria 2613
245 Ga0207678_10191745 3300026067 Bacteria 1747
246 Ga0207678_10436886 3300026067 Bacteria 1136
247 Ga0207678_10446561 3300026067 Bacteria 1124
248 Ga0207708_10028275 3300026075 Bacteria 4246
249 Ga0207702_10028255 3300026078 Bacteria 4661
250 Ga0207702_10219077 3300026078 Bacteria 1773
251 Ga0207641_10133031 3300026088 Bacteria 2235
252 Ga0207648_10009062 3300026089 Bacteria 9572
253 Ga0207676_10007647 3300026095 Bacteria 7670
254 Ga0207676_10803637 3300026095 Bacteria 918
255 Ga0207674_10382625 3300026116 Bacteria 1360
256 Ga0207675_100007722 3300026118 Bacteria 10151
257 Ga0207675_100084526 3300026118 Bacteria 2978
258 Ga0207698_10257126 3300026142 Bacteria 1602
259 Ga0209281_1000080 3300027111 Bacteria 261394
260 Ga0209371_1000029 3300027312 Bacteria 424797
261 Ga0209371_1017347 3300027312 Bacteria 1867
262 Ga0268266_10000255 3300028379 Bacteria 89930
263 Ga0268266_10007060 3300028379 Bacteria 10198
264 Ga0268266_10050832 3300028379 Bacteria 3557
265 Ga0268266_10079545 3300028379 Bacteria 2854
266 Ga0268265_10001478 3300028380 Bacteria 19705
267 Ga0268265_10001770 3300028380 Bacteria 17326
268 Ga0268265_10553976 3300028380 Bacteria 1092
269 Ga0268264_10026436 3300028381 Bacteria 4743
270 Ga0265338_10019103 3300028800 Bacteria 7293
271 Ga0265338_10167188 3300028800 Bacteria 1692
272 Ga0268256_1000032 3300030500 Bacteria 424603
273 Ga0268256_1015296 3300030500 Bacteria 2245
274 Ga0268256_1035958 3300030500 Bacteria 1146
275 Ga0265314_10095289 3300031711 Bacteria 1927
276 Ga0307516_10096376 3300031730 Bacteria 2779
277 Ga0307405_10253241 3300031731 Bacteria 1311
278 Ga0307410_10084328 3300031852 Bacteria 2240
279 Ga0307410_10454322 3300031852 Bacteria 1046
280 Ga0307406_10258351 3300031901 Bacteria 1316
281 Ga0307412_10000005 3300031911 Bacteria 526194
282 Ga0307412_10000954 3300031911 Bacteria 16544
283 Ga0307412_10135257 3300031911 Bacteria 1797
284 Ga0307416_100057652 3300032002 Bacteria 3144
285 Ga0307416_100471428 3300032002 Bacteria 1313
286 Ga0307414_10060547 3300032004 Bacteria 2678
287 Ga0307415_100014235 3300032126 Bacteria 4669
288 Ga0395898_0495080 3300037466 Bacteria 1163
289 Ga0395905_0015859 3300037471 Bacteria 7158
290 Ga0436364_1317855 3300037853 Bacteria 2249
291 Ga0395901_0120117 3300038443 Bacteria 2762
292 Ga0436365_0173869 3300039437 Bacteria 89108
293 Ga0436365_0214475 3300039437 Bacteria 1271
294 Ga0436365_0423225 3300039437 Bacteria 1461
295 Ga0436361_0027396 3300039447 Bacteria 3390
296 Ga0436361_0347557 3300039447 Bacteria 3242
297 Ga0436361_0743645 3300039447 Bacteria 72606
298 Ga0436361_1136913 3300039447 Bacteria 10109
299 Ga0436362_0676981 3300039453 Unclassified 3270
300 Ga0439436_0000001 3300041404 Bacteria 299341
301 Ga0439465_0001647 3300041413 Bacteria 7281
302 Ga0439452_000012 3300042010 Bacteria 412478
303 Ga0466969_0073818 3300044656 Bacteria 1637
304 Ga0466972_0000464 3300044658 Bacteria 20631
305 Ga0466972_0004636 3300044658 Bacteria 6883
306 Ga0466972_0029329 3300044658 Bacteria 2708
307 Ga0466972_0099209 3300044658 Unclassified 1378
308 Ga0466982_0000002 3300044672 Bacteria 454900
309 Ga0466965_0028276 3300044683 Bacteria 2723
310 Ga0466966_0001538 3300044684 Bacteria 14786
311 Ga0466961_0013450 3300044693 Bacteria 5242
312 Ga0466964_0012746 3300044706 Bacteria 3183
313 Ga0466971_0016238 3300044719 Bacteria 3282
314 Ga0466970_0019714 3300044765 Bacteria 3498
315 Ga0466957_0522992 3300044842 Bacteria 824
316 Ga0466959_0145316 3300045049 Bacteria 1674
317 Ga0466967_0034275 3300045976 Bacteria 4308
318 Ga0495617_000183 3300046452 Bacteria 39626
319 Ga0495617_000639 3300046452 Bacteria 17588
320 Ga0495627_001483 3300046453 Bacteria 13607
321 Ga0495592_0032166 3300046454 Bacteria 3961
322 Ga0495592_0175335 3300046454 Bacteria 1465
323 Ga0495591_001076 3300046458 Bacteria 18246
324 Ga0495629_0016155 3300046459 Bacteria 5358
325 Ga0495629_0162786 3300046459 Bacteria 1549
326 Ga0495638_0000034 3300046460 Bacteria 282038
327 Ga0495653_0005525 3300046463 Bacteria 10301
328 Ga0495650_0000380 3300046471 Bacteria 76955
329 Ga0495650_0005291 3300046471 Bacteria 8445
330 Ga0495650_0020882 3300046471 Bacteria 3181
331 Ga0495650_0053886 3300046471 Bacteria 1644
332 Ga0495580_0056319 3300046472 Bacteria 2769
333 Ga0495582_0026924 3300046473 Bacteria 3150
334 Ga0495605_0006772 3300046474 Bacteria 6549
335 Ga0495605_0033803 3300046474 Bacteria 2593
336 Ga0495605_0071284 3300046474 Bacteria 1641
337 Ga0495584_0002094 3300046491 Bacteria 11446
338 Ga0495584_0006501 3300046491 Bacteria 6114
339 Ga0495585_0000001 3300046492 Bacteria 609804
340 Ga0495585_0005476 3300046492 Bacteria 7992
341 Ga0495596_0016626 3300046500 Bacteria 3053
342 Ga0495607_0000010 3300046501 Bacteria 206525
343 Ga0495607_0000705 3300046501 Bacteria 32214
344 Ga0495607_0016052 3300046501 Plasmid 4839
345 Ga0495607_0155965 3300046501 Bacteria 1164
346 Ga0495583_0009454 3300046506 Bacteria 5819
347 Ga0495583_0018706 3300046506 Bacteria 3640
348 Ga0495606_0000150 3300046507 Bacteria 119726
349 Ga0495606_0000154 3300046507 Bacteria 119458
350 Ga0495606_0000469 3300046507 Bacteria 66319
351 Ga0495606_0002690 3300046507 Bacteria 20099
352 Ga0495606_0002890 3300046507 Bacteria 18971
353 Ga0495606_0008309 3300046507 Bacteria 9050
354 Ga0495606_0015946 3300046507 Bacteria 5759
355 Ga0495606_0015951 3300046507 Bacteria 5758
356 Ga0495606_0021515 3300046507 Bacteria 4724
357 Ga0495608_0032316 3300046511 Bacteria 3537
358 Ga0495610_0000282 3300046512 Bacteria 53033
359 Ga0495610_0002694 3300046512 Bacteria 14641
360 Ga0495610_0005914 3300046512 Bacteria 8570
361 Ga0495610_0010266 3300046512 Bacteria 5835
362 Ga0495610_0013453 3300046512 Bacteria 4863
363 Ga0495616_0000001 3300046513 Bacteria 780061
364 Ga0495618_0011486 3300046514 Bacteria 5371
365 Ga0495620_0000560 3300046515 Bacteria 23435
366 Ga0495620_0000588 3300046515 Bacteria 22750
367 Ga0495628_0011306 3300046516 Bacteria 7552
368 Ga0495628_0355333 3300046516 Bacteria 1076
369 Ga0495631_0000137 3300046518 Bacteria 49790
370 Ga0495631_0000966 3300046518 Bacteria 17897
371 Ga0495632_0004331 3300046519 Bacteria 9675
372 Ga0495632_0015610 3300046519 Bacteria 4248
373 Ga0495632_0130635 3300046519 Bacteria 1169
374 Ga0495632_0259075 3300046519 Bacteria 778
375 Ga0495637_0008462 3300046520 Bacteria 5051
376 Ga0495643_0083449 3300046522 Bacteria 1659
377 Ga0495643_0182955 3300046522 Bacteria 1017
378 Ga0495644_0004261 3300046523 Bacteria 5616
379 Ga0495648_0000559 3300046524 Bacteria 39811
380 Ga0495648_0004596 3300046524 Bacteria 11758
381 Ga0495648_0006600 3300046524 Bacteria 9426
382 Ga0495648_0008950 3300046524 Bacteria 7824
383 Ga0495648_0202975 3300046524 Bacteria 991
384 Ga0495666_0009610 3300046526 Bacteria 4835
385 Ga0495666_0009868 3300046526 Bacteria 4768
386 Ga0495642_0007496 3300046528 Bacteria 4179
387 Ga0495652_0127306 3300046529 Bacteria 2021
388 Ga0495654_0000183 3300046530 Bacteria 61398
389 Ga0495654_0173092 3300046530 Bacteria 940
390 Ga0495665_0002980 3300046531 Bacteria 9154
391 Ga0495640_0028066 3300046533 Bacteria 4054
392 Ga0495586_0098338 3300046535 Bacteria 1622
393 Ga0495586_0396980 3300046535 Bacteria 794
394 Ga0495645_0004978 3300046543 Bacteria 9099
395 Ga0495645_0202228 3300046543 Bacteria 1346
396 Ga0495622_0001709 3300046557 Bacteria 10849
397 Ga0495622_0038416 3300046557 Bacteria 2229
398 Ga0495633_0086656 3300046558 Bacteria 1456
399 Ga0495668_0000018 3300046616 Bacteria 417480
400 Ga0495634_0073344 3300046642 Bacteria 2250
401 Ga0495611_0000001 3300046648 Bacteria 2628469
402 Ga0495611_0000429 3300046648 Bacteria 26013
403 Ga0495611_0048557 3300046648 Bacteria 1908
404 Ga0495625_0000001 3300046660 Bacteria 1641829
405 Ga0495625_0003381 3300046660 Bacteria 15986
406 Ga0495625_0003390 3300046660 Bacteria 15963
407 Ga0495625_0052089 3300046660 Bacteria 2932
408 Ga0495625_0102228 3300046660 Bacteria 1967
409 Ga0495625_0117404 3300046660 Bacteria 1814
410 Ga0495635_0080551 3300046663 Bacteria 2228
411 Ga0495661_0001957 3300046665 Bacteria 16346
412 Ga0495661_0034817 3300046665 Bacteria 3166
413 Ga0495588_0000172 3300046674 Bacteria 81934
414 Ga0495657_0082035 3300046675 Bacteria 2084
415 Ga0495623_0012497 3300046679 Bacteria 5493
416 Ga0495623_0095492 3300046679 Bacteria 1817
417 Ga0495646_0040353 3300046680 Bacteria 2875
418 Ga0495646_0146573 3300046680 Bacteria 1316
419 Ga0495613_0215509 3300046689 Bacteria 1349
420 Ga0495624_0000846 3300046690 Bacteria 24268
421 Ga0495624_0055747 3300046690 Bacteria 2488
422 Ga0495670_0005484 3300046691 Bacteria 6225
423 Ga0495670_0010389 3300046691 Bacteria 4573
424 Ga0495670_0053741 3300046691 Bacteria 2017
425 Ga0495671_0000480 3300046692 Bacteria 31034
426 Ga0495671_0023009 3300046692 Bacteria 3259
427 Ga0495649_0007006 3300046694 Bacteria 6952
428 Ga0495649_0177817 3300046694 Bacteria 1111
429 Ga0495589_0000016 3300046794 Bacteria 209027
430 Ga0495660_0000058 3300046810 Bacteria 133170
431 Ga0495660_0000116 3300046810 Bacteria 85798
432 Ga0495660_0003525 3300046810 Bacteria 9645
433 Ga0495581_0014841 3300047315 Bacteria 4518
434 Ga0495581_0038543 3300047315 Bacteria 2765
435 Ga0495604_0000321 3300047317 Bacteria 43022
436 Ga0495672_0000106 3300047320 Bacteria 132815
437 Ga0495680_0034473 3300047322 Bacteria 4086
438 Ga0495683_0001193 3300047323 Bacteria 17728
439 Ga0495683_0006054 3300047323 Bacteria 6638
440 Ga0495683_0036657 3300047323 Bacteria 2489
441 Ga0495687_000634 3300047443 Bacteria 40217
442 Ga0495687_006747 3300047443 Bacteria 6946
443 Ga0495687_022771 3300047443 Bacteria 3003
444 Ga0495675_0070437 3300047444 Bacteria 2207
445 Ga0495679_000001 3300047446 Bacteria 1607568
446 Ga0495673_0000001 3300047469 Bacteria 1630730
447 Ga0495673_0000229 3300047469 Bacteria 82319
448 Ga0495673_0000371 3300047469 Bacteria 53983
449 Ga0495681_0000118 3300047470 Bacteria 69538
450 Ga0495686_0000085 3300047472 Bacteria 198128
451 Ga0495686_0000115 3300047472 Bacteria 166876
452 Ga0495686_0000407 3300047472 Bacteria 68110
453 Ga0495686_0001689 3300047472 Bacteria 22933
454 Ga0495686_0002146 3300047472 Bacteria 19287
455 Ga0495686_0018004 3300047472 Bacteria 4750
456 Ga0495686_0018598 3300047472 Bacteria 4658
457 Ga0495686_0018953 3300047472 Bacteria 4605
458 Ga0495686_0201372 3300047472 Bacteria 1142
459 Ga0495602_0051575 3300048088 Bacteria 3662
460 Ga0495614_0047059 3300048089 Bacteria 1849
461 Ga0495626_0012426 3300048091 Bacteria 4464
462 Ga0495626_0036578 3300048091 Bacteria 2338
463 Ga0496106_0002982 3300048909 Bacteria 12606
464 Ga0496110_0344718 3300048913 Bacteria 1357
465 Ga0496111_0001880 3300048914 Bacteria 12413
466 Ga0496111_0138037 3300048914 Bacteria 1807
467 Ga0496112_0213875 3300048915 Bacteria 1885
468 Ga0496114_0649648 3300048917 Bacteria 928
469 Ga0496114_0744116 3300048917 Bacteria 857
470 Ga0496116_0042860 3300048919 Bacteria 3088
471 Ga0496116_0046319 3300048919 Bacteria 2935
472 Ga0496117_0002017 3300048920 Bacteria 26920
473 Ga0496117_0028424 3300048920 Bacteria 4330
474 Ga0496117_0043057 3300048920 Bacteria 3288
475 Ga0496117_0165213 3300048920 Bacteria 1291
476 Ga0496118_0001001 3300048921 Bacteria 44080
477 Ga0496118_0001737 3300048921 Bacteria 31652
478 Ga0496118_0006503 3300048921 Bacteria 12808
479 Ga0496118_0009257 3300048921 Bacteria 9992
480 Ga0496118_0027108 3300048921 Bacteria 4858
481 Ga0496118_0206475 3300048921 Bacteria 1157
482 Ga0496119_0000023 3300048922 Bacteria 259882
483 Ga0496119_0027600 3300048922 Bacteria 3897
484 Ga0496119_0056569 3300048922 Bacteria 2376
485 Ga0496120_0000578 3300048923 Bacteria 55746
486 Ga0496120_0026578 3300048923 Bacteria 3571
487 Ga0496121_0000129 3300048924 Bacteria 168148
488 Ga0496121_0000308 3300048924 Bacteria 101811
489 Ga0496121_0000905 3300048924 Bacteria 53422
490 Ga0496121_0001400 3300048924 Bacteria 40824
491 Ga0496121_0035264 3300048924 Bacteria 4487
492 Ga0496121_0132938 3300048924 Bacteria 1858
493 Ga0496121_0253953 3300048924 Bacteria 1217
494 Ga0496122_0006856 3300048925 Bacteria 12908
495 Ga0496122_0034164 3300048925 Bacteria 4167
496 Ga0496122_0113820 3300048925 Bacteria 1766
497 Ga0496122_0230818 3300048925 Bacteria 1052
498 Ga0496123_0004244 3300048926 Bacteria 15263
499 Ga0496123_0005671 3300048926 Bacteria 12463
500 Ga0496123_0023530 3300048926 Bacteria 4712
501 Ga0496123_0070752 3300048926 Bacteria 2181
502 Ga0496124_0000109 3300048927 Bacteria 166429
503 Ga0496124_0125030 3300048927 Bacteria 2050
504 Ga0496125_0006086 3300048928 Bacteria 13167
505 Ga0496125_0166138 3300048928 Bacteria 1491
506 Ga0496126_0002238 3300048929 Bacteria 26740
507 Ga0496126_0011136 3300048929 Bacteria 9338
508 Ga0496126_0023806 3300048929 Bacteria 5928
509 Ga0496126_0054809 3300048929 Bacteria 3609
510 Ga0496126_0358547 3300048929 Bacteria 1191
511 Ga0495678_000088 3300049459 Bacteria 115071
512 Ga0495678_000475 3300049459 Bacteria 39998
513 Ga0495682_0000033 3300049460 Bacteria 132733
514 Ga0495682_0000576 3300049460 Bacteria 24893
515 Ga0495682_0008745 3300049460 Bacteria 3982
516 Ga0501033_0096266 3300049570 Bacteria 2163
517 Ga0501037_0013831 3300049573 Bacteria 5947
518 Ga0501038_0120442 3300049574 Bacteria 2165
519 Ga0501039_0528511 3300049575 Bacteria 926
520 Ga0501046_0041425 3300049580 Bacteria 3675
521 Ga0501047_0134599 3300049581 Bacteria 2352
522 Ga0501068_0173853 3300049584 Bacteria 1360
523 Ga0501070_0090736 3300049586 Bacteria 2529
524 Ga0501070_0396602 3300049586 Bacteria 1116
525 Ga0501071_0022336 3300049587 Bacteria 4411
526 Ga0501075_0477084 3300049591 Bacteria 951
527 Ga0501080_0058675 3300049742 Bacteria 3582
528 Ga0501035_0069317 3300049822 Bacteria 3126
529 Ga0501044_0018799 3300049823 Bacteria 7403
530 Ga0501044_0450365 3300049823 Bacteria 1194
531 Ga0501045_0380560 3300049824 Bacteria 1051
532 nmdc:mga05p37_57566_c1 3300050507 Bacteria 4788
533 nmdc:mga09592_3952_c1 3300050508 Bacteria 11942
534 nmdc:mga0qj67_905_c1 3300050509 Bacteria 10950
535 nmdc:mga06r32_31454_c1 3300050510 Bacteria 4985
536 nmdc:mga08y16_17267_c1 3300050511 Bacteria 7597
537 nmdc:mga0n895_224768_c1 3300050512 Bacteria 1905
538 Ga0500578_0000042 3300053086 Bacteria 129410
539 Ga0500578_0048478 3300053086 Bacteria 2725
540 Ga0500643_000002 3300053087 Bacteria 1277657
541 Ga0500555_000288 3300053103 Bacteria 21733
542 Ga0500618_000111 3300053125 Bacteria 65821
543 Ga0500621_000013 3300053126 Bacteria 132878
544 Ga0500603_003350 3300053150 Bacteria 3445
545 Ga0500616_0011692 3300053153 Bacteria 5169
546 Ga0500622_0000335 3300053156 Bacteria 46130
547 Ga0500622_0045354 3300053156 Bacteria 2276
548 Ga0500633_0090956 3300053160 Bacteria 1114
549 Ga0500645_001386 3300053730 Bacteria 12362
550 Ga0466962_0004762 3300061719 Bacteria 6523

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046453 Ga0495627_001483 Ga0495627_001483_10979_11803 230
2 3300046501 Ga0495607_0155965 Ga0495607_0155965_19_786 230
3 3300046512 Ga0495610_0000282 Ga0495610_0000282_36651_37475 230
4 3300046519 Ga0495632_0130635 Ga0495632_0130635_332_1156 230
5 3300046524 Ga0495648_0004596 Ga0495648_0004596_5817_6584 230
6 3300046558 Ga0495633_0086656 Ga0495633_0086656_63_887 230
7 3300046665 Ga0495661_0034817 Ga0495661_0034817_1927_2751 230
8 3300046679 Ga0495623_0012497 Ga0495623_0012497_4696_5475 230
9 3300047317 Ga0495604_0000321 Ga0495604_0000321_19281_20060 230
10 3300047322 Ga0495680_0034473 Ga0495680_0034473_290_1069 230
11 3300047470 Ga0495681_0000118 Ga0495681_0000118_12111_12935 230
12 3300047472 Ga0495686_0001689 Ga0495686_0001689_10068_10892 230
13 3300048088 Ga0495602_0051575 Ga0495602_0051575_2366_3145 230
14 3300009011 Ga0105251_10133278 Ga0105251_101332781 232
15 3300046454 Ga0495592_0032166 Ga0495592_0032166_1130_1909 232
16 3300046459 Ga0495629_0162786 Ga0495629_0162786_748_1527 232
17 3300046463 Ga0495653_0005525 Ga0495653_0005525_3802_4581 232
18 3300046471 Ga0495650_0020882 Ga0495650_0020882_1193_1972 232
19 3300046472 Ga0495580_0056319 Ga0495580_0056319_867_1646 232
20 3300046473 Ga0495582_0026924 Ga0495582_0026924_1248_2027 232
21 3300046511 Ga0495608_0032316 Ga0495608_0032316_818_1597 232
22 3300046514 Ga0495618_0011486 Ga0495618_0011486_3887_4666 232
23 3300046516 Ga0495628_0355333 Ga0495628_0355333_160_939 232
24 3300046526 Ga0495666_0009610 Ga0495666_0009610_1248_2027 232
25 3300046529 Ga0495652_0127306 Ga0495652_0127306_818_1597 232
26 3300046533 Ga0495640_0028066 Ga0495640_0028066_72_851 232
27 3300046535 Ga0495586_0098338 Ga0495586_0098338_52_831 232
28 3300046642 Ga0495634_0073344 Ga0495634_0073344_281_1060 232
29 3300046663 Ga0495635_0080551 Ga0495635_0080551_233_1012 232
30 3300046675 Ga0495657_0082035 Ga0495657_0082035_58_837 232
31 3300046679 Ga0495623_0095492 Ga0495623_0095492_370_1149 232
32 3300046680 Ga0495646_0040353 Ga0495646_0040353_1756_2535 232
33 3300046689 Ga0495613_0215509 Ga0495613_0215509_138_917 232
34 3300046690 Ga0495624_0055747 Ga0495624_0055747_1184_1963 232
35 3300047315 Ga0495581_0038543 Ga0495581_0038543_1969_2748 232
36 3300047323 Ga0495683_0036657 Ga0495683_0036657_406_1185 232
37 3300047444 Ga0495675_0070437 Ga0495675_0070437_564_1343 232
38 3300048089 Ga0495614_0047059 Ga0495614_0047059_233_1012 232
39 3300048922 Ga0496119_0056569 Ga0496119_0056569_769_1551 232
40 3300048923 Ga0496120_0000578 Ga0496120_0000578_30100_30882 232
41 3300045976 Ga0466967_0034275 Ga0466967_0034275_1148_1900 233
42 3300049591 Ga0501075_0477084 Ga0501075_0477084_231_935 233
43 3300003320 rootH2_10038272 rootH2_1003827222 234
44 3300026067 Ga0207678_10003997 Ga0207678_1000399710 234
45 3300048917 Ga0496114_0649648 Ga0496114_0649648_146_880 239
46 3300005616 Ga0068852_100647654 Ga0068852_1006476541 240
47 3300025302 Ga0207426_1023152 Ga0207426_10231522 241
48 3300005618 Ga0068864_100937957 Ga0068864_1009379571 242
49 3300009553 Ga0105249_10607599 Ga0105249_106075992 242
50 3300014326 Ga0157380_10434523 Ga0157380_104345232 242
51 3300005364 Ga0070673_100645355 Ga0070673_1006453551 244
52 3300006237 Ga0097621_100343219 Ga0097621_1003432192 244
53 3300025941 Ga0207711_10496385 Ga0207711_104963851 244
54 3300028800 Ga0265338_10019103 Ga0265338_100191032 244
55 3300031852 Ga0307410_10084328 Ga0307410_100843283 244
56 3300031852 Ga0307410_10454322 Ga0307410_104543222 244
57 3300032126 Ga0307415_100014235 Ga0307415_1000142353 244
58 3300025292 Ga0209676_1000812 Ga0209676_10008124 245
59 3300026095 Ga0207676_10803637 Ga0207676_108036371 246
60 iso_pu_bacteria 2818991440 2819563230 246
61 iso_pu_bacteria 2904463128 2904463850 246
62 3300037466 Ga0395898_0495080 Ga0395898_0495080_322_1083 247
63 3300038443 Ga0395901_0120117 Ga0395901_0120117_1168_1938 247
64 iso_pu_bacteria 2511231025 2511380850 247
65 iso_pu_bacteria 2511231035 2511434721 247
66 iso_pu_bacteria 2935625433 2935628497 247
67 iso_pu_bacteria 2939617950 2939620811 247
68 iso_pu_bacteria 2974435778 2974435996 247
69 iso_pu_bacteria 8019504834 8019507232 247
70 3300003323 rootH1_10074328 rootH1_100743283 248
71 3300003856 Ga0058692_1004357 Ga0058692_10043574 248
72 3300003856 Ga0058692_1013222 Ga0058692_10132222 248
73 3300005288 Ga0065714_10134458 Ga0065714_101344581 248
74 3300005445 Ga0070708_100068795 Ga0070708_1000687951 248
75 3300005458 Ga0070681_10309551 Ga0070681_103095512 248
76 3300005459 Ga0068867_100329663 Ga0068867_1003296631 248
77 3300005518 Ga0070699_100343507 Ga0070699_1003435072 248
78 3300006195 Ga0075366_10054707 Ga0075366_100547072 248
79 3300006946 Ga0079104_1000036 Ga0079104_100003631 248
80 3300009093 Ga0105240_10320154 Ga0105240_103201542 248
81 3300009093 Ga0105240_10851404 Ga0105240_108514042 248
82 3300009098 Ga0105245_10001203 Ga0105245_1000120310 248
83 3300009545 Ga0105237_10067444 Ga0105237_100674443 248
84 3300009551 Ga0105238_10132092 Ga0105238_101320923 248
85 3300009553 Ga0105249_10343094 Ga0105249_103430942 248
86 3300013102 Ga0157371_10038484 Ga0157371_100384841 248
87 3300013105 Ga0157369_10004776 Ga0157369_1000477611 248
88 3300013307 Ga0157372_10000358 Ga0157372_1000035819 248
89 3300014325 Ga0163163_10230991 Ga0163163_102309913 248
90 3300025914 Ga0207671_10187050 Ga0207671_101870502 248
91 3300026067 Ga0207678_10436886 Ga0207678_104368862 248
92 3300027111 Ga0209281_1000080 Ga0209281_1000080146 248
93 3300027312 Ga0209371_1000029 Ga0209371_1000029232 248
94 3300027312 Ga0209371_1017347 Ga0209371_10173472 248
95 3300028379 Ga0268266_10007060 Ga0268266_100070602 248
96 3300030500 Ga0268256_1000032 Ga0268256_1000032162 248
97 3300030500 Ga0268256_1015296 Ga0268256_10152962 248
98 3300030500 Ga0268256_1035958 Ga0268256_10359582 248
99 3300031911 Ga0307412_10135257 Ga0307412_101352572 248
100 3300037471 Ga0395905_0015859 Ga0395905_0015859_681_1445 248
101 3300042010 Ga0439452_000012 Ga0439452_000012_244039_244827 248
102 3300046458 Ga0495591_001076 Ga0495591_001076_7385_8143 248
103 3300046459 Ga0495629_0016155 Ga0495629_0016155_50_808 248
104 3300046471 Ga0495650_0000380 Ga0495650_0000380_50512_51270 248
105 3300046474 Ga0495605_0033803 Ga0495605_0033803_1413_2171 248
106 3300046474 Ga0495605_0071284 Ga0495605_0071284_800_1558 248
107 3300046491 Ga0495584_0002094 Ga0495584_0002094_1189_1947 248
108 3300046507 Ga0495606_0002690 Ga0495606_0002690_2994_3752 248
109 3300046507 Ga0495606_0015951 Ga0495606_0015951_2161_2931 248
110 3300046523 Ga0495644_0004261 Ga0495644_0004261_3233_3991 248
111 3300046524 Ga0495648_0006600 Ga0495648_0006600_2177_2935 248
112 3300046526 Ga0495666_0009868 Ga0495666_0009868_1023_1781 248
113 3300046530 Ga0495654_0000183 Ga0495654_0000183_11528_12286 248
114 3300046531 Ga0495665_0002980 Ga0495665_0002980_5416_6174 248
115 3300046557 Ga0495622_0001709 Ga0495622_0001709_2782_3540 248
116 3300046648 Ga0495611_0048557 Ga0495611_0048557_477_1235 248
117 3300046660 Ga0495625_0003381 Ga0495625_0003381_7814_8569 248
118 3300046660 Ga0495625_0102228 Ga0495625_0102228_773_1531 248
119 3300046690 Ga0495624_0000846 Ga0495624_0000846_19886_20644 248
120 3300046691 Ga0495670_0053741 Ga0495670_0053741_115_933 248
121 3300046692 Ga0495671_0023009 Ga0495671_0023009_2474_3232 248
122 3300046810 Ga0495660_0000058 Ga0495660_0000058_50508_51266 248
123 3300047315 Ga0495581_0014841 Ga0495581_0014841_995_1753 248
124 3300047320 Ga0495672_0000106 Ga0495672_0000106_81568_82326 248
125 3300047443 Ga0495687_000634 Ga0495687_000634_5921_6685 248
126 3300047469 Ga0495673_0000371 Ga0495673_0000371_31124_31882 248
127 3300048915 Ga0496112_0213875 Ga0496112_0213875_829_1689 248
128 3300048917 Ga0496114_0744116 Ga0496114_0744116_82_846 248
129 3300048919 Ga0496116_0042860 Ga0496116_0042860_2032_2790 248
130 3300048919 Ga0496116_0046319 Ga0496116_0046319_1209_1997 248
131 3300048920 Ga0496117_0002017 Ga0496117_0002017_12475_13263 248
132 3300048920 Ga0496117_0165213 Ga0496117_0165213_330_1118 248
133 3300048921 Ga0496118_0006503 Ga0496118_0006503_11691_12479 248
134 3300048921 Ga0496118_0206475 Ga0496118_0206475_222_1010 248
135 3300048922 Ga0496119_0000023 Ga0496119_0000023_166148_166906 248
136 3300048923 Ga0496120_0026578 Ga0496120_0026578_2663_3421 248
137 3300048924 Ga0496121_0001400 Ga0496121_0001400_30480_31253 248
138 3300048925 Ga0496122_0230818 Ga0496122_0230818_154_942 248
139 3300048926 Ga0496123_0023530 Ga0496123_0023530_3813_4601 248
140 3300048927 Ga0496124_0000109 Ga0496124_0000109_69390_70178 248
141 3300048928 Ga0496125_0006086 Ga0496125_0006086_1777_2565 248
142 3300048928 Ga0496125_0166138 Ga0496125_0166138_503_1285 248
143 3300048929 Ga0496126_0023806 Ga0496126_0023806_4321_5085 248
144 3300049459 Ga0495678_000088 Ga0495678_000088_81562_82320 248
145 3300049460 Ga0495682_0000033 Ga0495682_0000033_81467_82225 248
146 3300049575 Ga0501039_0528511 Ga0501039_0528511_27_791 248
147 3300049584 Ga0501068_0173853 Ga0501068_0173853_497_1267 248
148 3300049586 Ga0501070_0396602 Ga0501070_0396602_266_1024 248
149 3300049587 Ga0501071_0022336 Ga0501071_0022336_1081_1851 248
150 3300049742 Ga0501080_0058675 Ga0501080_0058675_1176_1946 248
151 3300049823 Ga0501044_0450365 Ga0501044_0450365_210_968 248
152 3300049824 Ga0501045_0380560 Ga0501045_0380560_80_847 248
153 3300053126 Ga0500621_000013 Ga0500621_000013_81568_82326 248
154 iso_pu_bacteria 2675903059 2676481017 248
155 iso_pu_bacteria 2721755763 2723877233 248
156 iso_pu_bacteria 2738541296 2738823320 248
157 iso_pu_bacteria 2738541298 2738835578 248
158 iso_pu_bacteria 2738541306 2738877241 248
159 iso_pu_bacteria 2738543002 2739188947 248
160 iso_pu_bacteria 2738543008 2739223834 248
161 iso_pu_bacteria 2842918807 2842919347 248
162 iso_pu_bacteria 2855730933 2855732325 248
163 iso_pu_bacteria 2855767633 2855769033 248
164 iso_pu_bacteria 2945934425 2945936076 248
165 iso_pu_bacteria 2953994433 2953998195 248
166 iso_pu_bacteria 2990703756 2990710020 248
167 3300003771 Ga0055526_1001233 Ga0055526_10012333 249
168 3300003773 Ga0055537_1000027 Ga0055537_100002793 249
169 3300003773 Ga0055537_1000451 Ga0055537_10004516 249
170 3300003775 Ga0055524_1002341 Ga0055524_10023413 249
171 3300003784 Ga0055534_1000019 Ga0055534_100001937 249
172 3300003790 Ga0055528_1000048 Ga0055528_10000482 249
173 3300005290 Ga0065712_10074544 Ga0065712_100745444 249
174 3300005293 Ga0065715_10097412 Ga0065715_100974122 249
175 3300005328 Ga0070676_10094966 Ga0070676_100949662 249
176 3300005328 Ga0070676_10188620 Ga0070676_101886202 249
177 3300005330 Ga0070690_100001305 Ga0070690_1000013054 249
178 3300005331 Ga0070670_100021796 Ga0070670_1000217965 249
179 3300005334 Ga0068869_100005387 Ga0068869_1000053875 249
180 3300005335 Ga0070666_10131368 Ga0070666_101313681 249
181 3300005338 Ga0068868_100126369 Ga0068868_1001263693 249
182 3300005340 Ga0070689_100003506 Ga0070689_1000035068 249
183 3300005341 Ga0070691_10040529 Ga0070691_100405291 249
184 3300005343 Ga0070687_100002238 Ga0070687_1000022387 249
185 3300005344 Ga0070661_100125675 Ga0070661_1001256752 249
186 3300005344 Ga0070661_100425268 Ga0070661_1004252682 249
187 3300005347 Ga0070668_100023659 Ga0070668_1000236593 249
188 3300005353 Ga0070669_100008171 Ga0070669_1000081712 249
189 3300005354 Ga0070675_100000236 Ga0070675_1000002367 249
190 3300005355 Ga0070671_100029861 Ga0070671_1000298614 249
191 3300005364 Ga0070673_100018756 Ga0070673_1000187563 249
192 3300005367 Ga0070667_100217479 Ga0070667_1002174791 249
193 3300005440 Ga0070705_100014853 Ga0070705_1000148533 249
194 3300005444 Ga0070694_100041879 Ga0070694_1000418792 249
195 3300005457 Ga0070662_100000839 Ga0070662_1000008394 249
196 3300005459 Ga0068867_100003350 Ga0068867_1000033508 249
197 3300005535 Ga0070684_100036141 Ga0070684_1000361413 249
198 3300005543 Ga0070672_100068583 Ga0070672_1000685833 249
199 3300005544 Ga0070686_100002094 Ga0070686_1000020946 249
200 3300005549 Ga0070704_100068113 Ga0070704_1000681134 249
201 3300005564 Ga0070664_100003665 Ga0070664_1000036657 249
202 3300005577 Ga0068857_100114768 Ga0068857_1001147682 249
203 3300005615 Ga0070702_100017244 Ga0070702_1000172443 249
204 3300005617 Ga0068859_100003877 Ga0068859_10000387714 249
205 3300005618 Ga0068864_100009414 Ga0068864_1000094145 249
206 3300005618 Ga0068864_100354347 Ga0068864_1003543471 249
207 3300005719 Ga0068861_100010322 Ga0068861_1000103223 249
208 3300005840 Ga0068870_10017259 Ga0068870_100172594 249
209 3300005841 Ga0068863_100013640 Ga0068863_1000136408 249
210 3300005842 Ga0068858_100043347 Ga0068858_1000433475 249
211 3300005843 Ga0068860_100102174 Ga0068860_1001021741 249
212 3300005844 Ga0068862_100000384 Ga0068862_10000038426 249
213 3300005844 Ga0068862_100000566 Ga0068862_10000056625 249
214 3300006028 Ga0070717_10330736 Ga0070717_103307361 249
215 3300006237 Ga0097621_100071486 Ga0097621_1000714861 249
216 3300006358 Ga0068871_100155150 Ga0068871_1001551502 249
217 3300006846 Ga0075430_100054834 Ga0075430_1000548344 249
218 3300006847 Ga0075431_100138666 Ga0075431_1001386664 249
219 3300006847 Ga0075431_100517429 Ga0075431_1005174292 249
220 3300006880 Ga0075429_100014751 Ga0075429_1000147515 249
221 3300006881 Ga0068865_100331420 Ga0068865_1003314202 249
222 3300006881 Ga0068865_100567742 Ga0068865_1005677421 249
223 3300006931 Ga0097620_100003879 Ga0097620_10000387914 249
224 3300009098 Ga0105245_10181788 Ga0105245_101817883 249
225 3300009147 Ga0114129_10177291 Ga0114129_101772912 249
226 3300009177 Ga0105248_10006352 Ga0105248_100063527 249
227 3300009553 Ga0105249_10005262 Ga0105249_100052624 249
228 3300011119 Ga0105246_10094436 Ga0105246_100944362 249
229 3300014745 Ga0157377_10022903 Ga0157377_100229032 249
230 3300017792 Ga0163161_10532936 Ga0163161_105329361 249
231 3300021361 Ga0213872_10000282 Ga0213872_1000028214 249
232 3300025263 Ga0209565_1000017 Ga0209565_1000017314 249
233 3300025273 Ga0209673_1000007 Ga0209673_1000007115 249
234 3300025291 Ga0209675_1000009 Ga0209675_1000009403 249
235 3300025295 Ga0209564_1000036 Ga0209564_1000036115 249
236 3300025297 Ga0209758_1062474 Ga0209758_10624741 249
237 3300025299 Ga0209256_1000091 Ga0209256_1000091115 249
238 3300025903 Ga0207680_10093320 Ga0207680_100933203 249
239 3300025907 Ga0207645_10266012 Ga0207645_102660121 249
240 3300025908 Ga0207643_10019027 Ga0207643_100190275 249
241 3300025917 Ga0207660_10434875 Ga0207660_104348751 249
242 3300025918 Ga0207662_10003084 Ga0207662_100030843 249
243 3300025920 Ga0207649_10153606 Ga0207649_101536062 249
244 3300025920 Ga0207649_10202374 Ga0207649_102023742 249
245 3300025921 Ga0207652_10372521 Ga0207652_103725212 249
246 3300025923 Ga0207681_10004231 Ga0207681_100042312 249
247 3300025925 Ga0207650_10064715 Ga0207650_100647152 249
248 3300025931 Ga0207644_10030880 Ga0207644_100308804 249
249 3300025933 Ga0207706_10004708 Ga0207706_100047081 249
250 3300025936 Ga0207670_10044829 Ga0207670_100448292 249
251 3300025938 Ga0207704_10195441 Ga0207704_101954412 249
252 3300025940 Ga0207691_10015438 Ga0207691_100154383 249
253 3300025941 Ga0207711_10008386 Ga0207711_100083864 249
254 3300025945 Ga0207679_10006942 Ga0207679_100069427 249
255 3300025960 Ga0207651_10034680 Ga0207651_100346804 249
256 3300025961 Ga0207712_10004437 Ga0207712_100044373 249
257 3300025972 Ga0207668_10179971 Ga0207668_101799712 249
258 3300025986 Ga0207658_10639071 Ga0207658_106390711 249
259 3300026023 Ga0207677_10033090 Ga0207677_100330901 249
260 3300026023 Ga0207677_10330704 Ga0207677_103307041 249
261 3300026035 Ga0207703_10137477 Ga0207703_101374772 249
262 3300026075 Ga0207708_10028275 Ga0207708_100282753 249
263 3300026088 Ga0207641_10133031 Ga0207641_101330313 249
264 3300026089 Ga0207648_10009062 Ga0207648_100090623 249
265 3300026095 Ga0207676_10007647 Ga0207676_100076471 249
266 3300026116 Ga0207674_10382625 Ga0207674_103826251 249
267 3300026118 Ga0207675_100007722 Ga0207675_1000077226 249
268 3300026118 Ga0207675_100084526 Ga0207675_1000845263 249
269 3300028379 Ga0268266_10050832 Ga0268266_100508325 249
270 3300028380 Ga0268265_10001478 Ga0268265_1000147815 249
271 3300028380 Ga0268265_10001770 Ga0268265_100017703 249
272 3300028380 Ga0268265_10553976 Ga0268265_105539761 249
273 3300028381 Ga0268264_10026436 Ga0268264_100264365 249
274 3300039437 Ga0436365_0423225 Ga0436365_0423225_543_1301 249
275 3300039447 Ga0436361_0743645 Ga0436361_0743645_15487_16248 249
276 3300046501 Ga0495607_0000010 Ga0495607_0000010_45185_45934 249
277 3300046616 Ga0495668_0000018 Ga0495668_0000018_119184_119933 249
278 3300047472 Ga0495686_0000407 Ga0495686_0000407_13578_14327 249
279 3300048929 Ga0496126_0002238 Ga0496126_0002238_24997_25767 249
280 3300049573 Ga0501037_0013831 Ga0501037_0013831_4083_4991 249
281 3300050507 nmdc:mga05p37_57566_c1 nmdc:mga05p37_57566_c1_2065_2826 249
282 3300050508 nmdc:mga09592_3952_c1 nmdc:mga09592_3952_c1_7812_8573 249
283 3300050509 nmdc:mga0qj67_905_c1 nmdc:mga0qj67_905_c1_446_1207 249
284 3300050510 nmdc:mga06r32_31454_c1 nmdc:mga06r32_31454_c1_3306_4067 249
285 3300050511 nmdc:mga08y16_17267_c1 nmdc:mga08y16_17267_c1_461_1222 249
286 iso_pu_bacteria 2599185236 2599722802 249
287 iso_pu_bacteria 2599185354 2600203605 249
288 3300003320 rootH2_10169690 rootH2_101696901 250
289 3300013306 Ga0163162_10636805 Ga0163162_106368052 250
290 3300021361 Ga0213872_10000013 Ga0213872_10000013138 250
291 3300025246 Ga0209646_1003510 Ga0209646_10035103 250
292 3300031730 Ga0307516_10096376 Ga0307516_100963763 250
293 3300031731 Ga0307405_10253241 Ga0307405_102532411 250
294 3300031901 Ga0307406_10258351 Ga0307406_102583511 250
295 3300032002 Ga0307416_100057652 Ga0307416_1000576526 250
296 3300032002 Ga0307416_100471428 Ga0307416_1004714282 250
297 3300032004 Ga0307414_10060547 Ga0307414_100605473 250
298 3300039447 Ga0436361_0027396 Ga0436361_0027396_642_1406 250
299 3300044658 Ga0466972_0000464 Ga0466972_0000464_3837_4598 250
300 3300046452 Ga0495617_000639 Ga0495617_000639_13117_13884 250
301 3300046501 Ga0495607_0000705 Ga0495607_0000705_13281_14057 250
302 3300046507 Ga0495606_0000469 Ga0495606_0000469_58064_58831 250
303 3300046515 Ga0495620_0000560 Ga0495620_0000560_3698_4465 250
304 3300046516 Ga0495628_0011306 Ga0495628_0011306_5115_5882 250
305 3300046660 Ga0495625_0003390 Ga0495625_0003390_2038_2805 250
306 3300047472 Ga0495686_0000115 Ga0495686_0000115_49995_50747 250
307 3300047472 Ga0495686_0018598 Ga0495686_0018598_288_1055 250
308 3300048924 Ga0496121_0132938 Ga0496121_0132938_425_1192 250
309 3300049581 Ga0501047_0134599 Ga0501047_0134599_1511_2281 250
310 3300050512 nmdc:mga0n895_224768_c1 nmdc:mga0n895_224768_c1_1094_1861 250
311 3300053086 Ga0500578_0000042 Ga0500578_0000042_116830_117594 250
312 3300053086 Ga0500578_0048478 Ga0500578_0048478_1227_1988 250
313 iso_pu_bacteria 2600255067 2600811525 250
314 iso_pu_bacteria 2718218334 2721027315 250
315 iso_pu_bacteria 2842454564 2842455101 250
316 3300003316 rootH1_10035169 rootH1_1003516927 251
317 3300003322 rootL2_10009353 rootL2_100093532 251
318 3300003322 rootL2_10046952 rootL2_100469524 251
319 3300003323 rootH1_10012599 rootH1_1001259914 251
320 3300005335 Ga0070666_10007647 Ga0070666_100076476 251
321 3300005539 Ga0068853_100064952 Ga0068853_1000649523 251
322 3300005539 Ga0068853_100260813 Ga0068853_1002608132 251
323 3300005577 Ga0068857_100137039 Ga0068857_1001370392 251
324 3300005614 Ga0068856_100005379 Ga0068856_10000537912 251
325 3300005614 Ga0068856_100260019 Ga0068856_1002600192 251
326 3300005616 Ga0068852_100018063 Ga0068852_1000180636 251
327 3300005616 Ga0068852_100571719 Ga0068852_1005717192 251
328 3300009093 Ga0105240_10000723 Ga0105240_1000072322 251
329 3300009174 Ga0105241_10000516 Ga0105241_1000051628 251
330 3300009545 Ga0105237_10004109 Ga0105237_100041095 251
331 3300009551 Ga0105238_10000678 Ga0105238_1000067814 251
332 3300010375 Ga0105239_10405333 Ga0105239_104053332 251
333 3300013306 Ga0163162_10165638 Ga0163162_101656382 251
334 3300013307 Ga0157372_10007957 Ga0157372_1000795712 251
335 3300025903 Ga0207680_10123434 Ga0207680_101234342 251
336 3300025911 Ga0207654_10003830 Ga0207654_100038308 251
337 3300025913 Ga0207695_10000648 Ga0207695_1000064830 251
338 3300025924 Ga0207694_10011304 Ga0207694_100113043 251
339 3300025981 Ga0207640_10038382 Ga0207640_100383822 251
340 3300026041 Ga0207639_10046499 Ga0207639_100464992 251
341 3300026041 Ga0207639_10248750 Ga0207639_102487502 251
342 3300026078 Ga0207702_10028255 Ga0207702_100282552 251
343 3300026078 Ga0207702_10219077 Ga0207702_102190771 251
344 3300026142 Ga0207698_10257126 Ga0207698_102571262 251
345 3300044656 Ga0466969_0073818 Ga0466969_0073818_625_1395 251
346 3300044658 Ga0466972_0004636 Ga0466972_0004636_1962_2729 251
347 3300044658 Ga0466972_0029329 Ga0466972_0029329_438_1208 251
348 3300044658 Ga0466972_0099209 Ga0466972_0099209_206_997 251
349 3300044672 Ga0466982_0000002 Ga0466982_0000002_121893_122663 251
350 3300044683 Ga0466965_0028276 Ga0466965_0028276_1545_2315 251
351 3300044684 Ga0466966_0001538 Ga0466966_0001538_13459_14229 251
352 3300044706 Ga0466964_0012746 Ga0466964_0012746_1939_2709 251
353 3300044719 Ga0466971_0016238 Ga0466971_0016238_2404_3174 251
354 3300044765 Ga0466970_0019714 Ga0466970_0019714_487_1257 251
355 3300044842 Ga0466957_0522992 Ga0466957_0522992_42_812 251
356 3300045049 Ga0466959_0145316 Ga0466959_0145316_13_783 251
357 3300046519 Ga0495632_0259075 Ga0495632_0259075_10_765 251
358 3300046674 Ga0495588_0000172 Ga0495588_0000172_66916_67671 251
359 3300048091 Ga0495626_0036578 Ga0495626_0036578_870_1634 251
360 3300061719 Ga0466962_0004762 Ga0466962_0004762_1225_1995 251
361 iso_pu_bacteria 2818991461 2819685230 251
362 3300001979 JGI24740J21852_10000693 JGI24740J21852_1000069313 252
363 3300001989 JGI24739J22299_10001046 JGI24739J22299_100010469 252
364 3300002075 JGI24738J21930_10000691 JGI24738J21930_100006917 252
365 3300002773 JGI25152J39213_1003013 JGI25152J39213_10030137 252
366 3300002773 JGI25152J39213_1004554 JGI25152J39213_10045544 252
367 3300002987 JGI25159J45721_1003111 JGI25159J45721_10031112 252
368 3300003187 JGI25151J46595_10033277 JGI25151J46595_100332771 252
369 3300003215 JGI25153J46596_10003507 JGI25153J46596_100035077 252
370 3300003215 JGI25153J46596_10010019 JGI25153J46596_100100194 252
371 3300003354 JGI25160J50197_1026237 JGI25160J50197_10262372 252
372 3300003374 JGI25161J50226_1000121 JGI25161J50226_100012148 252
373 3300003752 Ga0055539_1005125 Ga0055539_10051251 252
374 3300003771 Ga0055526_1001525 Ga0055526_100152511 252
375 3300003775 Ga0055524_1007749 Ga0055524_10077492 252
376 3300003790 Ga0055528_1006534 Ga0055528_10065348 252
377 3300004625 Ga0055543_1000176 Ga0055543_100017643 252
378 3300005262 Ga0065165_1005757 Ga0065165_10057578 252
379 3300005331 Ga0070670_100000133 Ga0070670_10000013348 252
380 3300005335 Ga0070666_10001004 Ga0070666_1000100411 252
381 3300005367 Ga0070667_100052891 Ga0070667_1000528914 252
382 3300005445 Ga0070708_100051939 Ga0070708_1000519396 252
383 3300005445 Ga0070708_100504256 Ga0070708_1005042561 252
384 3300005458 Ga0070681_10060774 Ga0070681_100607743 252
385 3300005467 Ga0070706_100155852 Ga0070706_1001558522 252
386 3300005539 Ga0068853_100122745 Ga0068853_1001227452 252
387 3300005548 Ga0070665_100073478 Ga0070665_1000734784 252
388 3300005548 Ga0070665_100116078 Ga0070665_1001160782 252
389 3300005548 Ga0070665_100382258 Ga0070665_1003822582 252
390 3300005563 Ga0068855_100289722 Ga0068855_1002897222 252
391 3300005563 Ga0068855_100424344 Ga0068855_1004243443 252
392 3300005577 Ga0068857_100617898 Ga0068857_1006178981 252
393 3300009098 Ga0105245_10384965 Ga0105245_103849652 252
394 3300009177 Ga0105248_10076098 Ga0105248_100760983 252
395 3300009545 Ga0105237_10001366 Ga0105237_1000136627 252
396 3300009545 Ga0105237_10330439 Ga0105237_103304391 252
397 3300009551 Ga0105238_10031362 Ga0105238_100313625 252
398 3300010375 Ga0105239_10050687 Ga0105239_100506874 252
399 3300013105 Ga0157369_10001160 Ga0157369_1000116027 252
400 3300014497 Ga0182008_10009391 Ga0182008_100093913 252
401 3300014497 Ga0182008_10012070 Ga0182008_100120703 252
402 3300014969 Ga0157376_10003459 Ga0157376_100034593 252
403 3300015261 Ga0182006_1000005 Ga0182006_1000005186 252
404 3300015261 Ga0182006_1000355 Ga0182006_100035521 252
405 3300015262 Ga0182007_10059316 Ga0182007_100593162 252
406 3300016635 Ga0183361_10007 Ga0183361_10007251 252
407 3300021361 Ga0213872_10135481 Ga0213872_101354811 252
408 3300021384 Ga0213876_10008842 Ga0213876_100088422 252
409 3300025208 Ga0209436_100002 Ga0209436_100002204 252
410 3300025228 Ga0209672_100695 Ga0209672_10069510 252
411 3300025231 Ga0207427_104033 Ga0207427_1040333 252
412 3300025253 Ga0209677_104977 Ga0209677_1049772 252
413 3300025258 Ga0209129_1000019 Ga0209129_100001912 252
414 3300025258 Ga0209129_1001405 Ga0209129_10014056 252
415 3300025258 Ga0209129_1001452 Ga0209129_10014524 252
416 3300025258 Ga0209129_1003522 Ga0209129_10035227 252
417 3300025261 Ga0209233_1000437 Ga0209233_100043728 252
418 3300025272 Ga0209455_1003981 Ga0209455_10039812 252
419 3300025273 Ga0209673_1004206 Ga0209673_10042065 252
420 3300025284 Ga0209130_1000015 Ga0209130_1000015123 252
421 3300025294 Ga0209025_1000648 Ga0209025_100064856 252
422 3300025294 Ga0209025_1013340 Ga0209025_10133404 252
423 3300025295 Ga0209564_1000021 Ga0209564_1000021353 252
424 3300025295 Ga0209564_1001407 Ga0209564_100140714 252
425 3300025295 Ga0209564_1001647 Ga0209564_100164719 252
426 3300025297 Ga0209758_1000148 Ga0209758_100014890 252
427 3300025297 Ga0209758_1000467 Ga0209758_10004675 252
428 3300025297 Ga0209758_1006875 Ga0209758_10068753 252
429 3300025297 Ga0209758_1048283 Ga0209758_10482832 252
430 3300025299 Ga0209256_1003221 Ga0209256_10032219 252
431 3300025302 Ga0207426_1000122 Ga0207426_1000122109 252
432 3300025303 Ga0209051_1012790 Ga0209051_10127903 252
433 3300025904 Ga0207647_10000006 Ga0207647_10000006203 252
434 3300025904 Ga0207647_10011418 Ga0207647_100114185 252
435 3300025910 Ga0207684_10501209 Ga0207684_105012091 252
436 3300025914 Ga0207671_10000215 Ga0207671_100002152 252
437 3300025919 Ga0207657_10056538 Ga0207657_100565383 252
438 3300025921 Ga0207652_10188736 Ga0207652_101887362 252
439 3300025923 Ga0207681_10179044 Ga0207681_101790442 252
440 3300025924 Ga0207694_10036791 Ga0207694_100367913 252
441 3300025925 Ga0207650_10000532 Ga0207650_1000053236 252
442 3300025936 Ga0207670_10008905 Ga0207670_100089055 252
443 3300025941 Ga0207711_10051695 Ga0207711_100516953 252
444 3300025949 Ga0207667_10075582 Ga0207667_100755823 252
445 3300026041 Ga0207639_10050824 Ga0207639_100508241 252
446 3300026067 Ga0207678_10000697 Ga0207678_1000069725 252
447 3300026067 Ga0207678_10090668 Ga0207678_100906682 252
448 3300026067 Ga0207678_10191745 Ga0207678_101917452 252
449 3300026067 Ga0207678_10446561 Ga0207678_104465611 252
450 3300028379 Ga0268266_10000255 Ga0268266_1000025538 252
451 3300028379 Ga0268266_10079545 Ga0268266_100795452 252
452 3300028800 Ga0265338_10167188 Ga0265338_101671881 252
453 3300031711 Ga0265314_10095289 Ga0265314_100952892 252
454 3300031911 Ga0307412_10000005 Ga0307412_10000005385 252
455 3300031911 Ga0307412_10000954 Ga0307412_1000095411 252
456 3300037853 Ga0436364_1317855 Ga0436364_1317855_1406_2185 252
457 3300039437 Ga0436365_0173869 Ga0436365_0173869_83894_84652 252
458 3300039437 Ga0436365_0214475 Ga0436365_0214475_229_1119 252
459 3300039447 Ga0436361_0347557 Ga0436361_0347557_2397_3158 252
460 3300039447 Ga0436361_1136913 Ga0436361_1136913_761_1543 252
461 3300039453 Ga0436362_0676981 Ga0436362_0676981_1529_2311 252
462 3300041404 Ga0439436_0000001 Ga0439436_0000001_289738_290496 252
463 3300041413 Ga0439465_0001647 Ga0439465_0001647_2862_3620 252
464 3300044693 Ga0466961_0013450 Ga0466961_0013450_354_1133 252
465 3300046452 Ga0495617_000183 Ga0495617_000183_35858_36637 252
466 3300046454 Ga0495592_0175335 Ga0495592_0175335_414_1172 252
467 3300046460 Ga0495638_0000034 Ga0495638_0000034_14532_15311 252
468 3300046471 Ga0495650_0005291 Ga0495650_0005291_2993_3772 252
469 3300046471 Ga0495650_0053886 Ga0495650_0053886_17_796 252
470 3300046474 Ga0495605_0006772 Ga0495605_0006772_5669_6448 252
471 3300046491 Ga0495584_0006501 Ga0495584_0006501_4497_5276 252
472 3300046492 Ga0495585_0000001 Ga0495585_0000001_591354_592133 252
473 3300046492 Ga0495585_0005476 Ga0495585_0005476_3340_4119 252
474 3300046500 Ga0495596_0016626 Ga0495596_0016626_285_1064 252
475 3300046501 Ga0495607_0016052 Ga0495607_0016052_2677_3456 252
476 3300046506 Ga0495583_0009454 Ga0495583_0009454_2921_3706 252
477 3300046506 Ga0495583_0018706 Ga0495583_0018706_837_1616 252
478 3300046507 Ga0495606_0000150 Ga0495606_0000150_108939_109718 252
479 3300046507 Ga0495606_0000154 Ga0495606_0000154_37037_37846 252
480 3300046507 Ga0495606_0002890 Ga0495606_0002890_10736_11515 252
481 3300046507 Ga0495606_0008309 Ga0495606_0008309_3570_4328 252
482 3300046507 Ga0495606_0015946 Ga0495606_0015946_3464_4243 252
483 3300046507 Ga0495606_0021515 Ga0495606_0021515_1217_1996 252
484 3300046512 Ga0495610_0002694 Ga0495610_0002694_9484_10263 252
485 3300046512 Ga0495610_0005914 Ga0495610_0005914_6060_6818 252
486 3300046512 Ga0495610_0010266 Ga0495610_0010266_2434_3192 252
487 3300046512 Ga0495610_0013453 Ga0495610_0013453_3385_4164 252
488 3300046513 Ga0495616_0000001 Ga0495616_0000001_549952_550731 252
489 3300046515 Ga0495620_0000588 Ga0495620_0000588_5646_6425 252
490 3300046518 Ga0495631_0000137 Ga0495631_0000137_45041_45820 252
491 3300046518 Ga0495631_0000966 Ga0495631_0000966_45_824 252
492 3300046519 Ga0495632_0004331 Ga0495632_0004331_1459_2238 252
493 3300046519 Ga0495632_0015610 Ga0495632_0015610_2304_3083 252
494 3300046520 Ga0495637_0008462 Ga0495637_0008462_1782_2561 252
495 3300046522 Ga0495643_0083449 Ga0495643_0083449_710_1489 252
496 3300046522 Ga0495643_0182955 Ga0495643_0182955_126_899 252
497 3300046524 Ga0495648_0000559 Ga0495648_0000559_21102_21881 252
498 3300046524 Ga0495648_0008950 Ga0495648_0008950_72_851 252
499 3300046524 Ga0495648_0202975 Ga0495648_0202975_19_798 252
500 3300046528 Ga0495642_0007496 Ga0495642_0007496_1592_2371 252
501 3300046530 Ga0495654_0173092 Ga0495654_0173092_143_922 252
502 3300046535 Ga0495586_0396980 Ga0495586_0396980_21_779 252
503 3300046543 Ga0495645_0004978 Ga0495645_0004978_6971_7729 252
504 3300046543 Ga0495645_0202228 Ga0495645_0202228_466_1224 252
505 3300046557 Ga0495622_0038416 Ga0495622_0038416_735_1544 252
506 3300046648 Ga0495611_0000001 Ga0495611_0000001_1313992_1314771 252
507 3300046648 Ga0495611_0000429 Ga0495611_0000429_24098_24877 252
508 3300046660 Ga0495625_0000001 Ga0495625_0000001_601266_602045 252
509 3300046660 Ga0495625_0052089 Ga0495625_0052089_2003_2812 252
510 3300046660 Ga0495625_0117404 Ga0495625_0117404_638_1423 252
511 3300046665 Ga0495661_0001957 Ga0495661_0001957_13453_14232 252
512 3300046680 Ga0495646_0146573 Ga0495646_0146573_361_1119 252
513 3300046691 Ga0495670_0005484 Ga0495670_0005484_1805_2584 252
514 3300046691 Ga0495670_0010389 Ga0495670_0010389_1736_2494 252
515 3300046692 Ga0495671_0000480 Ga0495671_0000480_16098_16877 252
516 3300046694 Ga0495649_0007006 Ga0495649_0007006_5202_5981 252
517 3300046694 Ga0495649_0177817 Ga0495649_0177817_114_884 252
518 3300046794 Ga0495589_0000016 Ga0495589_0000016_33316_34095 252
519 3300046810 Ga0495660_0000116 Ga0495660_0000116_51782_52561 252
520 3300046810 Ga0495660_0003525 Ga0495660_0003525_6645_7418 252
521 3300047323 Ga0495683_0001193 Ga0495683_0001193_14473_15252 252
522 3300047323 Ga0495683_0006054 Ga0495683_0006054_2335_3114 252
523 3300047443 Ga0495687_006747 Ga0495687_006747_898_1677 252
524 3300047443 Ga0495687_022771 Ga0495687_022771_437_1216 252
525 3300047446 Ga0495679_000001 Ga0495679_000001_272184_272963 252
526 3300047469 Ga0495673_0000001 Ga0495673_0000001_604731_605615 252
527 3300047469 Ga0495673_0000229 Ga0495673_0000229_59787_60566 252
528 3300047472 Ga0495686_0000085 Ga0495686_0000085_141299_142072 252
529 3300047472 Ga0495686_0002146 Ga0495686_0002146_8874_9653 252
530 3300047472 Ga0495686_0018004 Ga0495686_0018004_2634_3413 252
531 3300047472 Ga0495686_0018953 Ga0495686_0018953_1075_1833 252
532 3300047472 Ga0495686_0201372 Ga0495686_0201372_29_808 252
533 3300048091 Ga0495626_0012426 Ga0495626_0012426_3442_4221 252
534 3300048909 Ga0496106_0002982 Ga0496106_0002982_10257_11036 252
535 3300048913 Ga0496110_0344718 Ga0496110_0344718_542_1303 252
536 3300048914 Ga0496111_0001880 Ga0496111_0001880_8586_9347 252
537 3300048914 Ga0496111_0138037 Ga0496111_0138037_567_1340 252
538 3300048920 Ga0496117_0028424 Ga0496117_0028424_65_844 252
539 3300048920 Ga0496117_0043057 Ga0496117_0043057_2477_3250 252
540 3300048921 Ga0496118_0001001 Ga0496118_0001001_28049_28822 252
541 3300048921 Ga0496118_0001737 Ga0496118_0001737_14303_15076 252
542 3300048921 Ga0496118_0009257 Ga0496118_0009257_6399_7178 252
543 3300048921 Ga0496118_0027108 Ga0496118_0027108_481_1251 252
544 3300048922 Ga0496119_0027600 Ga0496119_0027600_2490_3248 252
545 3300048924 Ga0496121_0000129 Ga0496121_0000129_127111_127884 252
546 3300048924 Ga0496121_0000308 Ga0496121_0000308_100936_101715 252
547 3300048924 Ga0496121_0000905 Ga0496121_0000905_12749_13528 252
548 3300048924 Ga0496121_0035264 Ga0496121_0035264_162_920 252
549 3300048924 Ga0496121_0253953 Ga0496121_0253953_161_943 252
550 3300048925 Ga0496122_0006856 Ga0496122_0006856_11404_12177 252
551 3300048925 Ga0496122_0034164 Ga0496122_0034164_1534_2295 252
552 3300048925 Ga0496122_0113820 Ga0496122_0113820_585_1358 252
553 3300048926 Ga0496123_0004244 Ga0496123_0004244_638_1408 252
554 3300048926 Ga0496123_0005671 Ga0496123_0005671_5078_5851 252
555 3300048926 Ga0496123_0070752 Ga0496123_0070752_84_845 252
556 3300048927 Ga0496124_0125030 Ga0496124_0125030_175_936 252
557 3300048929 Ga0496126_0011136 Ga0496126_0011136_6406_7164 252
558 3300048929 Ga0496126_0054809 Ga0496126_0054809_493_1266 252
559 3300048929 Ga0496126_0358547 Ga0496126_0358547_229_1008 252
560 3300049459 Ga0495678_000475 Ga0495678_000475_32957_33736 252
561 3300049460 Ga0495682_0000576 Ga0495682_0000576_13903_14682 252
562 3300049460 Ga0495682_0008745 Ga0495682_0008745_2314_3093 252
563 3300049570 Ga0501033_0096266 Ga0501033_0096266_517_1293 252
564 3300049574 Ga0501038_0120442 Ga0501038_0120442_561_1337 252
565 3300049580 Ga0501046_0041425 Ga0501046_0041425_1070_1846 252
566 3300049586 Ga0501070_0090736 Ga0501070_0090736_794_1570 252
567 3300049822 Ga0501035_0069317 Ga0501035_0069317_476_1252 252
568 3300049823 Ga0501044_0018799 Ga0501044_0018799_5650_6426 252
569 3300053087 Ga0500643_000002 Ga0500643_000002_500831_501610 252
570 3300053103 Ga0500555_000288 Ga0500555_000288_7004_7783 252
571 3300053125 Ga0500618_000111 Ga0500618_000111_13395_14156 252
572 3300053150 Ga0500603_003350 Ga0500603_003350_2525_3283 252
573 3300053153 Ga0500616_0011692 Ga0500616_0011692_3719_4492 252
574 3300053156 Ga0500622_0000335 Ga0500622_0000335_39252_40022 252
575 3300053156 Ga0500622_0045354 Ga0500622_0045354_153_932 252
576 3300053160 Ga0500633_0090956 Ga0500633_0090956_239_1018 252
577 3300053730 Ga0500645_001386 Ga0500645_001386_6392_7171 252
578 iso_pu_bacteria 2501025501 2501073807 252
579 iso_pu_bacteria 2501025502 2501079074 252
580 iso_pu_bacteria 2501025504 2501407645 252
581 iso_pu_bacteria 2508501125 2509129968 252
582 iso_pu_bacteria 2510917013 2511093473 252
583 iso_pu_bacteria 2510917014 2511097517 252
584 iso_pu_bacteria 2510917015 2511105536 252
585 iso_pu_bacteria 2510917030 2511200463 252
586 iso_pu_bacteria 2515154189 2516022515 252
587 iso_pu_bacteria 2582581299 2585230599 252
588 iso_pu_bacteria 2617270735 2617346373 252
589 iso_pu_bacteria 2643221643 2644240922 252
590 iso_pu_bacteria 2734482264 2735837095 252
591 iso_pu_bacteria 2738543009 2739226551 252
592 iso_pu_bacteria 2738543031 2739351467 252
593 iso_pu_bacteria 2739367700 2739731840 252
594 iso_pu_bacteria 2808606384 2808970880 252
595 iso_pu_bacteria 2808606390 2809005711 252
596 iso_pu_bacteria 2808606391 2809012532 252
597 iso_pu_bacteria 2824773399 2824774635 252
598 iso_pu_bacteria 2857357740 2857358049 252
599 iso_pu_bacteria 2881412998 2881413179 252
600 iso_pu_bacteria 2883087390 2883089841 252
601 iso_pu_bacteria 2884338543 2884339975 252
602 iso_pu_bacteria 2891048133 2891050352 252
603 iso_pu_bacteria 2919100787 2919100913 252
604 iso_pu_bacteria 2941471342 2941472260 252
605 iso_pu_bacteria 3005445848 3005446513 252
606 iso_pu_bacteria 3005452660 3005453231 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

49

247

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

55

295

0.95

PF08659

KR

KR domain

50

230

0.89

PF23441

42

296

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3icc-assembly1.cif.gz_A crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution 0.9621 5 252
4osp-assembly1.cif.gz_C the crystal structure of urdamycin c-6 ketoreductase domain urdmred with bound nadp and rabelomycin 0.9614 5 245
4osp-assembly1.cif.gz_D the crystal structure of urdamycin c-6 ketoreductase domain urdmred with bound nadp and rabelomycin 0.9604 5 249
4fgs-assembly1.cif.gz_D crystal structure of a probable dehydrogenase protein 0.9583 4 251
7nm7-assembly1.cif.gz_AAA the crystal structure of the antimycin pathway standalone ketoreductase, antm 0.9578 5 252
ID Description Score Start End Superfamily
4ospB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9531 5 249 3.40.50.720
4mowD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9475 5 250 3.40.50.720
3wtbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9423 3 252 3.40.50.720
3v2gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9414 3 249 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9405 5 252 3.40.50.720
ID Description Score Start End GO Terms
AF-K8D0U4-F1-model_v4 deleted 0.996 4 184
AF-A0A542LX34-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9926 4 252 GO:0016616
GO:0030497
AF-A0A0P8XBT2-F1-model_v4 Short chain dehydrogenase family protein 0.9922 4 245
AF-R9VI22-F1-model_v4 deleted 0.9915 2 252
AF-A0A497ZGF6-F1-model_v4 deleted 0.9908 3 252

Feature Viewer

pLDDT pTM Quality
95.67 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map