F468611
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 606 | 378 | 550 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0214475|Ga0436365_0214475_229_1119 |
| Length | 296 |
| Sequence | MSHTRWSRIRQEIEWFRHSVRRAVAGSIAPEDRGSPDVRQKEIQLADNKIAIVTGGSRGIGRSTVLALAKRGVRSIFTFHSNRTEAGAVIALAKEAGAPATALQLDTGNIASFAAFAGDVRTALRSMGAERFDYLVNNAGTSSNASLETITEAEMDALYNVHFKGVLFLTQKLVPLMNDGGRIVNVSSGLARFTSPGRIAYGSIKAGVETLTRYMAMELGPRRITANVIAPGAIATDFSGGMVRDNPHVNKMIAERTALGRVGLPDDVGPAIAALLSDELGWVNAQRIEVSGGIHI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 5 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 6 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 7 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 8 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 9 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 10 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 11 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 12 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 13 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 14 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 15 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 16 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 17 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 18 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 19 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 20 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 21 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 22 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 23 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 24 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 25 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 26 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 27 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 28 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 29 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 30 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 31 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 32 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 33 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 34 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 35 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 36 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 37 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 38 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 39 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 40 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 41 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 42 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 43 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 44 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 45 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 46 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 47 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 48 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 49 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 50 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 51 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 52 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 53 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 54 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 55 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 56 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 57 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 58 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 59 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 60 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 61 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 62 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 63 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 64 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 65 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 66 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 67 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 68 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 69 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 70 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 71 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 72 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 73 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 74 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 75 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 76 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 77 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 78 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 79 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 80 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 83 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 85 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 87 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 88 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 102 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 103 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 107 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 109 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 112 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 114 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 115 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 117 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 118 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 119 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 120 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 121 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 122 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 123 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 124 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 125 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 127 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 129 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 130 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 131 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 132 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 133 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 135 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 153 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 157 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 158 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 160 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 161 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 165 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 222 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 228 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 230 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 232 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 233 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 234 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 235 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 236 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 243 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 244 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 245 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 246 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 247 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 248 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 249 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 250 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 251 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 252 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 253 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 254 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 255 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 256 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 257 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 258 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 259 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 330 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 331 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 332 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 333 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 334 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 335 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 336 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 337 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 338 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 339 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 340 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 341 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 342 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 343 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 344 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 345 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 368 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 369 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 370 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 372 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 373 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 374 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 375 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 376 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 377 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 378 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.76 |
| Metatranscriptomes | 0 |
| Isolates | 9.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.73 |
| Nodule | 1.16 |
| Rhizoplane | 1.49 |
| Rhizosphere | 72.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000693 | 3300001979 | Bacteria | 14599 |
| 2 | JGI24739J22299_10001046 | 3300001989 | Bacteria | 10272 |
| 3 | JGI24738J21930_10000691 | 3300002075 | Bacteria | 9709 |
| 4 | JGI25152J39213_1003013 | 3300002773 | Bacteria | 5955 |
| 5 | JGI25152J39213_1004554 | 3300002773 | Bacteria | 4328 |
| 6 | JGI25159J45721_1003111 | 3300002987 | Bacteria | 5988 |
| 7 | JGI25151J46595_10033277 | 3300003187 | Bacteria | 1987 |
| 8 | JGI25153J46596_10003507 | 3300003215 | Bacteria | 8755 |
| 9 | JGI25153J46596_10010019 | 3300003215 | Bacteria | 4328 |
| 10 | rootH1_10035169 | 3300003316 | Bacteria | 59849 |
| 11 | rootH2_10038272 | 3300003320 | Bacteria | 20840 |
| 12 | rootH2_10169690 | 3300003320 | Bacteria | 1355 |
| 13 | rootL2_10009353 | 3300003322 | Bacteria | 5999 |
| 14 | rootL2_10046952 | 3300003322 | Bacteria | 10020 |
| 15 | rootH1_10012599 | 3300003323 | Bacteria | 111210 |
| 16 | rootH1_10074328 | 3300003323 | Bacteria | 3186 |
| 17 | JGI25160J50197_1026237 | 3300003354 | Bacteria | 1611 |
| 18 | JGI25161J50226_1000121 | 3300003374 | Bacteria | 56946 |
| 19 | Ga0055539_1005125 | 3300003752 | Bacteria | 1713 |
| 20 | Ga0055526_1001233 | 3300003771 | Bacteria | 18375 |
| 21 | Ga0055526_1001525 | 3300003771 | Bacteria | 16383 |
| 22 | Ga0055537_1000027 | 3300003773 | Bacteria | 102244 |
| 23 | Ga0055537_1000451 | 3300003773 | Bacteria | 26082 |
| 24 | Ga0055524_1002341 | 3300003775 | Bacteria | 9852 |
| 25 | Ga0055524_1007749 | 3300003775 | Bacteria | 4529 |
| 26 | Ga0055534_1000019 | 3300003784 | Bacteria | 137920 |
| 27 | Ga0055528_1000048 | 3300003790 | Bacteria | 95179 |
| 28 | Ga0055528_1006534 | 3300003790 | Bacteria | 5281 |
| 29 | Ga0058692_1004357 | 3300003856 | Bacteria | 4207 |
| 30 | Ga0058692_1013222 | 3300003856 | Bacteria | 1929 |
| 31 | Ga0055543_1000176 | 3300004625 | Bacteria | 53419 |
| 32 | Ga0065165_1005757 | 3300005262 | Bacteria | 6800 |
| 33 | Ga0065714_10134458 | 3300005288 | Bacteria | 1221 |
| 34 | Ga0065712_10074544 | 3300005290 | Bacteria | 4069 |
| 35 | Ga0065715_10097412 | 3300005293 | Bacteria | 3709 |
| 36 | Ga0070676_10094966 | 3300005328 | Bacteria | 1833 |
| 37 | Ga0070676_10188620 | 3300005328 | Bacteria | 1345 |
| 38 | Ga0070690_100001305 | 3300005330 | Bacteria | 12949 |
| 39 | Ga0070670_100000133 | 3300005331 | Bacteria | 69691 |
| 40 | Ga0070670_100021796 | 3300005331 | Bacteria | 5510 |
| 41 | Ga0068869_100005387 | 3300005334 | Bacteria | 8039 |
| 42 | Ga0070666_10001004 | 3300005335 | Bacteria | 17255 |
| 43 | Ga0070666_10007647 | 3300005335 | Bacteria | 6671 |
| 44 | Ga0070666_10131368 | 3300005335 | Bacteria | 1740 |
| 45 | Ga0068868_100126369 | 3300005338 | Bacteria | 2089 |
| 46 | Ga0070689_100003506 | 3300005340 | Bacteria | 10433 |
| 47 | Ga0070691_10040529 | 3300005341 | Bacteria | 2201 |
| 48 | Ga0070687_100002238 | 3300005343 | Bacteria | 7175 |
| 49 | Ga0070661_100125675 | 3300005344 | Bacteria | 1924 |
| 50 | Ga0070661_100425268 | 3300005344 | Bacteria | 1053 |
| 51 | Ga0070668_100023659 | 3300005347 | Bacteria | 4649 |
| 52 | Ga0070669_100008171 | 3300005353 | Bacteria | 7473 |
| 53 | Ga0070675_100000236 | 3300005354 | Bacteria | 35636 |
| 54 | Ga0070671_100029861 | 3300005355 | Bacteria | 4497 |
| 55 | Ga0070673_100018756 | 3300005364 | Bacteria | 4953 |
| 56 | Ga0070673_100645355 | 3300005364 | Bacteria | 968 |
| 57 | Ga0070667_100052891 | 3300005367 | Bacteria | 3427 |
| 58 | Ga0070667_100217479 | 3300005367 | Bacteria | 1700 |
| 59 | Ga0070705_100014853 | 3300005440 | Bacteria | 4016 |
| 60 | Ga0070694_100041879 | 3300005444 | Bacteria | 3057 |
| 61 | Ga0070708_100051939 | 3300005445 | Bacteria | 3633 |
| 62 | Ga0070708_100068795 | 3300005445 | Bacteria | 3183 |
| 63 | Ga0070708_100504256 | 3300005445 | Bacteria | 1142 |
| 64 | Ga0070662_100000839 | 3300005457 | Bacteria | 18896 |
| 65 | Ga0070681_10060774 | 3300005458 | Bacteria | 3755 |
| 66 | Ga0070681_10309551 | 3300005458 | Bacteria | 1489 |
| 67 | Ga0068867_100003350 | 3300005459 | Bacteria | 11286 |
| 68 | Ga0068867_100329663 | 3300005459 | Bacteria | 1267 |
| 69 | Ga0070706_100155852 | 3300005467 | Bacteria | 2132 |
| 70 | Ga0070699_100343507 | 3300005518 | Bacteria | 1343 |
| 71 | Ga0070684_100036141 | 3300005535 | Bacteria | 4232 |
| 72 | Ga0068853_100064952 | 3300005539 | Bacteria | 3166 |
| 73 | Ga0068853_100122745 | 3300005539 | Bacteria | 2319 |
| 74 | Ga0068853_100260813 | 3300005539 | Bacteria | 1593 |
| 75 | Ga0070672_100068583 | 3300005543 | Bacteria | 2813 |
| 76 | Ga0070686_100002094 | 3300005544 | Bacteria | 11005 |
| 77 | Ga0070665_100073478 | 3300005548 | Bacteria | 3425 |
| 78 | Ga0070665_100116078 | 3300005548 | Bacteria | 2680 |
| 79 | Ga0070665_100382258 | 3300005548 | Bacteria | 1415 |
| 80 | Ga0070704_100068113 | 3300005549 | Bacteria | 2573 |
| 81 | Ga0068855_100289722 | 3300005563 | Bacteria | 1815 |
| 82 | Ga0068855_100424344 | 3300005563 | Bacteria | 1454 |
| 83 | Ga0070664_100003665 | 3300005564 | Bacteria | 12371 |
| 84 | Ga0068857_100114768 | 3300005577 | Bacteria | 2422 |
| 85 | Ga0068857_100137039 | 3300005577 | Unclassified | 2210 |
| 86 | Ga0068857_100617898 | 3300005577 | Bacteria | 1025 |
| 87 | Ga0068856_100005379 | 3300005614 | Bacteria | 12620 |
| 88 | Ga0068856_100260019 | 3300005614 | Unclassified | 1751 |
| 89 | Ga0070702_100017244 | 3300005615 | Bacteria | 3722 |
| 90 | Ga0068852_100018063 | 3300005616 | Bacteria | 5549 |
| 91 | Ga0068852_100571719 | 3300005616 | Bacteria | 1132 |
| 92 | Ga0068852_100647654 | 3300005616 | Bacteria | 1064 |
| 93 | Ga0068859_100003877 | 3300005617 | Bacteria | 15277 |
| 94 | Ga0068864_100009414 | 3300005618 | Bacteria | 8059 |
| 95 | Ga0068864_100354347 | 3300005618 | Bacteria | 1385 |
| 96 | Ga0068864_100937957 | 3300005618 | Bacteria | 856 |
| 97 | Ga0068861_100010322 | 3300005719 | Bacteria | 6479 |
| 98 | Ga0068870_10017259 | 3300005840 | Bacteria | 3465 |
| 99 | Ga0068863_100013640 | 3300005841 | Bacteria | 7839 |
| 100 | Ga0068858_100043347 | 3300005842 | Bacteria | 4172 |
| 101 | Ga0068860_100102174 | 3300005843 | Bacteria | 2735 |
| 102 | Ga0068862_100000384 | 3300005844 | Bacteria | 47655 |
| 103 | Ga0068862_100000566 | 3300005844 | Bacteria | 38602 |
| 104 | Ga0070717_10330736 | 3300006028 | Bacteria | 1359 |
| 105 | Ga0075366_10054707 | 3300006195 | Bacteria | 2370 |
| 106 | Ga0097621_100071486 | 3300006237 | Bacteria | 2867 |
| 107 | Ga0097621_100343219 | 3300006237 | Bacteria | 1326 |
| 108 | Ga0068871_100155150 | 3300006358 | Bacteria | 1955 |
| 109 | Ga0075430_100054834 | 3300006846 | Bacteria | 3353 |
| 110 | Ga0075431_100138666 | 3300006847 | Bacteria | 2507 |
| 111 | Ga0075431_100517429 | 3300006847 | Bacteria | 1183 |
| 112 | Ga0075429_100014751 | 3300006880 | Bacteria | 6772 |
| 113 | Ga0068865_100331420 | 3300006881 | Bacteria | 1227 |
| 114 | Ga0068865_100567742 | 3300006881 | Bacteria | 955 |
| 115 | Ga0097620_100003879 | 3300006931 | Bacteria | 15277 |
| 116 | Ga0079104_1000036 | 3300006946 | Bacteria | 194741 |
| 117 | Ga0105251_10133278 | 3300009011 | Bacteria | 1126 |
| 118 | Ga0105240_10000723 | 3300009093 | Bacteria | 60353 |
| 119 | Ga0105240_10320154 | 3300009093 | Bacteria | 1768 |
| 120 | Ga0105240_10851404 | 3300009093 | Bacteria | 984 |
| 121 | Ga0105245_10001203 | 3300009098 | Bacteria | 23428 |
| 122 | Ga0105245_10181788 | 3300009098 | Bacteria | 2010 |
| 123 | Ga0105245_10384965 | 3300009098 | Bacteria | 1398 |
| 124 | Ga0114129_10177291 | 3300009147 | Bacteria | 2902 |
| 125 | Ga0105241_10000516 | 3300009174 | Bacteria | 29076 |
| 126 | Ga0105248_10006352 | 3300009177 | Bacteria | 12965 |
| 127 | Ga0105248_10076098 | 3300009177 | Bacteria | 3772 |
| 128 | Ga0105237_10001366 | 3300009545 | Bacteria | 32234 |
| 129 | Ga0105237_10004109 | 3300009545 | Bacteria | 16975 |
| 130 | Ga0105237_10067444 | 3300009545 | Bacteria | 3571 |
| 131 | Ga0105237_10330439 | 3300009545 | Bacteria | 1529 |
| 132 | Ga0105238_10000678 | 3300009551 | Bacteria | 35832 |
| 133 | Ga0105238_10031362 | 3300009551 | Bacteria | 5410 |
| 134 | Ga0105238_10132092 | 3300009551 | Bacteria | 2475 |
| 135 | Ga0105249_10005262 | 3300009553 | Bacteria | 11170 |
| 136 | Ga0105249_10343094 | 3300009553 | Bacteria | 1511 |
| 137 | Ga0105249_10607599 | 3300009553 | Bacteria | 1149 |
| 138 | Ga0105239_10050687 | 3300010375 | Bacteria | 4552 |
| 139 | Ga0105239_10405333 | 3300010375 | Bacteria | 1543 |
| 140 | Ga0105246_10094436 | 3300011119 | Bacteria | 2163 |
| 141 | Ga0157371_10038484 | 3300013102 | Bacteria | 3421 |
| 142 | Ga0157369_10001160 | 3300013105 | Bacteria | 32867 |
| 143 | Ga0157369_10004776 | 3300013105 | Bacteria | 15927 |
| 144 | Ga0163162_10165638 | 3300013306 | Bacteria | 2334 |
| 145 | Ga0163162_10636805 | 3300013306 | Bacteria | 1191 |
| 146 | Ga0157372_10000358 | 3300013307 | Bacteria | 50206 |
| 147 | Ga0157372_10007957 | 3300013307 | Bacteria | 11270 |
| 148 | Ga0163163_10230991 | 3300014325 | Bacteria | 1899 |
| 149 | Ga0157380_10434523 | 3300014326 | Bacteria | 1256 |
| 150 | Ga0182008_10009391 | 3300014497 | Bacteria | 5281 |
| 151 | Ga0182008_10012070 | 3300014497 | Bacteria | 4570 |
| 152 | Ga0157377_10022903 | 3300014745 | Bacteria | 3304 |
| 153 | Ga0157376_10003459 | 3300014969 | Bacteria | 10880 |
| 154 | Ga0182006_1000005 | 3300015261 | Bacteria | 621201 |
| 155 | Ga0182006_1000355 | 3300015261 | Bacteria | 38520 |
| 156 | Ga0182007_10059316 | 3300015262 | Bacteria | 1255 |
| 157 | Ga0183361_10007 | 3300016635 | Bacteria | 339575 |
| 158 | Ga0163161_10532936 | 3300017792 | Bacteria | 960 |
| 159 | Ga0213872_10000013 | 3300021361 | Bacteria | 182866 |
| 160 | Ga0213872_10000282 | 3300021361 | Bacteria | 43374 |
| 161 | Ga0213872_10135481 | 3300021361 | Bacteria | 1083 |
| 162 | Ga0213876_10008842 | 3300021384 | Bacteria | 5435 |
| 163 | Ga0209436_100002 | 3300025208 | Bacteria | 222172 |
| 164 | Ga0209672_100695 | 3300025228 | Bacteria | 16861 |
| 165 | Ga0207427_104033 | 3300025231 | Bacteria | 2674 |
| 166 | Ga0209646_1003510 | 3300025246 | Bacteria | 3079 |
| 167 | Ga0209677_104977 | 3300025253 | Bacteria | 3618 |
| 168 | Ga0209129_1000019 | 3300025258 | Bacteria | 460802 |
| 169 | Ga0209129_1001405 | 3300025258 | Bacteria | 13470 |
| 170 | Ga0209129_1001452 | 3300025258 | Bacteria | 13222 |
| 171 | Ga0209129_1003522 | 3300025258 | Bacteria | 6760 |
| 172 | Ga0209233_1000437 | 3300025261 | Bacteria | 29382 |
| 173 | Ga0209565_1000017 | 3300025263 | Bacteria | 462438 |
| 174 | Ga0209455_1003981 | 3300025272 | Bacteria | 5010 |
| 175 | Ga0209673_1000007 | 3300025273 | Bacteria | 634477 |
| 176 | Ga0209673_1004206 | 3300025273 | Bacteria | 7855 |
| 177 | Ga0209130_1000015 | 3300025284 | Bacteria | 409631 |
| 178 | Ga0209675_1000009 | 3300025291 | Bacteria | 562872 |
| 179 | Ga0209676_1000812 | 3300025292 | Bacteria | 40825 |
| 180 | Ga0209025_1000648 | 3300025294 | Bacteria | 60937 |
| 181 | Ga0209025_1013340 | 3300025294 | Bacteria | 5176 |
| 182 | Ga0209564_1000021 | 3300025295 | Bacteria | 571316 |
| 183 | Ga0209564_1000036 | 3300025295 | Bacteria | 423455 |
| 184 | Ga0209564_1001407 | 3300025295 | Bacteria | 24859 |
| 185 | Ga0209564_1001647 | 3300025295 | Bacteria | 21535 |
| 186 | Ga0209758_1000148 | 3300025297 | Bacteria | 166232 |
| 187 | Ga0209758_1000467 | 3300025297 | Bacteria | 66705 |
| 188 | Ga0209758_1006875 | 3300025297 | Bacteria | 7952 |
| 189 | Ga0209758_1048283 | 3300025297 | Bacteria | 1514 |
| 190 | Ga0209758_1062474 | 3300025297 | Bacteria | 1219 |
| 191 | Ga0209256_1000091 | 3300025299 | Bacteria | 210945 |
| 192 | Ga0209256_1003221 | 3300025299 | Bacteria | 11777 |
| 193 | Ga0207426_1000122 | 3300025302 | Bacteria | 218307 |
| 194 | Ga0207426_1023152 | 3300025302 | Bacteria | 2123 |
| 195 | Ga0209051_1012790 | 3300025303 | Bacteria | 4038 |
| 196 | Ga0207680_10093320 | 3300025903 | Bacteria | 1920 |
| 197 | Ga0207680_10123434 | 3300025903 | Bacteria | 1697 |
| 198 | Ga0207647_10000006 | 3300025904 | Bacteria | 214791 |
| 199 | Ga0207647_10011418 | 3300025904 | Bacteria | 6231 |
| 200 | Ga0207645_10266012 | 3300025907 | Bacteria | 1136 |
| 201 | Ga0207643_10019027 | 3300025908 | Bacteria | 3762 |
| 202 | Ga0207684_10501209 | 3300025910 | Bacteria | 1041 |
| 203 | Ga0207654_10003830 | 3300025911 | Bacteria | 7584 |
| 204 | Ga0207695_10000648 | 3300025913 | Bacteria | 69088 |
| 205 | Ga0207671_10000215 | 3300025914 | Bacteria | 87204 |
| 206 | Ga0207671_10187050 | 3300025914 | Bacteria | 1614 |
| 207 | Ga0207660_10434875 | 3300025917 | Bacteria | 1060 |
| 208 | Ga0207662_10003084 | 3300025918 | Bacteria | 8503 |
| 209 | Ga0207657_10056538 | 3300025919 | Bacteria | 3385 |
| 210 | Ga0207649_10153606 | 3300025920 | Bacteria | 1588 |
| 211 | Ga0207649_10202374 | 3300025920 | Bacteria | 1403 |
| 212 | Ga0207652_10188736 | 3300025921 | Bacteria | 1853 |
| 213 | Ga0207652_10372521 | 3300025921 | Bacteria | 1289 |
| 214 | Ga0207681_10004231 | 3300025923 | Bacteria | 8863 |
| 215 | Ga0207681_10179044 | 3300025923 | Bacteria | 1613 |
| 216 | Ga0207694_10011304 | 3300025924 | Bacteria | 6739 |
| 217 | Ga0207694_10036791 | 3300025924 | Bacteria | 3757 |
| 218 | Ga0207650_10000532 | 3300025925 | Bacteria | 31166 |
| 219 | Ga0207650_10064715 | 3300025925 | Bacteria | 2738 |
| 220 | Ga0207644_10030880 | 3300025931 | Bacteria | 3730 |
| 221 | Ga0207706_10004708 | 3300025933 | Bacteria | 12779 |
| 222 | Ga0207670_10008905 | 3300025936 | Bacteria | 5691 |
| 223 | Ga0207670_10044829 | 3300025936 | Bacteria | 2928 |
| 224 | Ga0207704_10195441 | 3300025938 | Bacteria | 1475 |
| 225 | Ga0207691_10015438 | 3300025940 | Bacteria | 7263 |
| 226 | Ga0207711_10008386 | 3300025941 | Bacteria | 8647 |
| 227 | Ga0207711_10051695 | 3300025941 | Bacteria | 3520 |
| 228 | Ga0207711_10496385 | 3300025941 | Bacteria | 1137 |
| 229 | Ga0207679_10006942 | 3300025945 | Bacteria | 7175 |
| 230 | Ga0207667_10075582 | 3300025949 | Bacteria | 3497 |
| 231 | Ga0207651_10034680 | 3300025960 | Bacteria | 3271 |
| 232 | Ga0207712_10004437 | 3300025961 | Bacteria | 8864 |
| 233 | Ga0207668_10179971 | 3300025972 | Bacteria | 1666 |
| 234 | Ga0207640_10038382 | 3300025981 | Bacteria | 3022 |
| 235 | Ga0207658_10639071 | 3300025986 | Bacteria | 958 |
| 236 | Ga0207677_10033090 | 3300026023 | Bacteria | 3331 |
| 237 | Ga0207677_10330704 | 3300026023 | Bacteria | 1270 |
| 238 | Ga0207703_10137477 | 3300026035 | Bacteria | 2117 |
| 239 | Ga0207639_10046499 | 3300026041 | Bacteria | 3275 |
| 240 | Ga0207639_10050824 | 3300026041 | Bacteria | 3150 |
| 241 | Ga0207639_10248750 | 3300026041 | Bacteria | 1549 |
| 242 | Ga0207678_10000697 | 3300026067 | Bacteria | 30609 |
| 243 | Ga0207678_10003997 | 3300026067 | Bacteria | 13264 |
| 244 | Ga0207678_10090668 | 3300026067 | Bacteria | 2613 |
| 245 | Ga0207678_10191745 | 3300026067 | Bacteria | 1747 |
| 246 | Ga0207678_10436886 | 3300026067 | Bacteria | 1136 |
| 247 | Ga0207678_10446561 | 3300026067 | Bacteria | 1124 |
| 248 | Ga0207708_10028275 | 3300026075 | Bacteria | 4246 |
| 249 | Ga0207702_10028255 | 3300026078 | Bacteria | 4661 |
| 250 | Ga0207702_10219077 | 3300026078 | Bacteria | 1773 |
| 251 | Ga0207641_10133031 | 3300026088 | Bacteria | 2235 |
| 252 | Ga0207648_10009062 | 3300026089 | Bacteria | 9572 |
| 253 | Ga0207676_10007647 | 3300026095 | Bacteria | 7670 |
| 254 | Ga0207676_10803637 | 3300026095 | Bacteria | 918 |
| 255 | Ga0207674_10382625 | 3300026116 | Bacteria | 1360 |
| 256 | Ga0207675_100007722 | 3300026118 | Bacteria | 10151 |
| 257 | Ga0207675_100084526 | 3300026118 | Bacteria | 2978 |
| 258 | Ga0207698_10257126 | 3300026142 | Bacteria | 1602 |
| 259 | Ga0209281_1000080 | 3300027111 | Bacteria | 261394 |
| 260 | Ga0209371_1000029 | 3300027312 | Bacteria | 424797 |
| 261 | Ga0209371_1017347 | 3300027312 | Bacteria | 1867 |
| 262 | Ga0268266_10000255 | 3300028379 | Bacteria | 89930 |
| 263 | Ga0268266_10007060 | 3300028379 | Bacteria | 10198 |
| 264 | Ga0268266_10050832 | 3300028379 | Bacteria | 3557 |
| 265 | Ga0268266_10079545 | 3300028379 | Bacteria | 2854 |
| 266 | Ga0268265_10001478 | 3300028380 | Bacteria | 19705 |
| 267 | Ga0268265_10001770 | 3300028380 | Bacteria | 17326 |
| 268 | Ga0268265_10553976 | 3300028380 | Bacteria | 1092 |
| 269 | Ga0268264_10026436 | 3300028381 | Bacteria | 4743 |
| 270 | Ga0265338_10019103 | 3300028800 | Bacteria | 7293 |
| 271 | Ga0265338_10167188 | 3300028800 | Bacteria | 1692 |
| 272 | Ga0268256_1000032 | 3300030500 | Bacteria | 424603 |
| 273 | Ga0268256_1015296 | 3300030500 | Bacteria | 2245 |
| 274 | Ga0268256_1035958 | 3300030500 | Bacteria | 1146 |
| 275 | Ga0265314_10095289 | 3300031711 | Bacteria | 1927 |
| 276 | Ga0307516_10096376 | 3300031730 | Bacteria | 2779 |
| 277 | Ga0307405_10253241 | 3300031731 | Bacteria | 1311 |
| 278 | Ga0307410_10084328 | 3300031852 | Bacteria | 2240 |
| 279 | Ga0307410_10454322 | 3300031852 | Bacteria | 1046 |
| 280 | Ga0307406_10258351 | 3300031901 | Bacteria | 1316 |
| 281 | Ga0307412_10000005 | 3300031911 | Bacteria | 526194 |
| 282 | Ga0307412_10000954 | 3300031911 | Bacteria | 16544 |
| 283 | Ga0307412_10135257 | 3300031911 | Bacteria | 1797 |
| 284 | Ga0307416_100057652 | 3300032002 | Bacteria | 3144 |
| 285 | Ga0307416_100471428 | 3300032002 | Bacteria | 1313 |
| 286 | Ga0307414_10060547 | 3300032004 | Bacteria | 2678 |
| 287 | Ga0307415_100014235 | 3300032126 | Bacteria | 4669 |
| 288 | Ga0395898_0495080 | 3300037466 | Bacteria | 1163 |
| 289 | Ga0395905_0015859 | 3300037471 | Bacteria | 7158 |
| 290 | Ga0436364_1317855 | 3300037853 | Bacteria | 2249 |
| 291 | Ga0395901_0120117 | 3300038443 | Bacteria | 2762 |
| 292 | Ga0436365_0173869 | 3300039437 | Bacteria | 89108 |
| 293 | Ga0436365_0214475 | 3300039437 | Bacteria | 1271 |
| 294 | Ga0436365_0423225 | 3300039437 | Bacteria | 1461 |
| 295 | Ga0436361_0027396 | 3300039447 | Bacteria | 3390 |
| 296 | Ga0436361_0347557 | 3300039447 | Bacteria | 3242 |
| 297 | Ga0436361_0743645 | 3300039447 | Bacteria | 72606 |
| 298 | Ga0436361_1136913 | 3300039447 | Bacteria | 10109 |
| 299 | Ga0436362_0676981 | 3300039453 | Unclassified | 3270 |
| 300 | Ga0439436_0000001 | 3300041404 | Bacteria | 299341 |
| 301 | Ga0439465_0001647 | 3300041413 | Bacteria | 7281 |
| 302 | Ga0439452_000012 | 3300042010 | Bacteria | 412478 |
| 303 | Ga0466969_0073818 | 3300044656 | Bacteria | 1637 |
| 304 | Ga0466972_0000464 | 3300044658 | Bacteria | 20631 |
| 305 | Ga0466972_0004636 | 3300044658 | Bacteria | 6883 |
| 306 | Ga0466972_0029329 | 3300044658 | Bacteria | 2708 |
| 307 | Ga0466972_0099209 | 3300044658 | Unclassified | 1378 |
| 308 | Ga0466982_0000002 | 3300044672 | Bacteria | 454900 |
| 309 | Ga0466965_0028276 | 3300044683 | Bacteria | 2723 |
| 310 | Ga0466966_0001538 | 3300044684 | Bacteria | 14786 |
| 311 | Ga0466961_0013450 | 3300044693 | Bacteria | 5242 |
| 312 | Ga0466964_0012746 | 3300044706 | Bacteria | 3183 |
| 313 | Ga0466971_0016238 | 3300044719 | Bacteria | 3282 |
| 314 | Ga0466970_0019714 | 3300044765 | Bacteria | 3498 |
| 315 | Ga0466957_0522992 | 3300044842 | Bacteria | 824 |
| 316 | Ga0466959_0145316 | 3300045049 | Bacteria | 1674 |
| 317 | Ga0466967_0034275 | 3300045976 | Bacteria | 4308 |
| 318 | Ga0495617_000183 | 3300046452 | Bacteria | 39626 |
| 319 | Ga0495617_000639 | 3300046452 | Bacteria | 17588 |
| 320 | Ga0495627_001483 | 3300046453 | Bacteria | 13607 |
| 321 | Ga0495592_0032166 | 3300046454 | Bacteria | 3961 |
| 322 | Ga0495592_0175335 | 3300046454 | Bacteria | 1465 |
| 323 | Ga0495591_001076 | 3300046458 | Bacteria | 18246 |
| 324 | Ga0495629_0016155 | 3300046459 | Bacteria | 5358 |
| 325 | Ga0495629_0162786 | 3300046459 | Bacteria | 1549 |
| 326 | Ga0495638_0000034 | 3300046460 | Bacteria | 282038 |
| 327 | Ga0495653_0005525 | 3300046463 | Bacteria | 10301 |
| 328 | Ga0495650_0000380 | 3300046471 | Bacteria | 76955 |
| 329 | Ga0495650_0005291 | 3300046471 | Bacteria | 8445 |
| 330 | Ga0495650_0020882 | 3300046471 | Bacteria | 3181 |
| 331 | Ga0495650_0053886 | 3300046471 | Bacteria | 1644 |
| 332 | Ga0495580_0056319 | 3300046472 | Bacteria | 2769 |
| 333 | Ga0495582_0026924 | 3300046473 | Bacteria | 3150 |
| 334 | Ga0495605_0006772 | 3300046474 | Bacteria | 6549 |
| 335 | Ga0495605_0033803 | 3300046474 | Bacteria | 2593 |
| 336 | Ga0495605_0071284 | 3300046474 | Bacteria | 1641 |
| 337 | Ga0495584_0002094 | 3300046491 | Bacteria | 11446 |
| 338 | Ga0495584_0006501 | 3300046491 | Bacteria | 6114 |
| 339 | Ga0495585_0000001 | 3300046492 | Bacteria | 609804 |
| 340 | Ga0495585_0005476 | 3300046492 | Bacteria | 7992 |
| 341 | Ga0495596_0016626 | 3300046500 | Bacteria | 3053 |
| 342 | Ga0495607_0000010 | 3300046501 | Bacteria | 206525 |
| 343 | Ga0495607_0000705 | 3300046501 | Bacteria | 32214 |
| 344 | Ga0495607_0016052 | 3300046501 | Plasmid | 4839 |
| 345 | Ga0495607_0155965 | 3300046501 | Bacteria | 1164 |
| 346 | Ga0495583_0009454 | 3300046506 | Bacteria | 5819 |
| 347 | Ga0495583_0018706 | 3300046506 | Bacteria | 3640 |
| 348 | Ga0495606_0000150 | 3300046507 | Bacteria | 119726 |
| 349 | Ga0495606_0000154 | 3300046507 | Bacteria | 119458 |
| 350 | Ga0495606_0000469 | 3300046507 | Bacteria | 66319 |
| 351 | Ga0495606_0002690 | 3300046507 | Bacteria | 20099 |
| 352 | Ga0495606_0002890 | 3300046507 | Bacteria | 18971 |
| 353 | Ga0495606_0008309 | 3300046507 | Bacteria | 9050 |
| 354 | Ga0495606_0015946 | 3300046507 | Bacteria | 5759 |
| 355 | Ga0495606_0015951 | 3300046507 | Bacteria | 5758 |
| 356 | Ga0495606_0021515 | 3300046507 | Bacteria | 4724 |
| 357 | Ga0495608_0032316 | 3300046511 | Bacteria | 3537 |
| 358 | Ga0495610_0000282 | 3300046512 | Bacteria | 53033 |
| 359 | Ga0495610_0002694 | 3300046512 | Bacteria | 14641 |
| 360 | Ga0495610_0005914 | 3300046512 | Bacteria | 8570 |
| 361 | Ga0495610_0010266 | 3300046512 | Bacteria | 5835 |
| 362 | Ga0495610_0013453 | 3300046512 | Bacteria | 4863 |
| 363 | Ga0495616_0000001 | 3300046513 | Bacteria | 780061 |
| 364 | Ga0495618_0011486 | 3300046514 | Bacteria | 5371 |
| 365 | Ga0495620_0000560 | 3300046515 | Bacteria | 23435 |
| 366 | Ga0495620_0000588 | 3300046515 | Bacteria | 22750 |
| 367 | Ga0495628_0011306 | 3300046516 | Bacteria | 7552 |
| 368 | Ga0495628_0355333 | 3300046516 | Bacteria | 1076 |
| 369 | Ga0495631_0000137 | 3300046518 | Bacteria | 49790 |
| 370 | Ga0495631_0000966 | 3300046518 | Bacteria | 17897 |
| 371 | Ga0495632_0004331 | 3300046519 | Bacteria | 9675 |
| 372 | Ga0495632_0015610 | 3300046519 | Bacteria | 4248 |
| 373 | Ga0495632_0130635 | 3300046519 | Bacteria | 1169 |
| 374 | Ga0495632_0259075 | 3300046519 | Bacteria | 778 |
| 375 | Ga0495637_0008462 | 3300046520 | Bacteria | 5051 |
| 376 | Ga0495643_0083449 | 3300046522 | Bacteria | 1659 |
| 377 | Ga0495643_0182955 | 3300046522 | Bacteria | 1017 |
| 378 | Ga0495644_0004261 | 3300046523 | Bacteria | 5616 |
| 379 | Ga0495648_0000559 | 3300046524 | Bacteria | 39811 |
| 380 | Ga0495648_0004596 | 3300046524 | Bacteria | 11758 |
| 381 | Ga0495648_0006600 | 3300046524 | Bacteria | 9426 |
| 382 | Ga0495648_0008950 | 3300046524 | Bacteria | 7824 |
| 383 | Ga0495648_0202975 | 3300046524 | Bacteria | 991 |
| 384 | Ga0495666_0009610 | 3300046526 | Bacteria | 4835 |
| 385 | Ga0495666_0009868 | 3300046526 | Bacteria | 4768 |
| 386 | Ga0495642_0007496 | 3300046528 | Bacteria | 4179 |
| 387 | Ga0495652_0127306 | 3300046529 | Bacteria | 2021 |
| 388 | Ga0495654_0000183 | 3300046530 | Bacteria | 61398 |
| 389 | Ga0495654_0173092 | 3300046530 | Bacteria | 940 |
| 390 | Ga0495665_0002980 | 3300046531 | Bacteria | 9154 |
| 391 | Ga0495640_0028066 | 3300046533 | Bacteria | 4054 |
| 392 | Ga0495586_0098338 | 3300046535 | Bacteria | 1622 |
| 393 | Ga0495586_0396980 | 3300046535 | Bacteria | 794 |
| 394 | Ga0495645_0004978 | 3300046543 | Bacteria | 9099 |
| 395 | Ga0495645_0202228 | 3300046543 | Bacteria | 1346 |
| 396 | Ga0495622_0001709 | 3300046557 | Bacteria | 10849 |
| 397 | Ga0495622_0038416 | 3300046557 | Bacteria | 2229 |
| 398 | Ga0495633_0086656 | 3300046558 | Bacteria | 1456 |
| 399 | Ga0495668_0000018 | 3300046616 | Bacteria | 417480 |
| 400 | Ga0495634_0073344 | 3300046642 | Bacteria | 2250 |
| 401 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 402 | Ga0495611_0000429 | 3300046648 | Bacteria | 26013 |
| 403 | Ga0495611_0048557 | 3300046648 | Bacteria | 1908 |
| 404 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 405 | Ga0495625_0003381 | 3300046660 | Bacteria | 15986 |
| 406 | Ga0495625_0003390 | 3300046660 | Bacteria | 15963 |
| 407 | Ga0495625_0052089 | 3300046660 | Bacteria | 2932 |
| 408 | Ga0495625_0102228 | 3300046660 | Bacteria | 1967 |
| 409 | Ga0495625_0117404 | 3300046660 | Bacteria | 1814 |
| 410 | Ga0495635_0080551 | 3300046663 | Bacteria | 2228 |
| 411 | Ga0495661_0001957 | 3300046665 | Bacteria | 16346 |
| 412 | Ga0495661_0034817 | 3300046665 | Bacteria | 3166 |
| 413 | Ga0495588_0000172 | 3300046674 | Bacteria | 81934 |
| 414 | Ga0495657_0082035 | 3300046675 | Bacteria | 2084 |
| 415 | Ga0495623_0012497 | 3300046679 | Bacteria | 5493 |
| 416 | Ga0495623_0095492 | 3300046679 | Bacteria | 1817 |
| 417 | Ga0495646_0040353 | 3300046680 | Bacteria | 2875 |
| 418 | Ga0495646_0146573 | 3300046680 | Bacteria | 1316 |
| 419 | Ga0495613_0215509 | 3300046689 | Bacteria | 1349 |
| 420 | Ga0495624_0000846 | 3300046690 | Bacteria | 24268 |
| 421 | Ga0495624_0055747 | 3300046690 | Bacteria | 2488 |
| 422 | Ga0495670_0005484 | 3300046691 | Bacteria | 6225 |
| 423 | Ga0495670_0010389 | 3300046691 | Bacteria | 4573 |
| 424 | Ga0495670_0053741 | 3300046691 | Bacteria | 2017 |
| 425 | Ga0495671_0000480 | 3300046692 | Bacteria | 31034 |
| 426 | Ga0495671_0023009 | 3300046692 | Bacteria | 3259 |
| 427 | Ga0495649_0007006 | 3300046694 | Bacteria | 6952 |
| 428 | Ga0495649_0177817 | 3300046694 | Bacteria | 1111 |
| 429 | Ga0495589_0000016 | 3300046794 | Bacteria | 209027 |
| 430 | Ga0495660_0000058 | 3300046810 | Bacteria | 133170 |
| 431 | Ga0495660_0000116 | 3300046810 | Bacteria | 85798 |
| 432 | Ga0495660_0003525 | 3300046810 | Bacteria | 9645 |
| 433 | Ga0495581_0014841 | 3300047315 | Bacteria | 4518 |
| 434 | Ga0495581_0038543 | 3300047315 | Bacteria | 2765 |
| 435 | Ga0495604_0000321 | 3300047317 | Bacteria | 43022 |
| 436 | Ga0495672_0000106 | 3300047320 | Bacteria | 132815 |
| 437 | Ga0495680_0034473 | 3300047322 | Bacteria | 4086 |
| 438 | Ga0495683_0001193 | 3300047323 | Bacteria | 17728 |
| 439 | Ga0495683_0006054 | 3300047323 | Bacteria | 6638 |
| 440 | Ga0495683_0036657 | 3300047323 | Bacteria | 2489 |
| 441 | Ga0495687_000634 | 3300047443 | Bacteria | 40217 |
| 442 | Ga0495687_006747 | 3300047443 | Bacteria | 6946 |
| 443 | Ga0495687_022771 | 3300047443 | Bacteria | 3003 |
| 444 | Ga0495675_0070437 | 3300047444 | Bacteria | 2207 |
| 445 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 446 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 447 | Ga0495673_0000229 | 3300047469 | Bacteria | 82319 |
| 448 | Ga0495673_0000371 | 3300047469 | Bacteria | 53983 |
| 449 | Ga0495681_0000118 | 3300047470 | Bacteria | 69538 |
| 450 | Ga0495686_0000085 | 3300047472 | Bacteria | 198128 |
| 451 | Ga0495686_0000115 | 3300047472 | Bacteria | 166876 |
| 452 | Ga0495686_0000407 | 3300047472 | Bacteria | 68110 |
| 453 | Ga0495686_0001689 | 3300047472 | Bacteria | 22933 |
| 454 | Ga0495686_0002146 | 3300047472 | Bacteria | 19287 |
| 455 | Ga0495686_0018004 | 3300047472 | Bacteria | 4750 |
| 456 | Ga0495686_0018598 | 3300047472 | Bacteria | 4658 |
| 457 | Ga0495686_0018953 | 3300047472 | Bacteria | 4605 |
| 458 | Ga0495686_0201372 | 3300047472 | Bacteria | 1142 |
| 459 | Ga0495602_0051575 | 3300048088 | Bacteria | 3662 |
| 460 | Ga0495614_0047059 | 3300048089 | Bacteria | 1849 |
| 461 | Ga0495626_0012426 | 3300048091 | Bacteria | 4464 |
| 462 | Ga0495626_0036578 | 3300048091 | Bacteria | 2338 |
| 463 | Ga0496106_0002982 | 3300048909 | Bacteria | 12606 |
| 464 | Ga0496110_0344718 | 3300048913 | Bacteria | 1357 |
| 465 | Ga0496111_0001880 | 3300048914 | Bacteria | 12413 |
| 466 | Ga0496111_0138037 | 3300048914 | Bacteria | 1807 |
| 467 | Ga0496112_0213875 | 3300048915 | Bacteria | 1885 |
| 468 | Ga0496114_0649648 | 3300048917 | Bacteria | 928 |
| 469 | Ga0496114_0744116 | 3300048917 | Bacteria | 857 |
| 470 | Ga0496116_0042860 | 3300048919 | Bacteria | 3088 |
| 471 | Ga0496116_0046319 | 3300048919 | Bacteria | 2935 |
| 472 | Ga0496117_0002017 | 3300048920 | Bacteria | 26920 |
| 473 | Ga0496117_0028424 | 3300048920 | Bacteria | 4330 |
| 474 | Ga0496117_0043057 | 3300048920 | Bacteria | 3288 |
| 475 | Ga0496117_0165213 | 3300048920 | Bacteria | 1291 |
| 476 | Ga0496118_0001001 | 3300048921 | Bacteria | 44080 |
| 477 | Ga0496118_0001737 | 3300048921 | Bacteria | 31652 |
| 478 | Ga0496118_0006503 | 3300048921 | Bacteria | 12808 |
| 479 | Ga0496118_0009257 | 3300048921 | Bacteria | 9992 |
| 480 | Ga0496118_0027108 | 3300048921 | Bacteria | 4858 |
| 481 | Ga0496118_0206475 | 3300048921 | Bacteria | 1157 |
| 482 | Ga0496119_0000023 | 3300048922 | Bacteria | 259882 |
| 483 | Ga0496119_0027600 | 3300048922 | Bacteria | 3897 |
| 484 | Ga0496119_0056569 | 3300048922 | Bacteria | 2376 |
| 485 | Ga0496120_0000578 | 3300048923 | Bacteria | 55746 |
| 486 | Ga0496120_0026578 | 3300048923 | Bacteria | 3571 |
| 487 | Ga0496121_0000129 | 3300048924 | Bacteria | 168148 |
| 488 | Ga0496121_0000308 | 3300048924 | Bacteria | 101811 |
| 489 | Ga0496121_0000905 | 3300048924 | Bacteria | 53422 |
| 490 | Ga0496121_0001400 | 3300048924 | Bacteria | 40824 |
| 491 | Ga0496121_0035264 | 3300048924 | Bacteria | 4487 |
| 492 | Ga0496121_0132938 | 3300048924 | Bacteria | 1858 |
| 493 | Ga0496121_0253953 | 3300048924 | Bacteria | 1217 |
| 494 | Ga0496122_0006856 | 3300048925 | Bacteria | 12908 |
| 495 | Ga0496122_0034164 | 3300048925 | Bacteria | 4167 |
| 496 | Ga0496122_0113820 | 3300048925 | Bacteria | 1766 |
| 497 | Ga0496122_0230818 | 3300048925 | Bacteria | 1052 |
| 498 | Ga0496123_0004244 | 3300048926 | Bacteria | 15263 |
| 499 | Ga0496123_0005671 | 3300048926 | Bacteria | 12463 |
| 500 | Ga0496123_0023530 | 3300048926 | Bacteria | 4712 |
| 501 | Ga0496123_0070752 | 3300048926 | Bacteria | 2181 |
| 502 | Ga0496124_0000109 | 3300048927 | Bacteria | 166429 |
| 503 | Ga0496124_0125030 | 3300048927 | Bacteria | 2050 |
| 504 | Ga0496125_0006086 | 3300048928 | Bacteria | 13167 |
| 505 | Ga0496125_0166138 | 3300048928 | Bacteria | 1491 |
| 506 | Ga0496126_0002238 | 3300048929 | Bacteria | 26740 |
| 507 | Ga0496126_0011136 | 3300048929 | Bacteria | 9338 |
| 508 | Ga0496126_0023806 | 3300048929 | Bacteria | 5928 |
| 509 | Ga0496126_0054809 | 3300048929 | Bacteria | 3609 |
| 510 | Ga0496126_0358547 | 3300048929 | Bacteria | 1191 |
| 511 | Ga0495678_000088 | 3300049459 | Bacteria | 115071 |
| 512 | Ga0495678_000475 | 3300049459 | Bacteria | 39998 |
| 513 | Ga0495682_0000033 | 3300049460 | Bacteria | 132733 |
| 514 | Ga0495682_0000576 | 3300049460 | Bacteria | 24893 |
| 515 | Ga0495682_0008745 | 3300049460 | Bacteria | 3982 |
| 516 | Ga0501033_0096266 | 3300049570 | Bacteria | 2163 |
| 517 | Ga0501037_0013831 | 3300049573 | Bacteria | 5947 |
| 518 | Ga0501038_0120442 | 3300049574 | Bacteria | 2165 |
| 519 | Ga0501039_0528511 | 3300049575 | Bacteria | 926 |
| 520 | Ga0501046_0041425 | 3300049580 | Bacteria | 3675 |
| 521 | Ga0501047_0134599 | 3300049581 | Bacteria | 2352 |
| 522 | Ga0501068_0173853 | 3300049584 | Bacteria | 1360 |
| 523 | Ga0501070_0090736 | 3300049586 | Bacteria | 2529 |
| 524 | Ga0501070_0396602 | 3300049586 | Bacteria | 1116 |
| 525 | Ga0501071_0022336 | 3300049587 | Bacteria | 4411 |
| 526 | Ga0501075_0477084 | 3300049591 | Bacteria | 951 |
| 527 | Ga0501080_0058675 | 3300049742 | Bacteria | 3582 |
| 528 | Ga0501035_0069317 | 3300049822 | Bacteria | 3126 |
| 529 | Ga0501044_0018799 | 3300049823 | Bacteria | 7403 |
| 530 | Ga0501044_0450365 | 3300049823 | Bacteria | 1194 |
| 531 | Ga0501045_0380560 | 3300049824 | Bacteria | 1051 |
| 532 | nmdc:mga05p37_57566_c1 | 3300050507 | Bacteria | 4788 |
| 533 | nmdc:mga09592_3952_c1 | 3300050508 | Bacteria | 11942 |
| 534 | nmdc:mga0qj67_905_c1 | 3300050509 | Bacteria | 10950 |
| 535 | nmdc:mga06r32_31454_c1 | 3300050510 | Bacteria | 4985 |
| 536 | nmdc:mga08y16_17267_c1 | 3300050511 | Bacteria | 7597 |
| 537 | nmdc:mga0n895_224768_c1 | 3300050512 | Bacteria | 1905 |
| 538 | Ga0500578_0000042 | 3300053086 | Bacteria | 129410 |
| 539 | Ga0500578_0048478 | 3300053086 | Bacteria | 2725 |
| 540 | Ga0500643_000002 | 3300053087 | Bacteria | 1277657 |
| 541 | Ga0500555_000288 | 3300053103 | Bacteria | 21733 |
| 542 | Ga0500618_000111 | 3300053125 | Bacteria | 65821 |
| 543 | Ga0500621_000013 | 3300053126 | Bacteria | 132878 |
| 544 | Ga0500603_003350 | 3300053150 | Bacteria | 3445 |
| 545 | Ga0500616_0011692 | 3300053153 | Bacteria | 5169 |
| 546 | Ga0500622_0000335 | 3300053156 | Bacteria | 46130 |
| 547 | Ga0500622_0045354 | 3300053156 | Bacteria | 2276 |
| 548 | Ga0500633_0090956 | 3300053160 | Bacteria | 1114 |
| 549 | Ga0500645_001386 | 3300053730 | Bacteria | 12362 |
| 550 | Ga0466962_0004762 | 3300061719 | Bacteria | 6523 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046453 | Ga0495627_001483 | Ga0495627_001483_10979_11803 | 230 |
| 2 | 3300046501 | Ga0495607_0155965 | Ga0495607_0155965_19_786 | 230 |
| 3 | 3300046512 | Ga0495610_0000282 | Ga0495610_0000282_36651_37475 | 230 |
| 4 | 3300046519 | Ga0495632_0130635 | Ga0495632_0130635_332_1156 | 230 |
| 5 | 3300046524 | Ga0495648_0004596 | Ga0495648_0004596_5817_6584 | 230 |
| 6 | 3300046558 | Ga0495633_0086656 | Ga0495633_0086656_63_887 | 230 |
| 7 | 3300046665 | Ga0495661_0034817 | Ga0495661_0034817_1927_2751 | 230 |
| 8 | 3300046679 | Ga0495623_0012497 | Ga0495623_0012497_4696_5475 | 230 |
| 9 | 3300047317 | Ga0495604_0000321 | Ga0495604_0000321_19281_20060 | 230 |
| 10 | 3300047322 | Ga0495680_0034473 | Ga0495680_0034473_290_1069 | 230 |
| 11 | 3300047470 | Ga0495681_0000118 | Ga0495681_0000118_12111_12935 | 230 |
| 12 | 3300047472 | Ga0495686_0001689 | Ga0495686_0001689_10068_10892 | 230 |
| 13 | 3300048088 | Ga0495602_0051575 | Ga0495602_0051575_2366_3145 | 230 |
| 14 | 3300009011 | Ga0105251_10133278 | Ga0105251_101332781 | 232 |
| 15 | 3300046454 | Ga0495592_0032166 | Ga0495592_0032166_1130_1909 | 232 |
| 16 | 3300046459 | Ga0495629_0162786 | Ga0495629_0162786_748_1527 | 232 |
| 17 | 3300046463 | Ga0495653_0005525 | Ga0495653_0005525_3802_4581 | 232 |
| 18 | 3300046471 | Ga0495650_0020882 | Ga0495650_0020882_1193_1972 | 232 |
| 19 | 3300046472 | Ga0495580_0056319 | Ga0495580_0056319_867_1646 | 232 |
| 20 | 3300046473 | Ga0495582_0026924 | Ga0495582_0026924_1248_2027 | 232 |
| 21 | 3300046511 | Ga0495608_0032316 | Ga0495608_0032316_818_1597 | 232 |
| 22 | 3300046514 | Ga0495618_0011486 | Ga0495618_0011486_3887_4666 | 232 |
| 23 | 3300046516 | Ga0495628_0355333 | Ga0495628_0355333_160_939 | 232 |
| 24 | 3300046526 | Ga0495666_0009610 | Ga0495666_0009610_1248_2027 | 232 |
| 25 | 3300046529 | Ga0495652_0127306 | Ga0495652_0127306_818_1597 | 232 |
| 26 | 3300046533 | Ga0495640_0028066 | Ga0495640_0028066_72_851 | 232 |
| 27 | 3300046535 | Ga0495586_0098338 | Ga0495586_0098338_52_831 | 232 |
| 28 | 3300046642 | Ga0495634_0073344 | Ga0495634_0073344_281_1060 | 232 |
| 29 | 3300046663 | Ga0495635_0080551 | Ga0495635_0080551_233_1012 | 232 |
| 30 | 3300046675 | Ga0495657_0082035 | Ga0495657_0082035_58_837 | 232 |
| 31 | 3300046679 | Ga0495623_0095492 | Ga0495623_0095492_370_1149 | 232 |
| 32 | 3300046680 | Ga0495646_0040353 | Ga0495646_0040353_1756_2535 | 232 |
| 33 | 3300046689 | Ga0495613_0215509 | Ga0495613_0215509_138_917 | 232 |
| 34 | 3300046690 | Ga0495624_0055747 | Ga0495624_0055747_1184_1963 | 232 |
| 35 | 3300047315 | Ga0495581_0038543 | Ga0495581_0038543_1969_2748 | 232 |
| 36 | 3300047323 | Ga0495683_0036657 | Ga0495683_0036657_406_1185 | 232 |
| 37 | 3300047444 | Ga0495675_0070437 | Ga0495675_0070437_564_1343 | 232 |
| 38 | 3300048089 | Ga0495614_0047059 | Ga0495614_0047059_233_1012 | 232 |
| 39 | 3300048922 | Ga0496119_0056569 | Ga0496119_0056569_769_1551 | 232 |
| 40 | 3300048923 | Ga0496120_0000578 | Ga0496120_0000578_30100_30882 | 232 |
| 41 | 3300045976 | Ga0466967_0034275 | Ga0466967_0034275_1148_1900 | 233 |
| 42 | 3300049591 | Ga0501075_0477084 | Ga0501075_0477084_231_935 | 233 |
| 43 | 3300003320 | rootH2_10038272 | rootH2_1003827222 | 234 |
| 44 | 3300026067 | Ga0207678_10003997 | Ga0207678_1000399710 | 234 |
| 45 | 3300048917 | Ga0496114_0649648 | Ga0496114_0649648_146_880 | 239 |
| 46 | 3300005616 | Ga0068852_100647654 | Ga0068852_1006476541 | 240 |
| 47 | 3300025302 | Ga0207426_1023152 | Ga0207426_10231522 | 241 |
| 48 | 3300005618 | Ga0068864_100937957 | Ga0068864_1009379571 | 242 |
| 49 | 3300009553 | Ga0105249_10607599 | Ga0105249_106075992 | 242 |
| 50 | 3300014326 | Ga0157380_10434523 | Ga0157380_104345232 | 242 |
| 51 | 3300005364 | Ga0070673_100645355 | Ga0070673_1006453551 | 244 |
| 52 | 3300006237 | Ga0097621_100343219 | Ga0097621_1003432192 | 244 |
| 53 | 3300025941 | Ga0207711_10496385 | Ga0207711_104963851 | 244 |
| 54 | 3300028800 | Ga0265338_10019103 | Ga0265338_100191032 | 244 |
| 55 | 3300031852 | Ga0307410_10084328 | Ga0307410_100843283 | 244 |
| 56 | 3300031852 | Ga0307410_10454322 | Ga0307410_104543222 | 244 |
| 57 | 3300032126 | Ga0307415_100014235 | Ga0307415_1000142353 | 244 |
| 58 | 3300025292 | Ga0209676_1000812 | Ga0209676_10008124 | 245 |
| 59 | 3300026095 | Ga0207676_10803637 | Ga0207676_108036371 | 246 |
| 60 | iso_pu_bacteria | 2818991440 | 2819563230 | 246 |
| 61 | iso_pu_bacteria | 2904463128 | 2904463850 | 246 |
| 62 | 3300037466 | Ga0395898_0495080 | Ga0395898_0495080_322_1083 | 247 |
| 63 | 3300038443 | Ga0395901_0120117 | Ga0395901_0120117_1168_1938 | 247 |
| 64 | iso_pu_bacteria | 2511231025 | 2511380850 | 247 |
| 65 | iso_pu_bacteria | 2511231035 | 2511434721 | 247 |
| 66 | iso_pu_bacteria | 2935625433 | 2935628497 | 247 |
| 67 | iso_pu_bacteria | 2939617950 | 2939620811 | 247 |
| 68 | iso_pu_bacteria | 2974435778 | 2974435996 | 247 |
| 69 | iso_pu_bacteria | 8019504834 | 8019507232 | 247 |
| 70 | 3300003323 | rootH1_10074328 | rootH1_100743283 | 248 |
| 71 | 3300003856 | Ga0058692_1004357 | Ga0058692_10043574 | 248 |
| 72 | 3300003856 | Ga0058692_1013222 | Ga0058692_10132222 | 248 |
| 73 | 3300005288 | Ga0065714_10134458 | Ga0065714_101344581 | 248 |
| 74 | 3300005445 | Ga0070708_100068795 | Ga0070708_1000687951 | 248 |
| 75 | 3300005458 | Ga0070681_10309551 | Ga0070681_103095512 | 248 |
| 76 | 3300005459 | Ga0068867_100329663 | Ga0068867_1003296631 | 248 |
| 77 | 3300005518 | Ga0070699_100343507 | Ga0070699_1003435072 | 248 |
| 78 | 3300006195 | Ga0075366_10054707 | Ga0075366_100547072 | 248 |
| 79 | 3300006946 | Ga0079104_1000036 | Ga0079104_100003631 | 248 |
| 80 | 3300009093 | Ga0105240_10320154 | Ga0105240_103201542 | 248 |
| 81 | 3300009093 | Ga0105240_10851404 | Ga0105240_108514042 | 248 |
| 82 | 3300009098 | Ga0105245_10001203 | Ga0105245_1000120310 | 248 |
| 83 | 3300009545 | Ga0105237_10067444 | Ga0105237_100674443 | 248 |
| 84 | 3300009551 | Ga0105238_10132092 | Ga0105238_101320923 | 248 |
| 85 | 3300009553 | Ga0105249_10343094 | Ga0105249_103430942 | 248 |
| 86 | 3300013102 | Ga0157371_10038484 | Ga0157371_100384841 | 248 |
| 87 | 3300013105 | Ga0157369_10004776 | Ga0157369_1000477611 | 248 |
| 88 | 3300013307 | Ga0157372_10000358 | Ga0157372_1000035819 | 248 |
| 89 | 3300014325 | Ga0163163_10230991 | Ga0163163_102309913 | 248 |
| 90 | 3300025914 | Ga0207671_10187050 | Ga0207671_101870502 | 248 |
| 91 | 3300026067 | Ga0207678_10436886 | Ga0207678_104368862 | 248 |
| 92 | 3300027111 | Ga0209281_1000080 | Ga0209281_1000080146 | 248 |
| 93 | 3300027312 | Ga0209371_1000029 | Ga0209371_1000029232 | 248 |
| 94 | 3300027312 | Ga0209371_1017347 | Ga0209371_10173472 | 248 |
| 95 | 3300028379 | Ga0268266_10007060 | Ga0268266_100070602 | 248 |
| 96 | 3300030500 | Ga0268256_1000032 | Ga0268256_1000032162 | 248 |
| 97 | 3300030500 | Ga0268256_1015296 | Ga0268256_10152962 | 248 |
| 98 | 3300030500 | Ga0268256_1035958 | Ga0268256_10359582 | 248 |
| 99 | 3300031911 | Ga0307412_10135257 | Ga0307412_101352572 | 248 |
| 100 | 3300037471 | Ga0395905_0015859 | Ga0395905_0015859_681_1445 | 248 |
| 101 | 3300042010 | Ga0439452_000012 | Ga0439452_000012_244039_244827 | 248 |
| 102 | 3300046458 | Ga0495591_001076 | Ga0495591_001076_7385_8143 | 248 |
| 103 | 3300046459 | Ga0495629_0016155 | Ga0495629_0016155_50_808 | 248 |
| 104 | 3300046471 | Ga0495650_0000380 | Ga0495650_0000380_50512_51270 | 248 |
| 105 | 3300046474 | Ga0495605_0033803 | Ga0495605_0033803_1413_2171 | 248 |
| 106 | 3300046474 | Ga0495605_0071284 | Ga0495605_0071284_800_1558 | 248 |
| 107 | 3300046491 | Ga0495584_0002094 | Ga0495584_0002094_1189_1947 | 248 |
| 108 | 3300046507 | Ga0495606_0002690 | Ga0495606_0002690_2994_3752 | 248 |
| 109 | 3300046507 | Ga0495606_0015951 | Ga0495606_0015951_2161_2931 | 248 |
| 110 | 3300046523 | Ga0495644_0004261 | Ga0495644_0004261_3233_3991 | 248 |
| 111 | 3300046524 | Ga0495648_0006600 | Ga0495648_0006600_2177_2935 | 248 |
| 112 | 3300046526 | Ga0495666_0009868 | Ga0495666_0009868_1023_1781 | 248 |
| 113 | 3300046530 | Ga0495654_0000183 | Ga0495654_0000183_11528_12286 | 248 |
| 114 | 3300046531 | Ga0495665_0002980 | Ga0495665_0002980_5416_6174 | 248 |
| 115 | 3300046557 | Ga0495622_0001709 | Ga0495622_0001709_2782_3540 | 248 |
| 116 | 3300046648 | Ga0495611_0048557 | Ga0495611_0048557_477_1235 | 248 |
| 117 | 3300046660 | Ga0495625_0003381 | Ga0495625_0003381_7814_8569 | 248 |
| 118 | 3300046660 | Ga0495625_0102228 | Ga0495625_0102228_773_1531 | 248 |
| 119 | 3300046690 | Ga0495624_0000846 | Ga0495624_0000846_19886_20644 | 248 |
| 120 | 3300046691 | Ga0495670_0053741 | Ga0495670_0053741_115_933 | 248 |
| 121 | 3300046692 | Ga0495671_0023009 | Ga0495671_0023009_2474_3232 | 248 |
| 122 | 3300046810 | Ga0495660_0000058 | Ga0495660_0000058_50508_51266 | 248 |
| 123 | 3300047315 | Ga0495581_0014841 | Ga0495581_0014841_995_1753 | 248 |
| 124 | 3300047320 | Ga0495672_0000106 | Ga0495672_0000106_81568_82326 | 248 |
| 125 | 3300047443 | Ga0495687_000634 | Ga0495687_000634_5921_6685 | 248 |
| 126 | 3300047469 | Ga0495673_0000371 | Ga0495673_0000371_31124_31882 | 248 |
| 127 | 3300048915 | Ga0496112_0213875 | Ga0496112_0213875_829_1689 | 248 |
| 128 | 3300048917 | Ga0496114_0744116 | Ga0496114_0744116_82_846 | 248 |
| 129 | 3300048919 | Ga0496116_0042860 | Ga0496116_0042860_2032_2790 | 248 |
| 130 | 3300048919 | Ga0496116_0046319 | Ga0496116_0046319_1209_1997 | 248 |
| 131 | 3300048920 | Ga0496117_0002017 | Ga0496117_0002017_12475_13263 | 248 |
| 132 | 3300048920 | Ga0496117_0165213 | Ga0496117_0165213_330_1118 | 248 |
| 133 | 3300048921 | Ga0496118_0006503 | Ga0496118_0006503_11691_12479 | 248 |
| 134 | 3300048921 | Ga0496118_0206475 | Ga0496118_0206475_222_1010 | 248 |
| 135 | 3300048922 | Ga0496119_0000023 | Ga0496119_0000023_166148_166906 | 248 |
| 136 | 3300048923 | Ga0496120_0026578 | Ga0496120_0026578_2663_3421 | 248 |
| 137 | 3300048924 | Ga0496121_0001400 | Ga0496121_0001400_30480_31253 | 248 |
| 138 | 3300048925 | Ga0496122_0230818 | Ga0496122_0230818_154_942 | 248 |
| 139 | 3300048926 | Ga0496123_0023530 | Ga0496123_0023530_3813_4601 | 248 |
| 140 | 3300048927 | Ga0496124_0000109 | Ga0496124_0000109_69390_70178 | 248 |
| 141 | 3300048928 | Ga0496125_0006086 | Ga0496125_0006086_1777_2565 | 248 |
| 142 | 3300048928 | Ga0496125_0166138 | Ga0496125_0166138_503_1285 | 248 |
| 143 | 3300048929 | Ga0496126_0023806 | Ga0496126_0023806_4321_5085 | 248 |
| 144 | 3300049459 | Ga0495678_000088 | Ga0495678_000088_81562_82320 | 248 |
| 145 | 3300049460 | Ga0495682_0000033 | Ga0495682_0000033_81467_82225 | 248 |
| 146 | 3300049575 | Ga0501039_0528511 | Ga0501039_0528511_27_791 | 248 |
| 147 | 3300049584 | Ga0501068_0173853 | Ga0501068_0173853_497_1267 | 248 |
| 148 | 3300049586 | Ga0501070_0396602 | Ga0501070_0396602_266_1024 | 248 |
| 149 | 3300049587 | Ga0501071_0022336 | Ga0501071_0022336_1081_1851 | 248 |
| 150 | 3300049742 | Ga0501080_0058675 | Ga0501080_0058675_1176_1946 | 248 |
| 151 | 3300049823 | Ga0501044_0450365 | Ga0501044_0450365_210_968 | 248 |
| 152 | 3300049824 | Ga0501045_0380560 | Ga0501045_0380560_80_847 | 248 |
| 153 | 3300053126 | Ga0500621_000013 | Ga0500621_000013_81568_82326 | 248 |
| 154 | iso_pu_bacteria | 2675903059 | 2676481017 | 248 |
| 155 | iso_pu_bacteria | 2721755763 | 2723877233 | 248 |
| 156 | iso_pu_bacteria | 2738541296 | 2738823320 | 248 |
| 157 | iso_pu_bacteria | 2738541298 | 2738835578 | 248 |
| 158 | iso_pu_bacteria | 2738541306 | 2738877241 | 248 |
| 159 | iso_pu_bacteria | 2738543002 | 2739188947 | 248 |
| 160 | iso_pu_bacteria | 2738543008 | 2739223834 | 248 |
| 161 | iso_pu_bacteria | 2842918807 | 2842919347 | 248 |
| 162 | iso_pu_bacteria | 2855730933 | 2855732325 | 248 |
| 163 | iso_pu_bacteria | 2855767633 | 2855769033 | 248 |
| 164 | iso_pu_bacteria | 2945934425 | 2945936076 | 248 |
| 165 | iso_pu_bacteria | 2953994433 | 2953998195 | 248 |
| 166 | iso_pu_bacteria | 2990703756 | 2990710020 | 248 |
| 167 | 3300003771 | Ga0055526_1001233 | Ga0055526_10012333 | 249 |
| 168 | 3300003773 | Ga0055537_1000027 | Ga0055537_100002793 | 249 |
| 169 | 3300003773 | Ga0055537_1000451 | Ga0055537_10004516 | 249 |
| 170 | 3300003775 | Ga0055524_1002341 | Ga0055524_10023413 | 249 |
| 171 | 3300003784 | Ga0055534_1000019 | Ga0055534_100001937 | 249 |
| 172 | 3300003790 | Ga0055528_1000048 | Ga0055528_10000482 | 249 |
| 173 | 3300005290 | Ga0065712_10074544 | Ga0065712_100745444 | 249 |
| 174 | 3300005293 | Ga0065715_10097412 | Ga0065715_100974122 | 249 |
| 175 | 3300005328 | Ga0070676_10094966 | Ga0070676_100949662 | 249 |
| 176 | 3300005328 | Ga0070676_10188620 | Ga0070676_101886202 | 249 |
| 177 | 3300005330 | Ga0070690_100001305 | Ga0070690_1000013054 | 249 |
| 178 | 3300005331 | Ga0070670_100021796 | Ga0070670_1000217965 | 249 |
| 179 | 3300005334 | Ga0068869_100005387 | Ga0068869_1000053875 | 249 |
| 180 | 3300005335 | Ga0070666_10131368 | Ga0070666_101313681 | 249 |
| 181 | 3300005338 | Ga0068868_100126369 | Ga0068868_1001263693 | 249 |
| 182 | 3300005340 | Ga0070689_100003506 | Ga0070689_1000035068 | 249 |
| 183 | 3300005341 | Ga0070691_10040529 | Ga0070691_100405291 | 249 |
| 184 | 3300005343 | Ga0070687_100002238 | Ga0070687_1000022387 | 249 |
| 185 | 3300005344 | Ga0070661_100125675 | Ga0070661_1001256752 | 249 |
| 186 | 3300005344 | Ga0070661_100425268 | Ga0070661_1004252682 | 249 |
| 187 | 3300005347 | Ga0070668_100023659 | Ga0070668_1000236593 | 249 |
| 188 | 3300005353 | Ga0070669_100008171 | Ga0070669_1000081712 | 249 |
| 189 | 3300005354 | Ga0070675_100000236 | Ga0070675_1000002367 | 249 |
| 190 | 3300005355 | Ga0070671_100029861 | Ga0070671_1000298614 | 249 |
| 191 | 3300005364 | Ga0070673_100018756 | Ga0070673_1000187563 | 249 |
| 192 | 3300005367 | Ga0070667_100217479 | Ga0070667_1002174791 | 249 |
| 193 | 3300005440 | Ga0070705_100014853 | Ga0070705_1000148533 | 249 |
| 194 | 3300005444 | Ga0070694_100041879 | Ga0070694_1000418792 | 249 |
| 195 | 3300005457 | Ga0070662_100000839 | Ga0070662_1000008394 | 249 |
| 196 | 3300005459 | Ga0068867_100003350 | Ga0068867_1000033508 | 249 |
| 197 | 3300005535 | Ga0070684_100036141 | Ga0070684_1000361413 | 249 |
| 198 | 3300005543 | Ga0070672_100068583 | Ga0070672_1000685833 | 249 |
| 199 | 3300005544 | Ga0070686_100002094 | Ga0070686_1000020946 | 249 |
| 200 | 3300005549 | Ga0070704_100068113 | Ga0070704_1000681134 | 249 |
| 201 | 3300005564 | Ga0070664_100003665 | Ga0070664_1000036657 | 249 |
| 202 | 3300005577 | Ga0068857_100114768 | Ga0068857_1001147682 | 249 |
| 203 | 3300005615 | Ga0070702_100017244 | Ga0070702_1000172443 | 249 |
| 204 | 3300005617 | Ga0068859_100003877 | Ga0068859_10000387714 | 249 |
| 205 | 3300005618 | Ga0068864_100009414 | Ga0068864_1000094145 | 249 |
| 206 | 3300005618 | Ga0068864_100354347 | Ga0068864_1003543471 | 249 |
| 207 | 3300005719 | Ga0068861_100010322 | Ga0068861_1000103223 | 249 |
| 208 | 3300005840 | Ga0068870_10017259 | Ga0068870_100172594 | 249 |
| 209 | 3300005841 | Ga0068863_100013640 | Ga0068863_1000136408 | 249 |
| 210 | 3300005842 | Ga0068858_100043347 | Ga0068858_1000433475 | 249 |
| 211 | 3300005843 | Ga0068860_100102174 | Ga0068860_1001021741 | 249 |
| 212 | 3300005844 | Ga0068862_100000384 | Ga0068862_10000038426 | 249 |
| 213 | 3300005844 | Ga0068862_100000566 | Ga0068862_10000056625 | 249 |
| 214 | 3300006028 | Ga0070717_10330736 | Ga0070717_103307361 | 249 |
| 215 | 3300006237 | Ga0097621_100071486 | Ga0097621_1000714861 | 249 |
| 216 | 3300006358 | Ga0068871_100155150 | Ga0068871_1001551502 | 249 |
| 217 | 3300006846 | Ga0075430_100054834 | Ga0075430_1000548344 | 249 |
| 218 | 3300006847 | Ga0075431_100138666 | Ga0075431_1001386664 | 249 |
| 219 | 3300006847 | Ga0075431_100517429 | Ga0075431_1005174292 | 249 |
| 220 | 3300006880 | Ga0075429_100014751 | Ga0075429_1000147515 | 249 |
| 221 | 3300006881 | Ga0068865_100331420 | Ga0068865_1003314202 | 249 |
| 222 | 3300006881 | Ga0068865_100567742 | Ga0068865_1005677421 | 249 |
| 223 | 3300006931 | Ga0097620_100003879 | Ga0097620_10000387914 | 249 |
| 224 | 3300009098 | Ga0105245_10181788 | Ga0105245_101817883 | 249 |
| 225 | 3300009147 | Ga0114129_10177291 | Ga0114129_101772912 | 249 |
| 226 | 3300009177 | Ga0105248_10006352 | Ga0105248_100063527 | 249 |
| 227 | 3300009553 | Ga0105249_10005262 | Ga0105249_100052624 | 249 |
| 228 | 3300011119 | Ga0105246_10094436 | Ga0105246_100944362 | 249 |
| 229 | 3300014745 | Ga0157377_10022903 | Ga0157377_100229032 | 249 |
| 230 | 3300017792 | Ga0163161_10532936 | Ga0163161_105329361 | 249 |
| 231 | 3300021361 | Ga0213872_10000282 | Ga0213872_1000028214 | 249 |
| 232 | 3300025263 | Ga0209565_1000017 | Ga0209565_1000017314 | 249 |
| 233 | 3300025273 | Ga0209673_1000007 | Ga0209673_1000007115 | 249 |
| 234 | 3300025291 | Ga0209675_1000009 | Ga0209675_1000009403 | 249 |
| 235 | 3300025295 | Ga0209564_1000036 | Ga0209564_1000036115 | 249 |
| 236 | 3300025297 | Ga0209758_1062474 | Ga0209758_10624741 | 249 |
| 237 | 3300025299 | Ga0209256_1000091 | Ga0209256_1000091115 | 249 |
| 238 | 3300025903 | Ga0207680_10093320 | Ga0207680_100933203 | 249 |
| 239 | 3300025907 | Ga0207645_10266012 | Ga0207645_102660121 | 249 |
| 240 | 3300025908 | Ga0207643_10019027 | Ga0207643_100190275 | 249 |
| 241 | 3300025917 | Ga0207660_10434875 | Ga0207660_104348751 | 249 |
| 242 | 3300025918 | Ga0207662_10003084 | Ga0207662_100030843 | 249 |
| 243 | 3300025920 | Ga0207649_10153606 | Ga0207649_101536062 | 249 |
| 244 | 3300025920 | Ga0207649_10202374 | Ga0207649_102023742 | 249 |
| 245 | 3300025921 | Ga0207652_10372521 | Ga0207652_103725212 | 249 |
| 246 | 3300025923 | Ga0207681_10004231 | Ga0207681_100042312 | 249 |
| 247 | 3300025925 | Ga0207650_10064715 | Ga0207650_100647152 | 249 |
| 248 | 3300025931 | Ga0207644_10030880 | Ga0207644_100308804 | 249 |
| 249 | 3300025933 | Ga0207706_10004708 | Ga0207706_100047081 | 249 |
| 250 | 3300025936 | Ga0207670_10044829 | Ga0207670_100448292 | 249 |
| 251 | 3300025938 | Ga0207704_10195441 | Ga0207704_101954412 | 249 |
| 252 | 3300025940 | Ga0207691_10015438 | Ga0207691_100154383 | 249 |
| 253 | 3300025941 | Ga0207711_10008386 | Ga0207711_100083864 | 249 |
| 254 | 3300025945 | Ga0207679_10006942 | Ga0207679_100069427 | 249 |
| 255 | 3300025960 | Ga0207651_10034680 | Ga0207651_100346804 | 249 |
| 256 | 3300025961 | Ga0207712_10004437 | Ga0207712_100044373 | 249 |
| 257 | 3300025972 | Ga0207668_10179971 | Ga0207668_101799712 | 249 |
| 258 | 3300025986 | Ga0207658_10639071 | Ga0207658_106390711 | 249 |
| 259 | 3300026023 | Ga0207677_10033090 | Ga0207677_100330901 | 249 |
| 260 | 3300026023 | Ga0207677_10330704 | Ga0207677_103307041 | 249 |
| 261 | 3300026035 | Ga0207703_10137477 | Ga0207703_101374772 | 249 |
| 262 | 3300026075 | Ga0207708_10028275 | Ga0207708_100282753 | 249 |
| 263 | 3300026088 | Ga0207641_10133031 | Ga0207641_101330313 | 249 |
| 264 | 3300026089 | Ga0207648_10009062 | Ga0207648_100090623 | 249 |
| 265 | 3300026095 | Ga0207676_10007647 | Ga0207676_100076471 | 249 |
| 266 | 3300026116 | Ga0207674_10382625 | Ga0207674_103826251 | 249 |
| 267 | 3300026118 | Ga0207675_100007722 | Ga0207675_1000077226 | 249 |
| 268 | 3300026118 | Ga0207675_100084526 | Ga0207675_1000845263 | 249 |
| 269 | 3300028379 | Ga0268266_10050832 | Ga0268266_100508325 | 249 |
| 270 | 3300028380 | Ga0268265_10001478 | Ga0268265_1000147815 | 249 |
| 271 | 3300028380 | Ga0268265_10001770 | Ga0268265_100017703 | 249 |
| 272 | 3300028380 | Ga0268265_10553976 | Ga0268265_105539761 | 249 |
| 273 | 3300028381 | Ga0268264_10026436 | Ga0268264_100264365 | 249 |
| 274 | 3300039437 | Ga0436365_0423225 | Ga0436365_0423225_543_1301 | 249 |
| 275 | 3300039447 | Ga0436361_0743645 | Ga0436361_0743645_15487_16248 | 249 |
| 276 | 3300046501 | Ga0495607_0000010 | Ga0495607_0000010_45185_45934 | 249 |
| 277 | 3300046616 | Ga0495668_0000018 | Ga0495668_0000018_119184_119933 | 249 |
| 278 | 3300047472 | Ga0495686_0000407 | Ga0495686_0000407_13578_14327 | 249 |
| 279 | 3300048929 | Ga0496126_0002238 | Ga0496126_0002238_24997_25767 | 249 |
| 280 | 3300049573 | Ga0501037_0013831 | Ga0501037_0013831_4083_4991 | 249 |
| 281 | 3300050507 | nmdc:mga05p37_57566_c1 | nmdc:mga05p37_57566_c1_2065_2826 | 249 |
| 282 | 3300050508 | nmdc:mga09592_3952_c1 | nmdc:mga09592_3952_c1_7812_8573 | 249 |
| 283 | 3300050509 | nmdc:mga0qj67_905_c1 | nmdc:mga0qj67_905_c1_446_1207 | 249 |
| 284 | 3300050510 | nmdc:mga06r32_31454_c1 | nmdc:mga06r32_31454_c1_3306_4067 | 249 |
| 285 | 3300050511 | nmdc:mga08y16_17267_c1 | nmdc:mga08y16_17267_c1_461_1222 | 249 |
| 286 | iso_pu_bacteria | 2599185236 | 2599722802 | 249 |
| 287 | iso_pu_bacteria | 2599185354 | 2600203605 | 249 |
| 288 | 3300003320 | rootH2_10169690 | rootH2_101696901 | 250 |
| 289 | 3300013306 | Ga0163162_10636805 | Ga0163162_106368052 | 250 |
| 290 | 3300021361 | Ga0213872_10000013 | Ga0213872_10000013138 | 250 |
| 291 | 3300025246 | Ga0209646_1003510 | Ga0209646_10035103 | 250 |
| 292 | 3300031730 | Ga0307516_10096376 | Ga0307516_100963763 | 250 |
| 293 | 3300031731 | Ga0307405_10253241 | Ga0307405_102532411 | 250 |
| 294 | 3300031901 | Ga0307406_10258351 | Ga0307406_102583511 | 250 |
| 295 | 3300032002 | Ga0307416_100057652 | Ga0307416_1000576526 | 250 |
| 296 | 3300032002 | Ga0307416_100471428 | Ga0307416_1004714282 | 250 |
| 297 | 3300032004 | Ga0307414_10060547 | Ga0307414_100605473 | 250 |
| 298 | 3300039447 | Ga0436361_0027396 | Ga0436361_0027396_642_1406 | 250 |
| 299 | 3300044658 | Ga0466972_0000464 | Ga0466972_0000464_3837_4598 | 250 |
| 300 | 3300046452 | Ga0495617_000639 | Ga0495617_000639_13117_13884 | 250 |
| 301 | 3300046501 | Ga0495607_0000705 | Ga0495607_0000705_13281_14057 | 250 |
| 302 | 3300046507 | Ga0495606_0000469 | Ga0495606_0000469_58064_58831 | 250 |
| 303 | 3300046515 | Ga0495620_0000560 | Ga0495620_0000560_3698_4465 | 250 |
| 304 | 3300046516 | Ga0495628_0011306 | Ga0495628_0011306_5115_5882 | 250 |
| 305 | 3300046660 | Ga0495625_0003390 | Ga0495625_0003390_2038_2805 | 250 |
| 306 | 3300047472 | Ga0495686_0000115 | Ga0495686_0000115_49995_50747 | 250 |
| 307 | 3300047472 | Ga0495686_0018598 | Ga0495686_0018598_288_1055 | 250 |
| 308 | 3300048924 | Ga0496121_0132938 | Ga0496121_0132938_425_1192 | 250 |
| 309 | 3300049581 | Ga0501047_0134599 | Ga0501047_0134599_1511_2281 | 250 |
| 310 | 3300050512 | nmdc:mga0n895_224768_c1 | nmdc:mga0n895_224768_c1_1094_1861 | 250 |
| 311 | 3300053086 | Ga0500578_0000042 | Ga0500578_0000042_116830_117594 | 250 |
| 312 | 3300053086 | Ga0500578_0048478 | Ga0500578_0048478_1227_1988 | 250 |
| 313 | iso_pu_bacteria | 2600255067 | 2600811525 | 250 |
| 314 | iso_pu_bacteria | 2718218334 | 2721027315 | 250 |
| 315 | iso_pu_bacteria | 2842454564 | 2842455101 | 250 |
| 316 | 3300003316 | rootH1_10035169 | rootH1_1003516927 | 251 |
| 317 | 3300003322 | rootL2_10009353 | rootL2_100093532 | 251 |
| 318 | 3300003322 | rootL2_10046952 | rootL2_100469524 | 251 |
| 319 | 3300003323 | rootH1_10012599 | rootH1_1001259914 | 251 |
| 320 | 3300005335 | Ga0070666_10007647 | Ga0070666_100076476 | 251 |
| 321 | 3300005539 | Ga0068853_100064952 | Ga0068853_1000649523 | 251 |
| 322 | 3300005539 | Ga0068853_100260813 | Ga0068853_1002608132 | 251 |
| 323 | 3300005577 | Ga0068857_100137039 | Ga0068857_1001370392 | 251 |
| 324 | 3300005614 | Ga0068856_100005379 | Ga0068856_10000537912 | 251 |
| 325 | 3300005614 | Ga0068856_100260019 | Ga0068856_1002600192 | 251 |
| 326 | 3300005616 | Ga0068852_100018063 | Ga0068852_1000180636 | 251 |
| 327 | 3300005616 | Ga0068852_100571719 | Ga0068852_1005717192 | 251 |
| 328 | 3300009093 | Ga0105240_10000723 | Ga0105240_1000072322 | 251 |
| 329 | 3300009174 | Ga0105241_10000516 | Ga0105241_1000051628 | 251 |
| 330 | 3300009545 | Ga0105237_10004109 | Ga0105237_100041095 | 251 |
| 331 | 3300009551 | Ga0105238_10000678 | Ga0105238_1000067814 | 251 |
| 332 | 3300010375 | Ga0105239_10405333 | Ga0105239_104053332 | 251 |
| 333 | 3300013306 | Ga0163162_10165638 | Ga0163162_101656382 | 251 |
| 334 | 3300013307 | Ga0157372_10007957 | Ga0157372_1000795712 | 251 |
| 335 | 3300025903 | Ga0207680_10123434 | Ga0207680_101234342 | 251 |
| 336 | 3300025911 | Ga0207654_10003830 | Ga0207654_100038308 | 251 |
| 337 | 3300025913 | Ga0207695_10000648 | Ga0207695_1000064830 | 251 |
| 338 | 3300025924 | Ga0207694_10011304 | Ga0207694_100113043 | 251 |
| 339 | 3300025981 | Ga0207640_10038382 | Ga0207640_100383822 | 251 |
| 340 | 3300026041 | Ga0207639_10046499 | Ga0207639_100464992 | 251 |
| 341 | 3300026041 | Ga0207639_10248750 | Ga0207639_102487502 | 251 |
| 342 | 3300026078 | Ga0207702_10028255 | Ga0207702_100282552 | 251 |
| 343 | 3300026078 | Ga0207702_10219077 | Ga0207702_102190771 | 251 |
| 344 | 3300026142 | Ga0207698_10257126 | Ga0207698_102571262 | 251 |
| 345 | 3300044656 | Ga0466969_0073818 | Ga0466969_0073818_625_1395 | 251 |
| 346 | 3300044658 | Ga0466972_0004636 | Ga0466972_0004636_1962_2729 | 251 |
| 347 | 3300044658 | Ga0466972_0029329 | Ga0466972_0029329_438_1208 | 251 |
| 348 | 3300044658 | Ga0466972_0099209 | Ga0466972_0099209_206_997 | 251 |
| 349 | 3300044672 | Ga0466982_0000002 | Ga0466982_0000002_121893_122663 | 251 |
| 350 | 3300044683 | Ga0466965_0028276 | Ga0466965_0028276_1545_2315 | 251 |
| 351 | 3300044684 | Ga0466966_0001538 | Ga0466966_0001538_13459_14229 | 251 |
| 352 | 3300044706 | Ga0466964_0012746 | Ga0466964_0012746_1939_2709 | 251 |
| 353 | 3300044719 | Ga0466971_0016238 | Ga0466971_0016238_2404_3174 | 251 |
| 354 | 3300044765 | Ga0466970_0019714 | Ga0466970_0019714_487_1257 | 251 |
| 355 | 3300044842 | Ga0466957_0522992 | Ga0466957_0522992_42_812 | 251 |
| 356 | 3300045049 | Ga0466959_0145316 | Ga0466959_0145316_13_783 | 251 |
| 357 | 3300046519 | Ga0495632_0259075 | Ga0495632_0259075_10_765 | 251 |
| 358 | 3300046674 | Ga0495588_0000172 | Ga0495588_0000172_66916_67671 | 251 |
| 359 | 3300048091 | Ga0495626_0036578 | Ga0495626_0036578_870_1634 | 251 |
| 360 | 3300061719 | Ga0466962_0004762 | Ga0466962_0004762_1225_1995 | 251 |
| 361 | iso_pu_bacteria | 2818991461 | 2819685230 | 251 |
| 362 | 3300001979 | JGI24740J21852_10000693 | JGI24740J21852_1000069313 | 252 |
| 363 | 3300001989 | JGI24739J22299_10001046 | JGI24739J22299_100010469 | 252 |
| 364 | 3300002075 | JGI24738J21930_10000691 | JGI24738J21930_100006917 | 252 |
| 365 | 3300002773 | JGI25152J39213_1003013 | JGI25152J39213_10030137 | 252 |
| 366 | 3300002773 | JGI25152J39213_1004554 | JGI25152J39213_10045544 | 252 |
| 367 | 3300002987 | JGI25159J45721_1003111 | JGI25159J45721_10031112 | 252 |
| 368 | 3300003187 | JGI25151J46595_10033277 | JGI25151J46595_100332771 | 252 |
| 369 | 3300003215 | JGI25153J46596_10003507 | JGI25153J46596_100035077 | 252 |
| 370 | 3300003215 | JGI25153J46596_10010019 | JGI25153J46596_100100194 | 252 |
| 371 | 3300003354 | JGI25160J50197_1026237 | JGI25160J50197_10262372 | 252 |
| 372 | 3300003374 | JGI25161J50226_1000121 | JGI25161J50226_100012148 | 252 |
| 373 | 3300003752 | Ga0055539_1005125 | Ga0055539_10051251 | 252 |
| 374 | 3300003771 | Ga0055526_1001525 | Ga0055526_100152511 | 252 |
| 375 | 3300003775 | Ga0055524_1007749 | Ga0055524_10077492 | 252 |
| 376 | 3300003790 | Ga0055528_1006534 | Ga0055528_10065348 | 252 |
| 377 | 3300004625 | Ga0055543_1000176 | Ga0055543_100017643 | 252 |
| 378 | 3300005262 | Ga0065165_1005757 | Ga0065165_10057578 | 252 |
| 379 | 3300005331 | Ga0070670_100000133 | Ga0070670_10000013348 | 252 |
| 380 | 3300005335 | Ga0070666_10001004 | Ga0070666_1000100411 | 252 |
| 381 | 3300005367 | Ga0070667_100052891 | Ga0070667_1000528914 | 252 |
| 382 | 3300005445 | Ga0070708_100051939 | Ga0070708_1000519396 | 252 |
| 383 | 3300005445 | Ga0070708_100504256 | Ga0070708_1005042561 | 252 |
| 384 | 3300005458 | Ga0070681_10060774 | Ga0070681_100607743 | 252 |
| 385 | 3300005467 | Ga0070706_100155852 | Ga0070706_1001558522 | 252 |
| 386 | 3300005539 | Ga0068853_100122745 | Ga0068853_1001227452 | 252 |
| 387 | 3300005548 | Ga0070665_100073478 | Ga0070665_1000734784 | 252 |
| 388 | 3300005548 | Ga0070665_100116078 | Ga0070665_1001160782 | 252 |
| 389 | 3300005548 | Ga0070665_100382258 | Ga0070665_1003822582 | 252 |
| 390 | 3300005563 | Ga0068855_100289722 | Ga0068855_1002897222 | 252 |
| 391 | 3300005563 | Ga0068855_100424344 | Ga0068855_1004243443 | 252 |
| 392 | 3300005577 | Ga0068857_100617898 | Ga0068857_1006178981 | 252 |
| 393 | 3300009098 | Ga0105245_10384965 | Ga0105245_103849652 | 252 |
| 394 | 3300009177 | Ga0105248_10076098 | Ga0105248_100760983 | 252 |
| 395 | 3300009545 | Ga0105237_10001366 | Ga0105237_1000136627 | 252 |
| 396 | 3300009545 | Ga0105237_10330439 | Ga0105237_103304391 | 252 |
| 397 | 3300009551 | Ga0105238_10031362 | Ga0105238_100313625 | 252 |
| 398 | 3300010375 | Ga0105239_10050687 | Ga0105239_100506874 | 252 |
| 399 | 3300013105 | Ga0157369_10001160 | Ga0157369_1000116027 | 252 |
| 400 | 3300014497 | Ga0182008_10009391 | Ga0182008_100093913 | 252 |
| 401 | 3300014497 | Ga0182008_10012070 | Ga0182008_100120703 | 252 |
| 402 | 3300014969 | Ga0157376_10003459 | Ga0157376_100034593 | 252 |
| 403 | 3300015261 | Ga0182006_1000005 | Ga0182006_1000005186 | 252 |
| 404 | 3300015261 | Ga0182006_1000355 | Ga0182006_100035521 | 252 |
| 405 | 3300015262 | Ga0182007_10059316 | Ga0182007_100593162 | 252 |
| 406 | 3300016635 | Ga0183361_10007 | Ga0183361_10007251 | 252 |
| 407 | 3300021361 | Ga0213872_10135481 | Ga0213872_101354811 | 252 |
| 408 | 3300021384 | Ga0213876_10008842 | Ga0213876_100088422 | 252 |
| 409 | 3300025208 | Ga0209436_100002 | Ga0209436_100002204 | 252 |
| 410 | 3300025228 | Ga0209672_100695 | Ga0209672_10069510 | 252 |
| 411 | 3300025231 | Ga0207427_104033 | Ga0207427_1040333 | 252 |
| 412 | 3300025253 | Ga0209677_104977 | Ga0209677_1049772 | 252 |
| 413 | 3300025258 | Ga0209129_1000019 | Ga0209129_100001912 | 252 |
| 414 | 3300025258 | Ga0209129_1001405 | Ga0209129_10014056 | 252 |
| 415 | 3300025258 | Ga0209129_1001452 | Ga0209129_10014524 | 252 |
| 416 | 3300025258 | Ga0209129_1003522 | Ga0209129_10035227 | 252 |
| 417 | 3300025261 | Ga0209233_1000437 | Ga0209233_100043728 | 252 |
| 418 | 3300025272 | Ga0209455_1003981 | Ga0209455_10039812 | 252 |
| 419 | 3300025273 | Ga0209673_1004206 | Ga0209673_10042065 | 252 |
| 420 | 3300025284 | Ga0209130_1000015 | Ga0209130_1000015123 | 252 |
| 421 | 3300025294 | Ga0209025_1000648 | Ga0209025_100064856 | 252 |
| 422 | 3300025294 | Ga0209025_1013340 | Ga0209025_10133404 | 252 |
| 423 | 3300025295 | Ga0209564_1000021 | Ga0209564_1000021353 | 252 |
| 424 | 3300025295 | Ga0209564_1001407 | Ga0209564_100140714 | 252 |
| 425 | 3300025295 | Ga0209564_1001647 | Ga0209564_100164719 | 252 |
| 426 | 3300025297 | Ga0209758_1000148 | Ga0209758_100014890 | 252 |
| 427 | 3300025297 | Ga0209758_1000467 | Ga0209758_10004675 | 252 |
| 428 | 3300025297 | Ga0209758_1006875 | Ga0209758_10068753 | 252 |
| 429 | 3300025297 | Ga0209758_1048283 | Ga0209758_10482832 | 252 |
| 430 | 3300025299 | Ga0209256_1003221 | Ga0209256_10032219 | 252 |
| 431 | 3300025302 | Ga0207426_1000122 | Ga0207426_1000122109 | 252 |
| 432 | 3300025303 | Ga0209051_1012790 | Ga0209051_10127903 | 252 |
| 433 | 3300025904 | Ga0207647_10000006 | Ga0207647_10000006203 | 252 |
| 434 | 3300025904 | Ga0207647_10011418 | Ga0207647_100114185 | 252 |
| 435 | 3300025910 | Ga0207684_10501209 | Ga0207684_105012091 | 252 |
| 436 | 3300025914 | Ga0207671_10000215 | Ga0207671_100002152 | 252 |
| 437 | 3300025919 | Ga0207657_10056538 | Ga0207657_100565383 | 252 |
| 438 | 3300025921 | Ga0207652_10188736 | Ga0207652_101887362 | 252 |
| 439 | 3300025923 | Ga0207681_10179044 | Ga0207681_101790442 | 252 |
| 440 | 3300025924 | Ga0207694_10036791 | Ga0207694_100367913 | 252 |
| 441 | 3300025925 | Ga0207650_10000532 | Ga0207650_1000053236 | 252 |
| 442 | 3300025936 | Ga0207670_10008905 | Ga0207670_100089055 | 252 |
| 443 | 3300025941 | Ga0207711_10051695 | Ga0207711_100516953 | 252 |
| 444 | 3300025949 | Ga0207667_10075582 | Ga0207667_100755823 | 252 |
| 445 | 3300026041 | Ga0207639_10050824 | Ga0207639_100508241 | 252 |
| 446 | 3300026067 | Ga0207678_10000697 | Ga0207678_1000069725 | 252 |
| 447 | 3300026067 | Ga0207678_10090668 | Ga0207678_100906682 | 252 |
| 448 | 3300026067 | Ga0207678_10191745 | Ga0207678_101917452 | 252 |
| 449 | 3300026067 | Ga0207678_10446561 | Ga0207678_104465611 | 252 |
| 450 | 3300028379 | Ga0268266_10000255 | Ga0268266_1000025538 | 252 |
| 451 | 3300028379 | Ga0268266_10079545 | Ga0268266_100795452 | 252 |
| 452 | 3300028800 | Ga0265338_10167188 | Ga0265338_101671881 | 252 |
| 453 | 3300031711 | Ga0265314_10095289 | Ga0265314_100952892 | 252 |
| 454 | 3300031911 | Ga0307412_10000005 | Ga0307412_10000005385 | 252 |
| 455 | 3300031911 | Ga0307412_10000954 | Ga0307412_1000095411 | 252 |
| 456 | 3300037853 | Ga0436364_1317855 | Ga0436364_1317855_1406_2185 | 252 |
| 457 | 3300039437 | Ga0436365_0173869 | Ga0436365_0173869_83894_84652 | 252 |
| 458 | 3300039437 | Ga0436365_0214475 | Ga0436365_0214475_229_1119 | 252 |
| 459 | 3300039447 | Ga0436361_0347557 | Ga0436361_0347557_2397_3158 | 252 |
| 460 | 3300039447 | Ga0436361_1136913 | Ga0436361_1136913_761_1543 | 252 |
| 461 | 3300039453 | Ga0436362_0676981 | Ga0436362_0676981_1529_2311 | 252 |
| 462 | 3300041404 | Ga0439436_0000001 | Ga0439436_0000001_289738_290496 | 252 |
| 463 | 3300041413 | Ga0439465_0001647 | Ga0439465_0001647_2862_3620 | 252 |
| 464 | 3300044693 | Ga0466961_0013450 | Ga0466961_0013450_354_1133 | 252 |
| 465 | 3300046452 | Ga0495617_000183 | Ga0495617_000183_35858_36637 | 252 |
| 466 | 3300046454 | Ga0495592_0175335 | Ga0495592_0175335_414_1172 | 252 |
| 467 | 3300046460 | Ga0495638_0000034 | Ga0495638_0000034_14532_15311 | 252 |
| 468 | 3300046471 | Ga0495650_0005291 | Ga0495650_0005291_2993_3772 | 252 |
| 469 | 3300046471 | Ga0495650_0053886 | Ga0495650_0053886_17_796 | 252 |
| 470 | 3300046474 | Ga0495605_0006772 | Ga0495605_0006772_5669_6448 | 252 |
| 471 | 3300046491 | Ga0495584_0006501 | Ga0495584_0006501_4497_5276 | 252 |
| 472 | 3300046492 | Ga0495585_0000001 | Ga0495585_0000001_591354_592133 | 252 |
| 473 | 3300046492 | Ga0495585_0005476 | Ga0495585_0005476_3340_4119 | 252 |
| 474 | 3300046500 | Ga0495596_0016626 | Ga0495596_0016626_285_1064 | 252 |
| 475 | 3300046501 | Ga0495607_0016052 | Ga0495607_0016052_2677_3456 | 252 |
| 476 | 3300046506 | Ga0495583_0009454 | Ga0495583_0009454_2921_3706 | 252 |
| 477 | 3300046506 | Ga0495583_0018706 | Ga0495583_0018706_837_1616 | 252 |
| 478 | 3300046507 | Ga0495606_0000150 | Ga0495606_0000150_108939_109718 | 252 |
| 479 | 3300046507 | Ga0495606_0000154 | Ga0495606_0000154_37037_37846 | 252 |
| 480 | 3300046507 | Ga0495606_0002890 | Ga0495606_0002890_10736_11515 | 252 |
| 481 | 3300046507 | Ga0495606_0008309 | Ga0495606_0008309_3570_4328 | 252 |
| 482 | 3300046507 | Ga0495606_0015946 | Ga0495606_0015946_3464_4243 | 252 |
| 483 | 3300046507 | Ga0495606_0021515 | Ga0495606_0021515_1217_1996 | 252 |
| 484 | 3300046512 | Ga0495610_0002694 | Ga0495610_0002694_9484_10263 | 252 |
| 485 | 3300046512 | Ga0495610_0005914 | Ga0495610_0005914_6060_6818 | 252 |
| 486 | 3300046512 | Ga0495610_0010266 | Ga0495610_0010266_2434_3192 | 252 |
| 487 | 3300046512 | Ga0495610_0013453 | Ga0495610_0013453_3385_4164 | 252 |
| 488 | 3300046513 | Ga0495616_0000001 | Ga0495616_0000001_549952_550731 | 252 |
| 489 | 3300046515 | Ga0495620_0000588 | Ga0495620_0000588_5646_6425 | 252 |
| 490 | 3300046518 | Ga0495631_0000137 | Ga0495631_0000137_45041_45820 | 252 |
| 491 | 3300046518 | Ga0495631_0000966 | Ga0495631_0000966_45_824 | 252 |
| 492 | 3300046519 | Ga0495632_0004331 | Ga0495632_0004331_1459_2238 | 252 |
| 493 | 3300046519 | Ga0495632_0015610 | Ga0495632_0015610_2304_3083 | 252 |
| 494 | 3300046520 | Ga0495637_0008462 | Ga0495637_0008462_1782_2561 | 252 |
| 495 | 3300046522 | Ga0495643_0083449 | Ga0495643_0083449_710_1489 | 252 |
| 496 | 3300046522 | Ga0495643_0182955 | Ga0495643_0182955_126_899 | 252 |
| 497 | 3300046524 | Ga0495648_0000559 | Ga0495648_0000559_21102_21881 | 252 |
| 498 | 3300046524 | Ga0495648_0008950 | Ga0495648_0008950_72_851 | 252 |
| 499 | 3300046524 | Ga0495648_0202975 | Ga0495648_0202975_19_798 | 252 |
| 500 | 3300046528 | Ga0495642_0007496 | Ga0495642_0007496_1592_2371 | 252 |
| 501 | 3300046530 | Ga0495654_0173092 | Ga0495654_0173092_143_922 | 252 |
| 502 | 3300046535 | Ga0495586_0396980 | Ga0495586_0396980_21_779 | 252 |
| 503 | 3300046543 | Ga0495645_0004978 | Ga0495645_0004978_6971_7729 | 252 |
| 504 | 3300046543 | Ga0495645_0202228 | Ga0495645_0202228_466_1224 | 252 |
| 505 | 3300046557 | Ga0495622_0038416 | Ga0495622_0038416_735_1544 | 252 |
| 506 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_1313992_1314771 | 252 |
| 507 | 3300046648 | Ga0495611_0000429 | Ga0495611_0000429_24098_24877 | 252 |
| 508 | 3300046660 | Ga0495625_0000001 | Ga0495625_0000001_601266_602045 | 252 |
| 509 | 3300046660 | Ga0495625_0052089 | Ga0495625_0052089_2003_2812 | 252 |
| 510 | 3300046660 | Ga0495625_0117404 | Ga0495625_0117404_638_1423 | 252 |
| 511 | 3300046665 | Ga0495661_0001957 | Ga0495661_0001957_13453_14232 | 252 |
| 512 | 3300046680 | Ga0495646_0146573 | Ga0495646_0146573_361_1119 | 252 |
| 513 | 3300046691 | Ga0495670_0005484 | Ga0495670_0005484_1805_2584 | 252 |
| 514 | 3300046691 | Ga0495670_0010389 | Ga0495670_0010389_1736_2494 | 252 |
| 515 | 3300046692 | Ga0495671_0000480 | Ga0495671_0000480_16098_16877 | 252 |
| 516 | 3300046694 | Ga0495649_0007006 | Ga0495649_0007006_5202_5981 | 252 |
| 517 | 3300046694 | Ga0495649_0177817 | Ga0495649_0177817_114_884 | 252 |
| 518 | 3300046794 | Ga0495589_0000016 | Ga0495589_0000016_33316_34095 | 252 |
| 519 | 3300046810 | Ga0495660_0000116 | Ga0495660_0000116_51782_52561 | 252 |
| 520 | 3300046810 | Ga0495660_0003525 | Ga0495660_0003525_6645_7418 | 252 |
| 521 | 3300047323 | Ga0495683_0001193 | Ga0495683_0001193_14473_15252 | 252 |
| 522 | 3300047323 | Ga0495683_0006054 | Ga0495683_0006054_2335_3114 | 252 |
| 523 | 3300047443 | Ga0495687_006747 | Ga0495687_006747_898_1677 | 252 |
| 524 | 3300047443 | Ga0495687_022771 | Ga0495687_022771_437_1216 | 252 |
| 525 | 3300047446 | Ga0495679_000001 | Ga0495679_000001_272184_272963 | 252 |
| 526 | 3300047469 | Ga0495673_0000001 | Ga0495673_0000001_604731_605615 | 252 |
| 527 | 3300047469 | Ga0495673_0000229 | Ga0495673_0000229_59787_60566 | 252 |
| 528 | 3300047472 | Ga0495686_0000085 | Ga0495686_0000085_141299_142072 | 252 |
| 529 | 3300047472 | Ga0495686_0002146 | Ga0495686_0002146_8874_9653 | 252 |
| 530 | 3300047472 | Ga0495686_0018004 | Ga0495686_0018004_2634_3413 | 252 |
| 531 | 3300047472 | Ga0495686_0018953 | Ga0495686_0018953_1075_1833 | 252 |
| 532 | 3300047472 | Ga0495686_0201372 | Ga0495686_0201372_29_808 | 252 |
| 533 | 3300048091 | Ga0495626_0012426 | Ga0495626_0012426_3442_4221 | 252 |
| 534 | 3300048909 | Ga0496106_0002982 | Ga0496106_0002982_10257_11036 | 252 |
| 535 | 3300048913 | Ga0496110_0344718 | Ga0496110_0344718_542_1303 | 252 |
| 536 | 3300048914 | Ga0496111_0001880 | Ga0496111_0001880_8586_9347 | 252 |
| 537 | 3300048914 | Ga0496111_0138037 | Ga0496111_0138037_567_1340 | 252 |
| 538 | 3300048920 | Ga0496117_0028424 | Ga0496117_0028424_65_844 | 252 |
| 539 | 3300048920 | Ga0496117_0043057 | Ga0496117_0043057_2477_3250 | 252 |
| 540 | 3300048921 | Ga0496118_0001001 | Ga0496118_0001001_28049_28822 | 252 |
| 541 | 3300048921 | Ga0496118_0001737 | Ga0496118_0001737_14303_15076 | 252 |
| 542 | 3300048921 | Ga0496118_0009257 | Ga0496118_0009257_6399_7178 | 252 |
| 543 | 3300048921 | Ga0496118_0027108 | Ga0496118_0027108_481_1251 | 252 |
| 544 | 3300048922 | Ga0496119_0027600 | Ga0496119_0027600_2490_3248 | 252 |
| 545 | 3300048924 | Ga0496121_0000129 | Ga0496121_0000129_127111_127884 | 252 |
| 546 | 3300048924 | Ga0496121_0000308 | Ga0496121_0000308_100936_101715 | 252 |
| 547 | 3300048924 | Ga0496121_0000905 | Ga0496121_0000905_12749_13528 | 252 |
| 548 | 3300048924 | Ga0496121_0035264 | Ga0496121_0035264_162_920 | 252 |
| 549 | 3300048924 | Ga0496121_0253953 | Ga0496121_0253953_161_943 | 252 |
| 550 | 3300048925 | Ga0496122_0006856 | Ga0496122_0006856_11404_12177 | 252 |
| 551 | 3300048925 | Ga0496122_0034164 | Ga0496122_0034164_1534_2295 | 252 |
| 552 | 3300048925 | Ga0496122_0113820 | Ga0496122_0113820_585_1358 | 252 |
| 553 | 3300048926 | Ga0496123_0004244 | Ga0496123_0004244_638_1408 | 252 |
| 554 | 3300048926 | Ga0496123_0005671 | Ga0496123_0005671_5078_5851 | 252 |
| 555 | 3300048926 | Ga0496123_0070752 | Ga0496123_0070752_84_845 | 252 |
| 556 | 3300048927 | Ga0496124_0125030 | Ga0496124_0125030_175_936 | 252 |
| 557 | 3300048929 | Ga0496126_0011136 | Ga0496126_0011136_6406_7164 | 252 |
| 558 | 3300048929 | Ga0496126_0054809 | Ga0496126_0054809_493_1266 | 252 |
| 559 | 3300048929 | Ga0496126_0358547 | Ga0496126_0358547_229_1008 | 252 |
| 560 | 3300049459 | Ga0495678_000475 | Ga0495678_000475_32957_33736 | 252 |
| 561 | 3300049460 | Ga0495682_0000576 | Ga0495682_0000576_13903_14682 | 252 |
| 562 | 3300049460 | Ga0495682_0008745 | Ga0495682_0008745_2314_3093 | 252 |
| 563 | 3300049570 | Ga0501033_0096266 | Ga0501033_0096266_517_1293 | 252 |
| 564 | 3300049574 | Ga0501038_0120442 | Ga0501038_0120442_561_1337 | 252 |
| 565 | 3300049580 | Ga0501046_0041425 | Ga0501046_0041425_1070_1846 | 252 |
| 566 | 3300049586 | Ga0501070_0090736 | Ga0501070_0090736_794_1570 | 252 |
| 567 | 3300049822 | Ga0501035_0069317 | Ga0501035_0069317_476_1252 | 252 |
| 568 | 3300049823 | Ga0501044_0018799 | Ga0501044_0018799_5650_6426 | 252 |
| 569 | 3300053087 | Ga0500643_000002 | Ga0500643_000002_500831_501610 | 252 |
| 570 | 3300053103 | Ga0500555_000288 | Ga0500555_000288_7004_7783 | 252 |
| 571 | 3300053125 | Ga0500618_000111 | Ga0500618_000111_13395_14156 | 252 |
| 572 | 3300053150 | Ga0500603_003350 | Ga0500603_003350_2525_3283 | 252 |
| 573 | 3300053153 | Ga0500616_0011692 | Ga0500616_0011692_3719_4492 | 252 |
| 574 | 3300053156 | Ga0500622_0000335 | Ga0500622_0000335_39252_40022 | 252 |
| 575 | 3300053156 | Ga0500622_0045354 | Ga0500622_0045354_153_932 | 252 |
| 576 | 3300053160 | Ga0500633_0090956 | Ga0500633_0090956_239_1018 | 252 |
| 577 | 3300053730 | Ga0500645_001386 | Ga0500645_001386_6392_7171 | 252 |
| 578 | iso_pu_bacteria | 2501025501 | 2501073807 | 252 |
| 579 | iso_pu_bacteria | 2501025502 | 2501079074 | 252 |
| 580 | iso_pu_bacteria | 2501025504 | 2501407645 | 252 |
| 581 | iso_pu_bacteria | 2508501125 | 2509129968 | 252 |
| 582 | iso_pu_bacteria | 2510917013 | 2511093473 | 252 |
| 583 | iso_pu_bacteria | 2510917014 | 2511097517 | 252 |
| 584 | iso_pu_bacteria | 2510917015 | 2511105536 | 252 |
| 585 | iso_pu_bacteria | 2510917030 | 2511200463 | 252 |
| 586 | iso_pu_bacteria | 2515154189 | 2516022515 | 252 |
| 587 | iso_pu_bacteria | 2582581299 | 2585230599 | 252 |
| 588 | iso_pu_bacteria | 2617270735 | 2617346373 | 252 |
| 589 | iso_pu_bacteria | 2643221643 | 2644240922 | 252 |
| 590 | iso_pu_bacteria | 2734482264 | 2735837095 | 252 |
| 591 | iso_pu_bacteria | 2738543009 | 2739226551 | 252 |
| 592 | iso_pu_bacteria | 2738543031 | 2739351467 | 252 |
| 593 | iso_pu_bacteria | 2739367700 | 2739731840 | 252 |
| 594 | iso_pu_bacteria | 2808606384 | 2808970880 | 252 |
| 595 | iso_pu_bacteria | 2808606390 | 2809005711 | 252 |
| 596 | iso_pu_bacteria | 2808606391 | 2809012532 | 252 |
| 597 | iso_pu_bacteria | 2824773399 | 2824774635 | 252 |
| 598 | iso_pu_bacteria | 2857357740 | 2857358049 | 252 |
| 599 | iso_pu_bacteria | 2881412998 | 2881413179 | 252 |
| 600 | iso_pu_bacteria | 2883087390 | 2883089841 | 252 |
| 601 | iso_pu_bacteria | 2884338543 | 2884339975 | 252 |
| 602 | iso_pu_bacteria | 2891048133 | 2891050352 | 252 |
| 603 | iso_pu_bacteria | 2919100787 | 2919100913 | 252 |
| 604 | iso_pu_bacteria | 2941471342 | 2941472260 | 252 |
| 605 | iso_pu_bacteria | 3005445848 | 3005446513 | 252 |
| 606 | iso_pu_bacteria | 3005452660 | 3005453231 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3icc-assembly1.cif.gz_A | crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution | 0.9621 | 5 | 252 |
| 4osp-assembly1.cif.gz_C | the crystal structure of urdamycin c-6 ketoreductase domain urdmred with bound nadp and rabelomycin | 0.9614 | 5 | 245 |
| 4osp-assembly1.cif.gz_D | the crystal structure of urdamycin c-6 ketoreductase domain urdmred with bound nadp and rabelomycin | 0.9604 | 5 | 249 |
| 4fgs-assembly1.cif.gz_D | crystal structure of a probable dehydrogenase protein | 0.9583 | 4 | 251 |
| 7nm7-assembly1.cif.gz_AAA | the crystal structure of the antimycin pathway standalone ketoreductase, antm | 0.9578 | 5 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ospB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9531 | 5 | 249 | 3.40.50.720 |
| 4mowD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9475 | 5 | 250 | 3.40.50.720 |
| 3wtbC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9423 | 3 | 252 | 3.40.50.720 |
| 3v2gA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9414 | 3 | 249 | 3.40.50.720 |
| 4hsyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9405 | 5 | 252 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K8D0U4-F1-model_v4 | deleted | 0.996 | 4 | 184 |
|
| AF-A0A542LX34-F1-model_v4 | NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) | 0.9926 | 4 | 252 |
GO:0016616
GO:0030497 |
| AF-A0A0P8XBT2-F1-model_v4 | Short chain dehydrogenase family protein | 0.9922 | 4 | 245 |
|
| AF-R9VI22-F1-model_v4 | deleted | 0.9915 | 2 | 252 |
|
| AF-A0A497ZGF6-F1-model_v4 | deleted | 0.9908 | 3 | 252 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar