F468561
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 606 | 318 | 606 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_100011695|Ga0070707_1000116952 |
| Length | 106 |
| Sequence | VASKTRHAGAPVYFPASLAVENEVKGKLIAEHRRADKDTGSPEVQVALHTARIRELTEHLKTHAKDHHSRRGLLLLVGKQRRLLNYLRDTDVERYRALVAKLGIRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 116 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 123 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 170 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 173 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 174 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 184 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 191 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 198 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 201 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 202 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 203 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 204 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 205 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 206 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 207 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 208 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 209 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 210 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 211 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 248 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 249 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 250 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 251 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 252 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 255 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 258 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 259 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 260 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 261 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 262 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 263 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 264 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 265 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 266 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 267 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 287 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 288 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 295 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 296 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 297 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 309 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 318 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.05 |
| Metatranscriptomes | 4.95 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.64 |
| Nodule | 0 |
| Rhizoplane | 6.27 |
| Rhizosphere | 87.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1000245 | 3300002074 | Bacteria | 6465 |
| 2 | JGI24034J26672_10000228 | 3300002239 | Bacteria | 7405 |
| 3 | JGI24742J22300_10002179 | 3300002244 | Bacteria | 3122 |
| 4 | JGI25159J45721_1043792 | 3300002987 | Bacteria | 641 |
| 5 | JGI25151J46595_10000335 | 3300003187 | Bacteria | 50415 |
| 6 | JGI25406J46586_10068133 | 3300003203 | Bacteria | 1125 |
| 7 | JGI25406J46586_10083903 | 3300003203 | Bacteria | 972 |
| 8 | JGI25153J46596_10036352 | 3300003215 | Bacteria | 1580 |
| 9 | JGI25160J50197_1013448 | 3300003354 | Bacteria | 2790 |
| 10 | Ga0007429J51699_1051436 | 3300003579 | Bacteria | 871 |
| 11 | Ga0058862_12812905 | 3300004803 | Bacteria | 678 |
| 12 | Ga0065165_1043725 | 3300005262 | Bacteria | 1314 |
| 13 | Ga0070683_100077533 | 3300005329 | Bacteria | 3108 |
| 14 | Ga0070683_100696874 | 3300005329 | Bacteria | 973 |
| 15 | Ga0070683_101276346 | 3300005329 | Bacteria | 706 |
| 16 | Ga0070690_101078506 | 3300005330 | Bacteria | 636 |
| 17 | Ga0070670_101202171 | 3300005331 | Bacteria | 693 |
| 18 | Ga0070682_100277708 | 3300005337 | Bacteria | 1220 |
| 19 | Ga0070682_100388772 | 3300005337 | Bacteria | 1051 |
| 20 | Ga0068868_100135247 | 3300005338 | Bacteria | 2020 |
| 21 | Ga0068868_100247312 | 3300005338 | Bacteria | 1500 |
| 22 | Ga0068868_101164155 | 3300005338 | Bacteria | 712 |
| 23 | Ga0068868_102180316 | 3300005338 | Bacteria | 528 |
| 24 | Ga0070692_10462039 | 3300005345 | Bacteria | 815 |
| 25 | Ga0070668_100375507 | 3300005347 | Bacteria | 1209 |
| 26 | Ga0070674_100000012 | 3300005356 | Bacteria | 130773 |
| 27 | Ga0070674_100354732 | 3300005356 | Bacteria | 1186 |
| 28 | Ga0070673_101818462 | 3300005364 | Bacteria | 577 |
| 29 | Ga0070688_100000860 | 3300005365 | Bacteria | 15092 |
| 30 | Ga0070688_101062758 | 3300005365 | Bacteria | 646 |
| 31 | Ga0070667_100721170 | 3300005367 | Bacteria | 923 |
| 32 | Ga0070667_101870658 | 3300005367 | Bacteria | 565 |
| 33 | Ga0070667_102173896 | 3300005367 | Bacteria | 523 |
| 34 | Ga0070703_10001676 | 3300005406 | Bacteria | 6579 |
| 35 | Ga0070709_10302412 | 3300005434 | Bacteria | 1169 |
| 36 | Ga0070714_100640646 | 3300005435 | Bacteria | 1022 |
| 37 | Ga0070714_101127546 | 3300005435 | Bacteria | 765 |
| 38 | Ga0070713_100000010 | 3300005436 | Bacteria | 151790 |
| 39 | Ga0070713_100105340 | 3300005436 | Bacteria | 2450 |
| 40 | Ga0070713_100208016 | 3300005436 | Bacteria | 1770 |
| 41 | Ga0070713_101271984 | 3300005436 | Bacteria | 713 |
| 42 | Ga0070713_101612968 | 3300005436 | Bacteria | 630 |
| 43 | Ga0070713_102070899 | 3300005436 | Bacteria | 552 |
| 44 | Ga0070710_10055018 | 3300005437 | Bacteria | 2247 |
| 45 | Ga0070710_10990335 | 3300005437 | Bacteria | 612 |
| 46 | Ga0070711_100102559 | 3300005439 | Bacteria | 2084 |
| 47 | Ga0070705_100139831 | 3300005440 | Bacteria | 1592 |
| 48 | Ga0070705_101683561 | 3300005440 | Bacteria | 536 |
| 49 | Ga0070694_100955108 | 3300005444 | Bacteria | 710 |
| 50 | Ga0070708_100004731 | 3300005445 | Bacteria | 10724 |
| 51 | Ga0070708_100010345 | 3300005445 | Bacteria | 7555 |
| 52 | Ga0070708_100396353 | 3300005445 | Bacteria | 1302 |
| 53 | Ga0070708_101363358 | 3300005445 | Bacteria | 662 |
| 54 | Ga0070708_101383269 | 3300005445 | Bacteria | 657 |
| 55 | Ga0070678_100564606 | 3300005456 | Bacteria | 1012 |
| 56 | Ga0070662_100000002 | 3300005457 | Bacteria | 253208 |
| 57 | Ga0070681_10023478 | 3300005458 | Bacteria | 6203 |
| 58 | Ga0070681_10092805 | 3300005458 | Bacteria | 2968 |
| 59 | Ga0070681_10431463 | 3300005458 | Bacteria | 1230 |
| 60 | Ga0068867_101868435 | 3300005459 | Bacteria | 566 |
| 61 | Ga0070685_10001018 | 3300005466 | Bacteria | 15078 |
| 62 | Ga0070685_10261075 | 3300005466 | Bacteria | 1152 |
| 63 | Ga0070706_100000606 | 3300005467 | Bacteria | 41522 |
| 64 | Ga0070706_100000697 | 3300005467 | Bacteria | 38037 |
| 65 | Ga0070706_100076019 | 3300005467 | Bacteria | 3108 |
| 66 | Ga0070706_100162673 | 3300005467 | Unclassified | 2084 |
| 67 | Ga0070706_100177064 | 3300005467 | Bacteria | 1991 |
| 68 | Ga0070706_100205211 | 3300005467 | Bacteria | 1841 |
| 69 | Ga0070707_100008348 | 3300005468 | Bacteria | 9616 |
| 70 | Ga0070707_100011695 | 3300005468 | Bacteria | 8189 |
| 71 | Ga0070707_100021792 | 3300005468 | Bacteria | 6056 |
| 72 | Ga0070707_100127427 | 3300005468 | Bacteria | 2474 |
| 73 | Ga0070707_100375453 | 3300005468 | Unclassified | 1381 |
| 74 | Ga0070707_100749667 | 3300005468 | Bacteria | 940 |
| 75 | Ga0070707_101696158 | 3300005468 | Bacteria | 599 |
| 76 | Ga0070707_101911416 | 3300005468 | Bacteria | 561 |
| 77 | Ga0070698_100003666 | 3300005471 | Bacteria | 16870 |
| 78 | Ga0070698_100151399 | 3300005471 | Bacteria | 2267 |
| 79 | Ga0070698_100352901 | 3300005471 | Bacteria | 1402 |
| 80 | Ga0070698_100474803 | 3300005471 | Bacteria | 1187 |
| 81 | Ga0070698_100941981 | 3300005471 | Unclassified | 810 |
| 82 | Ga0070698_101062863 | 3300005471 | Unclassified | 757 |
| 83 | Ga0070698_101139192 | 3300005471 | Bacteria | 729 |
| 84 | Ga0070699_100000907 | 3300005518 | Bacteria | 27639 |
| 85 | Ga0070699_100001226 | 3300005518 | Bacteria | 23641 |
| 86 | Ga0070699_100029831 | 3300005518 | Bacteria | 4704 |
| 87 | Ga0070699_100107882 | 3300005518 | Bacteria | 2443 |
| 88 | Ga0070699_100277250 | 3300005518 | Bacteria | 1501 |
| 89 | Ga0070699_100423891 | 3300005518 | Bacteria | 1204 |
| 90 | Ga0070699_100730478 | 3300005518 | Bacteria | 905 |
| 91 | Ga0070699_101025761 | 3300005518 | Bacteria | 757 |
| 92 | Ga0070699_101104485 | 3300005518 | Bacteria | 727 |
| 93 | Ga0070699_101451450 | 3300005518 | Bacteria | 629 |
| 94 | Ga0070679_100405982 | 3300005530 | Bacteria | 1308 |
| 95 | Ga0070679_101137335 | 3300005530 | Bacteria | 726 |
| 96 | Ga0070679_101894915 | 3300005530 | Bacteria | 545 |
| 97 | Ga0070697_100000025 | 3300005536 | Bacteria | 128895 |
| 98 | Ga0070697_100001828 | 3300005536 | Bacteria | 16269 |
| 99 | Ga0070697_100004167 | 3300005536 | Bacteria | 11076 |
| 100 | Ga0070697_100007410 | 3300005536 | Bacteria | 8545 |
| 101 | Ga0070697_100017925 | 3300005536 | Bacteria | 5578 |
| 102 | Ga0070697_100076813 | 3300005536 | Bacteria | 2746 |
| 103 | Ga0070697_100099541 | 3300005536 | Bacteria | 2413 |
| 104 | Ga0070697_100156127 | 3300005536 | Bacteria | 1926 |
| 105 | Ga0070697_100179201 | 3300005536 | Bacteria | 1796 |
| 106 | Ga0070697_100353274 | 3300005536 | Bacteria | 1270 |
| 107 | Ga0070697_100579113 | 3300005536 | Bacteria | 985 |
| 108 | Ga0070697_100679095 | 3300005536 | Bacteria | 908 |
| 109 | Ga0070697_100760371 | 3300005536 | Unclassified | 856 |
| 110 | Ga0070697_101304508 | 3300005536 | Bacteria | 648 |
| 111 | Ga0068853_100794987 | 3300005539 | Bacteria | 906 |
| 112 | Ga0070672_101065898 | 3300005543 | Bacteria | 718 |
| 113 | Ga0070686_100749561 | 3300005544 | Bacteria | 783 |
| 114 | Ga0070695_100226829 | 3300005545 | Bacteria | 1348 |
| 115 | Ga0070695_100625310 | 3300005545 | Bacteria | 848 |
| 116 | Ga0070695_100700112 | 3300005545 | Bacteria | 804 |
| 117 | Ga0070695_100896683 | 3300005545 | Bacteria | 716 |
| 118 | Ga0070695_101744173 | 3300005545 | Bacteria | 522 |
| 119 | Ga0070696_100188979 | 3300005546 | Bacteria | 1532 |
| 120 | Ga0070696_100628282 | 3300005546 | Bacteria | 868 |
| 121 | Ga0070696_100656285 | 3300005546 | Bacteria | 851 |
| 122 | Ga0070696_100966752 | 3300005546 | Bacteria | 710 |
| 123 | Ga0070693_100003273 | 3300005547 | Bacteria | 7521 |
| 124 | Ga0070665_101194011 | 3300005548 | Bacteria | 772 |
| 125 | Ga0070704_100016423 | 3300005549 | Bacteria | 4677 |
| 126 | Ga0070704_100866133 | 3300005549 | Bacteria | 811 |
| 127 | Ga0070704_101438972 | 3300005549 | Bacteria | 633 |
| 128 | Ga0070704_101552381 | 3300005549 | Bacteria | 610 |
| 129 | Ga0070704_101710239 | 3300005549 | Unclassified | 581 |
| 130 | Ga0068855_100032833 | 3300005563 | Bacteria | 6197 |
| 131 | Ga0068857_101264343 | 3300005577 | Bacteria | 716 |
| 132 | Ga0068854_101436264 | 3300005578 | Bacteria | 625 |
| 133 | Ga0068854_101818638 | 3300005578 | Bacteria | 559 |
| 134 | Ga0068856_101175506 | 3300005614 | Bacteria | 784 |
| 135 | Ga0070702_100288478 | 3300005615 | Bacteria | 1130 |
| 136 | Ga0068852_100160942 | 3300005616 | Bacteria | 2096 |
| 137 | Ga0068859_100640950 | 3300005617 | Bacteria | 1155 |
| 138 | Ga0068866_10000460 | 3300005718 | Bacteria | 18634 |
| 139 | Ga0068866_10481288 | 3300005718 | Bacteria | 818 |
| 140 | Ga0068866_11446976 | 3300005718 | Unclassified | 504 |
| 141 | Ga0068861_100866300 | 3300005719 | Bacteria | 853 |
| 142 | Ga0068870_10630906 | 3300005840 | Bacteria | 732 |
| 143 | Ga0068858_101129382 | 3300005842 | Bacteria | 770 |
| 144 | Ga0068858_101842137 | 3300005842 | Bacteria | 598 |
| 145 | Ga0068858_102266387 | 3300005842 | Bacteria | 537 |
| 146 | Ga0068862_101192247 | 3300005844 | Bacteria | 760 |
| 147 | Ga0068862_101774516 | 3300005844 | Bacteria | 626 |
| 148 | Ga0081455_10035539 | 3300005937 | Bacteria | 4451 |
| 149 | Ga0081455_10075713 | 3300005937 | Bacteria | 2775 |
| 150 | Ga0081455_10143574 | 3300005937 | Bacteria | 1850 |
| 151 | Ga0081455_10148147 | 3300005937 | Bacteria | 1812 |
| 152 | Ga0081455_10190393 | 3300005937 | Bacteria | 1545 |
| 153 | Ga0081455_10201992 | 3300005937 | Bacteria | 1488 |
| 154 | Ga0081538_10000141 | 3300005981 | Bacteria | 74085 |
| 155 | Ga0081538_10048844 | 3300005981 | Bacteria | 2574 |
| 156 | Ga0081538_10053005 | 3300005981 | Bacteria | 2417 |
| 157 | Ga0081539_10000078 | 3300005985 | Bacteria | 226113 |
| 158 | Ga0081539_10009284 | 3300005985 | Bacteria | 8266 |
| 159 | Ga0070717_10000368 | 3300006028 | Bacteria | 28942 |
| 160 | Ga0070717_10238562 | 3300006028 | Unclassified | 1602 |
| 161 | Ga0070717_10474277 | 3300006028 | Unclassified | 1129 |
| 162 | Ga0070717_12106142 | 3300006028 | Unclassified | 507 |
| 163 | Ga0075363_100183933 | 3300006048 | Bacteria | 1190 |
| 164 | Ga0075363_100424893 | 3300006048 | Bacteria | 783 |
| 165 | Ga0070715_10345475 | 3300006163 | Bacteria | 811 |
| 166 | Ga0070715_10625405 | 3300006163 | Bacteria | 634 |
| 167 | Ga0070716_100278013 | 3300006173 | Bacteria | 1154 |
| 168 | Ga0070716_100411991 | 3300006173 | Bacteria | 975 |
| 169 | Ga0070716_100499620 | 3300006173 | Bacteria | 897 |
| 170 | Ga0070716_100717084 | 3300006173 | Bacteria | 766 |
| 171 | Ga0070716_101457997 | 3300006173 | Unclassified | 558 |
| 172 | Ga0070712_100176452 | 3300006175 | Bacteria | 1662 |
| 173 | Ga0070712_100295163 | 3300006175 | Bacteria | 1310 |
| 174 | Ga0070712_100782902 | 3300006175 | Bacteria | 818 |
| 175 | Ga0097621_100551822 | 3300006237 | Bacteria | 1049 |
| 176 | Ga0097621_100554149 | 3300006237 | Bacteria | 1047 |
| 177 | Ga0075370_11038241 | 3300006353 | Bacteria | 503 |
| 178 | Ga0068871_101534530 | 3300006358 | Bacteria | 630 |
| 179 | Ga0075428_100016707 | 3300006844 | Bacteria | 8101 |
| 180 | Ga0075428_100027485 | 3300006844 | Bacteria | 6294 |
| 181 | Ga0075428_100330527 | 3300006844 | Bacteria | 1637 |
| 182 | Ga0075430_100036063 | 3300006846 | Bacteria | 4193 |
| 183 | Ga0075430_100118082 | 3300006846 | Bacteria | 2211 |
| 184 | Ga0075431_100008760 | 3300006847 | Bacteria | 10136 |
| 185 | Ga0075431_100422763 | 3300006847 | Bacteria | 1332 |
| 186 | Ga0075433_10008217 | 3300006852 | Bacteria | 8315 |
| 187 | Ga0075433_10012628 | 3300006852 | Bacteria | 6832 |
| 188 | Ga0075434_100008137 | 3300006871 | Bacteria | 9724 |
| 189 | Ga0075434_100092162 | 3300006871 | Bacteria | 3032 |
| 190 | Ga0075434_100986117 | 3300006871 | Bacteria | 857 |
| 191 | Ga0075429_100002108 | 3300006880 | Bacteria | 16603 |
| 192 | Ga0075429_100044834 | 3300006880 | Bacteria | 3846 |
| 193 | Ga0075429_100695665 | 3300006880 | Bacteria | 890 |
| 194 | Ga0068865_100549299 | 3300006881 | Bacteria | 970 |
| 195 | Ga0068865_100825046 | 3300006881 | Bacteria | 802 |
| 196 | Ga0068865_101103566 | 3300006881 | Bacteria | 699 |
| 197 | Ga0075436_100211207 | 3300006914 | Bacteria | 1376 |
| 198 | Ga0075436_100478181 | 3300006914 | Unclassified | 909 |
| 199 | Ga0097620_100640977 | 3300006931 | Bacteria | 1155 |
| 200 | Ga0075435_100010534 | 3300007076 | Bacteria | 6765 |
| 201 | Ga0075435_100025259 | 3300007076 | Bacteria | 4623 |
| 202 | Ga0075435_101375497 | 3300007076 | Bacteria | 618 |
| 203 | Ga0099794_10076976 | 3300007265 | Bacteria | 1640 |
| 204 | Ga0099794_10078534 | 3300007265 | Bacteria | 1625 |
| 205 | Ga0099794_10232651 | 3300007265 | Bacteria | 948 |
| 206 | Ga0105240_12469473 | 3300009093 | Bacteria | 538 |
| 207 | Ga0105240_12498236 | 3300009093 | Bacteria | 534 |
| 208 | Ga0111539_10696624 | 3300009094 | Bacteria | 1182 |
| 209 | Ga0111539_10896175 | 3300009094 | Bacteria | 1032 |
| 210 | Ga0111539_11023538 | 3300009094 | Bacteria | 960 |
| 211 | Ga0105245_10317863 | 3300009098 | Bacteria | 1533 |
| 212 | Ga0105245_10801620 | 3300009098 | Bacteria | 980 |
| 213 | Ga0105245_11822737 | 3300009098 | Bacteria | 661 |
| 214 | Ga0105247_10433313 | 3300009101 | Bacteria | 944 |
| 215 | Ga0114129_10418308 | 3300009147 | Bacteria | 1763 |
| 216 | Ga0114129_10918290 | 3300009147 | Bacteria | 1108 |
| 217 | Ga0114129_11714529 | 3300009147 | Bacteria | 766 |
| 218 | Ga0105243_10200652 | 3300009148 | Bacteria | 1749 |
| 219 | Ga0105243_10328460 | 3300009148 | Bacteria | 1396 |
| 220 | Ga0105243_13015027 | 3300009148 | Bacteria | 511 |
| 221 | Ga0105241_11064549 | 3300009174 | Bacteria | 760 |
| 222 | Ga0105242_10066584 | 3300009176 | Bacteria | 2976 |
| 223 | Ga0105242_10664087 | 3300009176 | Bacteria | 1015 |
| 224 | Ga0105242_11113140 | 3300009176 | Bacteria | 804 |
| 225 | Ga0105242_11905771 | 3300009176 | Bacteria | 635 |
| 226 | Ga0105242_12599107 | 3300009176 | Bacteria | 555 |
| 227 | Ga0105242_13005503 | 3300009176 | Bacteria | 522 |
| 228 | Ga0105248_10521005 | 3300009177 | Bacteria | 1340 |
| 229 | Ga0105248_13130913 | 3300009177 | Bacteria | 526 |
| 230 | Ga0105248_13434819 | 3300009177 | Bacteria | 503 |
| 231 | Ga0105237_10872536 | 3300009545 | Bacteria | 907 |
| 232 | Ga0105238_11566264 | 3300009551 | Bacteria | 688 |
| 233 | Ga0105238_11817152 | 3300009551 | Bacteria | 642 |
| 234 | Ga0105238_12029912 | 3300009551 | Bacteria | 609 |
| 235 | Ga0105238_12230505 | 3300009551 | Bacteria | 582 |
| 236 | Ga0105249_10035662 | 3300009553 | Bacteria | 4510 |
| 237 | Ga0105249_10712482 | 3300009553 | Bacteria | 1064 |
| 238 | Ga0099796_10009902 | 3300010159 | Bacteria | 2599 |
| 239 | Ga0105239_10865192 | 3300010375 | Bacteria | 1037 |
| 240 | Ga0105239_12412216 | 3300010375 | Bacteria | 613 |
| 241 | Ga0105239_13182732 | 3300010375 | Bacteria | 534 |
| 242 | Ga0157342_1083339 | 3300012507 | Bacteria | 506 |
| 243 | Ga0157370_10076189 | 3300013104 | Bacteria | 3160 |
| 244 | Ga0157369_10577821 | 3300013105 | Bacteria | 1161 |
| 245 | Ga0157369_12450237 | 3300013105 | Unclassified | 528 |
| 246 | Ga0157374_11090196 | 3300013296 | Bacteria | 819 |
| 247 | Ga0157374_11585707 | 3300013296 | Bacteria | 679 |
| 248 | Ga0157374_12031578 | 3300013296 | Bacteria | 601 |
| 249 | Ga0157374_12283756 | 3300013296 | Bacteria | 568 |
| 250 | Ga0157378_10969379 | 3300013297 | Bacteria | 883 |
| 251 | Ga0157378_11063798 | 3300013297 | Bacteria | 845 |
| 252 | Ga0157378_13170646 | 3300013297 | Bacteria | 511 |
| 253 | Ga0163162_10583164 | 3300013306 | Bacteria | 1245 |
| 254 | Ga0163162_11249490 | 3300013306 | Bacteria | 843 |
| 255 | Ga0163162_12199277 | 3300013306 | Bacteria | 633 |
| 256 | Ga0163162_12757277 | 3300013306 | Bacteria | 566 |
| 257 | Ga0157372_11063923 | 3300013307 | Bacteria | 936 |
| 258 | Ga0157375_10472782 | 3300013308 | Bacteria | 1419 |
| 259 | Ga0157375_11018221 | 3300013308 | Bacteria | 967 |
| 260 | Ga0157375_11576696 | 3300013308 | Bacteria | 776 |
| 261 | Ga0163163_11755949 | 3300014325 | Bacteria | 681 |
| 262 | Ga0163163_12415470 | 3300014325 | Bacteria | 584 |
| 263 | Ga0157380_10417700 | 3300014326 | Bacteria | 1278 |
| 264 | Ga0157380_10452083 | 3300014326 | Bacteria | 1234 |
| 265 | Ga0157380_10926813 | 3300014326 | Bacteria | 899 |
| 266 | Ga0157377_11240233 | 3300014745 | Bacteria | 579 |
| 267 | Ga0157379_10090236 | 3300014968 | Bacteria | 2749 |
| 268 | Ga0157379_11343470 | 3300014968 | Bacteria | 691 |
| 269 | Ga0157379_12308675 | 3300014968 | Bacteria | 536 |
| 270 | Ga0157376_11460886 | 3300014969 | Bacteria | 716 |
| 271 | Ga0157376_12372247 | 3300014969 | Bacteria | 570 |
| 272 | Ga0163161_10578720 | 3300017792 | Bacteria | 923 |
| 273 | Ga0197907_10928300 | 3300020069 | Bacteria | 863 |
| 274 | Ga0197907_10961597 | 3300020069 | Bacteria | 624 |
| 275 | Ga0206356_10556947 | 3300020070 | Bacteria | 3311 |
| 276 | Ga0206356_10923357 | 3300020070 | Bacteria | 870 |
| 277 | Ga0206355_1703326 | 3300020076 | Unclassified | 772 |
| 278 | Ga0206352_10134164 | 3300020078 | Bacteria | 1235 |
| 279 | Ga0206352_11055209 | 3300020078 | Bacteria | 922 |
| 280 | Ga0206350_10782470 | 3300020080 | Bacteria | 545 |
| 281 | Ga0206354_10028481 | 3300020081 | Bacteria | 594 |
| 282 | Ga0206354_10261121 | 3300020081 | Bacteria | 556 |
| 283 | Ga0206353_10733172 | 3300020082 | Bacteria | 865 |
| 284 | Ga0206353_11913518 | 3300020082 | Bacteria | 707 |
| 285 | Ga0213872_10052478 | 3300021361 | Bacteria | 1850 |
| 286 | Ga0213875_10015036 | 3300021388 | Bacteria | 3768 |
| 287 | Ga0213875_10027132 | 3300021388 | Bacteria | 2724 |
| 288 | Ga0213875_10334401 | 3300021388 | Bacteria | 718 |
| 289 | Ga0213875_10355905 | 3300021388 | Bacteria | 696 |
| 290 | Ga0213871_10008809 | 3300021441 | Bacteria | 2239 |
| 291 | Ga0224712_10003013 | 3300022467 | Bacteria | 4287 |
| 292 | Ga0224712_10194969 | 3300022467 | Bacteria | 919 |
| 293 | Ga0224712_10340242 | 3300022467 | Bacteria | 708 |
| 294 | Ga0224712_10532763 | 3300022467 | Bacteria | 570 |
| 295 | Ga0209130_1007500 | 3300025284 | Bacteria | 3357 |
| 296 | Ga0209025_1000179 | 3300025294 | Bacteria | 157965 |
| 297 | Ga0209758_1002708 | 3300025297 | Bacteria | 17456 |
| 298 | Ga0207426_1000191 | 3300025302 | Bacteria | 151850 |
| 299 | Ga0207653_10005689 | 3300025885 | Bacteria | 3890 |
| 300 | Ga0207682_10000091 | 3300025893 | Bacteria | 41479 |
| 301 | Ga0207692_11091529 | 3300025898 | Unclassified | 528 |
| 302 | Ga0207642_10000275 | 3300025899 | Bacteria | 15398 |
| 303 | Ga0207642_10268251 | 3300025899 | Bacteria | 976 |
| 304 | Ga0207647_10527386 | 3300025904 | Bacteria | 657 |
| 305 | Ga0207699_10874655 | 3300025906 | Unclassified | 662 |
| 306 | Ga0207684_10000014 | 3300025910 | Bacteria | 440027 |
| 307 | Ga0207684_10000027 | 3300025910 | Bacteria | 313272 |
| 308 | Ga0207684_10152163 | 3300025910 | Bacteria | 1991 |
| 309 | Ga0207684_10171476 | 3300025910 | Unclassified | 1870 |
| 310 | Ga0207684_10273662 | 3300025910 | Unclassified | 1457 |
| 311 | Ga0207684_11297081 | 3300025910 | Bacteria | 600 |
| 312 | Ga0207654_11229480 | 3300025911 | Bacteria | 546 |
| 313 | Ga0207707_10434644 | 3300025912 | Bacteria | 1124 |
| 314 | Ga0207663_11320352 | 3300025916 | Bacteria | 581 |
| 315 | Ga0207663_11622702 | 3300025916 | Bacteria | 520 |
| 316 | Ga0207660_10418690 | 3300025917 | Bacteria | 1080 |
| 317 | Ga0207649_10000127 | 3300025920 | Bacteria | 64603 |
| 318 | Ga0207652_10660557 | 3300025921 | Bacteria | 934 |
| 319 | Ga0207646_10005694 | 3300025922 | Bacteria | 13068 |
| 320 | Ga0207646_10040687 | 3300025922 | Bacteria | 4179 |
| 321 | Ga0207646_10115916 | 3300025922 | Bacteria | 2406 |
| 322 | Ga0207646_10486774 | 3300025922 | Bacteria | 1112 |
| 323 | Ga0207646_10760385 | 3300025922 | Bacteria | 864 |
| 324 | Ga0207687_10195706 | 3300025927 | Bacteria | 1576 |
| 325 | Ga0207700_10000007 | 3300025928 | Bacteria | 345720 |
| 326 | Ga0207700_10358341 | 3300025928 | Unclassified | 1271 |
| 327 | Ga0207700_10490166 | 3300025928 | Bacteria | 1087 |
| 328 | Ga0207700_10895682 | 3300025928 | Unclassified | 794 |
| 329 | Ga0207664_10137588 | 3300025929 | Unclassified | 2062 |
| 330 | Ga0207664_10395288 | 3300025929 | Bacteria | 1229 |
| 331 | Ga0207664_10457703 | 3300025929 | Bacteria | 1139 |
| 332 | Ga0207664_10994015 | 3300025929 | Unclassified | 752 |
| 333 | Ga0207706_10000001 | 3300025933 | Bacteria | 423014 |
| 334 | Ga0207686_10085344 | 3300025934 | Bacteria | 2071 |
| 335 | Ga0207709_10449005 | 3300025935 | Bacteria | 996 |
| 336 | Ga0207709_10758580 | 3300025935 | Bacteria | 780 |
| 337 | Ga0207669_10000017 | 3300025937 | Bacteria | 119878 |
| 338 | Ga0207669_11078839 | 3300025937 | Unclassified | 677 |
| 339 | Ga0207665_10477905 | 3300025939 | Bacteria | 960 |
| 340 | Ga0207665_10510797 | 3300025939 | Bacteria | 929 |
| 341 | Ga0207661_10236297 | 3300025944 | Bacteria | 1620 |
| 342 | Ga0207667_10256850 | 3300025949 | Bacteria | 1787 |
| 343 | Ga0207667_10584167 | 3300025949 | Bacteria | 1127 |
| 344 | Ga0207712_10850918 | 3300025961 | Bacteria | 804 |
| 345 | Ga0207668_11149948 | 3300025972 | Bacteria | 697 |
| 346 | Ga0207640_11407553 | 3300025981 | Bacteria | 625 |
| 347 | Ga0207677_10000284 | 3300026023 | Bacteria | 37886 |
| 348 | Ga0207708_10339341 | 3300026075 | Bacteria | 1230 |
| 349 | Ga0207702_10379083 | 3300026078 | Unclassified | 1360 |
| 350 | Ga0207648_10792678 | 3300026089 | Bacteria | 882 |
| 351 | Ga0207674_10107858 | 3300026116 | Bacteria | 2762 |
| 352 | Ga0207698_10067576 | 3300026142 | Bacteria | 2819 |
| 353 | Ga0207698_11386403 | 3300026142 | Bacteria | 718 |
| 354 | Ga0265326_10106596 | 3300028558 | Bacteria | 795 |
| 355 | Ga0265319_1000317 | 3300028563 | Bacteria | 35915 |
| 356 | Ga0265338_10007586 | 3300028800 | Bacteria | 13402 |
| 357 | Ga0265324_10099004 | 3300029957 | Bacteria | 991 |
| 358 | Ga0265766_1006649 | 3300030863 | Bacteria | 761 |
| 359 | Ga0265766_1012905 | 3300030863 | Bacteria | 622 |
| 360 | Ga0265764_117031 | 3300030882 | Unclassified | 509 |
| 361 | Ga0265761_107232 | 3300030889 | Bacteria | 604 |
| 362 | Ga0265320_10155254 | 3300031240 | Bacteria | 1032 |
| 363 | Ga0265325_10045108 | 3300031241 | Bacteria | 2292 |
| 364 | Ga0265331_10119764 | 3300031250 | Bacteria | 1204 |
| 365 | Ga0265327_10008558 | 3300031251 | Bacteria | 7594 |
| 366 | Ga0265327_10284809 | 3300031251 | Bacteria | 730 |
| 367 | Ga0316576_10098103 | 3300031727 | Bacteria | 2188 |
| 368 | Ga0307413_10147317 | 3300031824 | Bacteria | 1636 |
| 369 | Ga0307410_10648596 | 3300031852 | Bacteria | 885 |
| 370 | Ga0307410_11058586 | 3300031852 | Bacteria | 702 |
| 371 | Ga0307410_11307720 | 3300031852 | Bacteria | 634 |
| 372 | Ga0307406_12145234 | 3300031901 | Bacteria | 501 |
| 373 | Ga0307407_10327843 | 3300031903 | Bacteria | 1077 |
| 374 | Ga0307412_10273814 | 3300031911 | Bacteria | 1322 |
| 375 | Ga0307409_100095541 | 3300031995 | Bacteria | 2449 |
| 376 | Ga0307409_100438501 | 3300031995 | Bacteria | 1258 |
| 377 | Ga0307409_101045752 | 3300031995 | Bacteria | 836 |
| 378 | Ga0307409_102027496 | 3300031995 | Unclassified | 605 |
| 379 | Ga0307416_100082015 | 3300032002 | Bacteria | 2730 |
| 380 | Ga0307416_100437860 | 3300032002 | Bacteria | 1356 |
| 381 | Ga0307416_101277553 | 3300032002 | Bacteria | 840 |
| 382 | Ga0307411_10052797 | 3300032005 | Bacteria | 2660 |
| 383 | Ga0307411_11447217 | 3300032005 | Bacteria | 630 |
| 384 | Ga0307415_100064831 | 3300032126 | Bacteria | 2543 |
| 385 | Ga0307415_100689933 | 3300032126 | Bacteria | 920 |
| 386 | Ga0316596_1157851 | 3300033541 | Bacteria | 624 |
| 387 | Ga0373929_0081084 | 3300035085 | Unclassified | 791 |
| 388 | Ga0373943_0015929 | 3300035170 | Bacteria | 3422 |
| 389 | Ga0373943_0046463 | 3300035170 | Bacteria | 2119 |
| 390 | Ga0373943_0387769 | 3300035170 | Bacteria | 805 |
| 391 | Ga0373931_0968056 | 3300035691 | Bacteria | 575 |
| 392 | Ga0373935_0058765 | 3300035692 | Bacteria | 2457 |
| 393 | Ga0373935_0223762 | 3300035692 | Bacteria | 1308 |
| 394 | Ga0373933_0379390 | 3300035724 | Bacteria | 921 |
| 395 | Ga0373947_0022670 | 3300035725 | Bacteria | 3643 |
| 396 | Ga0373947_0567634 | 3300035725 | Bacteria | 773 |
| 397 | Ga0373937_0748140 | 3300036401 | Unclassified | 925 |
| 398 | Ga0316584_0306123 | 3300036712 | Bacteria | 1150 |
| 399 | Ga0316584_0537016 | 3300036712 | Unclassified | 818 |
| 400 | Ga0373925_0149551 | 3300037068 | Bacteria | 1833 |
| 401 | Ga0373925_0499243 | 3300037068 | Bacteria | 999 |
| 402 | Ga0395900_1777016 | 3300037418 | Bacteria | 527 |
| 403 | Ga0395898_0235185 | 3300037466 | Bacteria | 1747 |
| 404 | Ga0395898_0405918 | 3300037466 | Bacteria | 1299 |
| 405 | Ga0395905_0509410 | 3300037471 | Unclassified | 1104 |
| 406 | Ga0436364_0569107 | 3300037853 | Bacteria | 14260 |
| 407 | Ga0436364_0655107 | 3300037853 | Bacteria | 652 |
| 408 | Ga0436364_0880037 | 3300037853 | Bacteria | 536 |
| 409 | Ga0436364_1370940 | 3300037853 | Bacteria | 1399 |
| 410 | Ga0436364_1509934 | 3300037853 | Bacteria | 734 |
| 411 | Ga0395901_0030683 | 3300038443 | Bacteria | 5539 |
| 412 | Ga0395901_0078553 | 3300038443 | Bacteria | 3446 |
| 413 | Ga0395901_0983908 | 3300038443 | Bacteria | 820 |
| 414 | Ga0242419_007706 | 3300038698 | Bacteria | 797 |
| 415 | Ga0242420_040487 | 3300038996 | Bacteria | 889 |
| 416 | Ga0436365_0206254 | 3300039437 | Bacteria | 1132 |
| 417 | Ga0436365_1873661 | 3300039437 | Bacteria | 704 |
| 418 | Ga0436360_0295789 | 3300039438 | Bacteria | 8520 |
| 419 | Ga0436360_1305965 | 3300039438 | Bacteria | 1005 |
| 420 | Ga0436361_0951225 | 3300039447 | Bacteria | 873 |
| 421 | Ga0436361_0971748 | 3300039447 | Bacteria | 2799 |
| 422 | Ga0436363_1103378 | 3300039450 | Bacteria | 517 |
| 423 | Ga0436363_1360105 | 3300039450 | Bacteria | 1405 |
| 424 | Ga0436363_1525352 | 3300039450 | Bacteria | 871 |
| 425 | Ga0436362_0435610 | 3300039453 | Bacteria | 620 |
| 426 | Ga0436362_0555315 | 3300039453 | Bacteria | 995 |
| 427 | Ga0451833_0944410 | 3300041491 | Bacteria | 707 |
| 428 | Ga0451839_0700365 | 3300041496 | Bacteria | 1017 |
| 429 | Ga0439435_0157046 | 3300042436 | Unclassified | 733 |
| 430 | Ga0439460_0096683 | 3300042461 | Bacteria | 944 |
| 431 | Ga0466965_0914157 | 3300044683 | Bacteria | 512 |
| 432 | Ga0466966_0948802 | 3300044684 | Bacteria | 519 |
| 433 | Ga0466963_0033204 | 3300044694 | Bacteria | 3348 |
| 434 | Ga0466963_0107569 | 3300044694 | Bacteria | 1912 |
| 435 | Ga0466963_0688143 | 3300044694 | Bacteria | 722 |
| 436 | Ga0466964_0078019 | 3300044706 | Bacteria | 1415 |
| 437 | Ga0466957_0057232 | 3300044842 | Bacteria | 2386 |
| 438 | Ga0466957_0222677 | 3300044842 | Bacteria | 1246 |
| 439 | Ga0466957_0366291 | 3300044842 | Bacteria | 980 |
| 440 | Ga0466958_0273776 | 3300045836 | Bacteria | 1081 |
| 441 | Ga0466967_0052271 | 3300045976 | Bacteria | 3585 |
| 442 | Ga0466967_1598276 | 3300045976 | Unclassified | 649 |
| 443 | Ga0466967_1972804 | 3300045976 | Bacteria | 580 |
| 444 | Ga0495603_0112464 | 3300046455 | Bacteria | 1588 |
| 445 | Ga0495629_0384977 | 3300046459 | Bacteria | 954 |
| 446 | Ga0495641_0056549 | 3300046461 | Bacteria | 1778 |
| 447 | Ga0495651_0558096 | 3300046462 | Bacteria | 727 |
| 448 | Ga0495653_0520824 | 3300046463 | Bacteria | 739 |
| 449 | Ga0495664_0542511 | 3300046477 | Bacteria | 693 |
| 450 | Ga0495664_0661526 | 3300046477 | Bacteria | 619 |
| 451 | Ga0495585_0243690 | 3300046492 | Bacteria | 899 |
| 452 | Ga0495594_0457867 | 3300046499 | Bacteria | 725 |
| 453 | Ga0495596_0225152 | 3300046500 | Bacteria | 728 |
| 454 | Ga0495644_0218880 | 3300046523 | Bacteria | 736 |
| 455 | Ga0495663_0211714 | 3300046525 | Bacteria | 679 |
| 456 | Ga0495586_0212357 | 3300046535 | Bacteria | 1098 |
| 457 | Ga0495586_0612825 | 3300046535 | Bacteria | 629 |
| 458 | Ga0495656_0001446 | 3300046615 | Bacteria | 7763 |
| 459 | Ga0495656_0186515 | 3300046615 | Bacteria | 1022 |
| 460 | Ga0495634_0311431 | 3300046642 | Bacteria | 950 |
| 461 | Ga0495657_0097013 | 3300046675 | Bacteria | 1883 |
| 462 | Ga0495623_0424481 | 3300046679 | Bacteria | 712 |
| 463 | Ga0495647_0228224 | 3300046681 | Bacteria | 824 |
| 464 | Ga0495658_0172617 | 3300046683 | Bacteria | 1339 |
| 465 | Ga0495658_0264955 | 3300046683 | Bacteria | 1082 |
| 466 | Ga0495658_0402242 | 3300046683 | Unclassified | 873 |
| 467 | Ga0495669_0000113 | 3300046684 | Bacteria | 52780 |
| 468 | Ga0495613_0000041 | 3300046689 | Bacteria | 130784 |
| 469 | Ga0495613_0128764 | 3300046689 | Bacteria | 1813 |
| 470 | Ga0495624_0530851 | 3300046690 | Bacteria | 703 |
| 471 | Ga0495600_0004414 | 3300046809 | Bacteria | 8414 |
| 472 | Ga0495604_0000704 | 3300047317 | Bacteria | 28417 |
| 473 | Ga0495604_0006922 | 3300047317 | Bacteria | 8988 |
| 474 | Ga0495674_0043790 | 3300047319 | Bacteria | 3982 |
| 475 | Ga0495674_1044418 | 3300047319 | Bacteria | 624 |
| 476 | Ga0495676_0328376 | 3300047321 | Bacteria | 1026 |
| 477 | Ga0495676_0937537 | 3300047321 | Bacteria | 554 |
| 478 | Ga0495675_0474971 | 3300047444 | Bacteria | 721 |
| 479 | Ga0495684_0786521 | 3300047471 | Bacteria | 623 |
| 480 | Ga0495686_0237138 | 3300047472 | Bacteria | 1030 |
| 481 | Ga0495593_0136807 | 3300047673 | Bacteria | 1242 |
| 482 | Ga0495593_0475560 | 3300047673 | Bacteria | 626 |
| 483 | Ga0495602_0000007 | 3300048088 | Bacteria | 273212 |
| 484 | Ga0495602_0352041 | 3300048088 | Bacteria | 1063 |
| 485 | Ga0496100_0176236 | 3300048903 | Bacteria | 1544 |
| 486 | Ga0496100_0311329 | 3300048903 | Bacteria | 1181 |
| 487 | Ga0496100_0687234 | 3300048903 | Bacteria | 798 |
| 488 | Ga0496101_0289985 | 3300048904 | Bacteria | 1280 |
| 489 | Ga0496101_1142141 | 3300048904 | Bacteria | 611 |
| 490 | Ga0496101_1156448 | 3300048904 | Bacteria | 607 |
| 491 | Ga0496102_0713488 | 3300048905 | Bacteria | 926 |
| 492 | Ga0496102_0920690 | 3300048905 | Bacteria | 796 |
| 493 | Ga0496102_1349967 | 3300048905 | Bacteria | 632 |
| 494 | Ga0496104_0092499 | 3300048907 | Bacteria | 2892 |
| 495 | Ga0496104_0099694 | 3300048907 | Bacteria | 2781 |
| 496 | Ga0496104_0847004 | 3300048907 | Bacteria | 820 |
| 497 | Ga0496104_1517833 | 3300048907 | Bacteria | 573 |
| 498 | Ga0496105_0783182 | 3300048908 | Bacteria | 726 |
| 499 | Ga0496106_0274829 | 3300048909 | Bacteria | 1349 |
| 500 | Ga0496106_1070014 | 3300048909 | Bacteria | 633 |
| 501 | Ga0496106_1133595 | 3300048909 | Bacteria | 612 |
| 502 | Ga0496107_0034339 | 3300048910 | Bacteria | 3633 |
| 503 | Ga0496107_0372728 | 3300048910 | Bacteria | 1062 |
| 504 | Ga0496107_1225407 | 3300048910 | Bacteria | 539 |
| 505 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 506 | Ga0496109_0000009 | 3300048912 | Bacteria | 236561 |
| 507 | Ga0496109_0030582 | 3300048912 | Bacteria | 4827 |
| 508 | Ga0496109_0197332 | 3300048912 | Bacteria | 1892 |
| 509 | Ga0496109_0774926 | 3300048912 | Bacteria | 897 |
| 510 | Ga0496109_1392222 | 3300048912 | Bacteria | 637 |
| 511 | Ga0496110_0471689 | 3300048913 | Bacteria | 1143 |
| 512 | Ga0496110_0490250 | 3300048913 | Bacteria | 1119 |
| 513 | Ga0496110_1730996 | 3300048913 | Bacteria | 535 |
| 514 | Ga0496111_0060055 | 3300048914 | Bacteria | 2755 |
| 515 | Ga0496112_0325571 | 3300048915 | Bacteria | 1481 |
| 516 | Ga0496112_0357847 | 3300048915 | Bacteria | 1402 |
| 517 | Ga0496112_0458864 | 3300048915 | Bacteria | 1212 |
| 518 | Ga0496113_0021043 | 3300048916 | Bacteria | 4597 |
| 519 | Ga0496113_0188617 | 3300048916 | Bacteria | 1636 |
| 520 | Ga0496113_1192072 | 3300048916 | Bacteria | 595 |
| 521 | Ga0496114_0202385 | 3300048917 | Bacteria | 1739 |
| 522 | Ga0496115_0029166 | 3300048918 | Bacteria | 4332 |
| 523 | Ga0496117_0258385 | 3300048920 | Bacteria | 946 |
| 524 | Ga0496121_0175642 | 3300048924 | Bacteria | 1551 |
| 525 | Ga0496124_0230554 | 3300048927 | Bacteria | 1385 |
| 526 | Ga0496124_0838770 | 3300048927 | Bacteria | 565 |
| 527 | Ga0496125_0144539 | 3300048928 | Bacteria | 1647 |
| 528 | Ga0501291_080443 | 3300049514 | Bacteria | 648 |
| 529 | Ga0501297_017044 | 3300049520 | Bacteria | 882 |
| 530 | Ga0501299_019448 | 3300049522 | Bacteria | 1229 |
| 531 | Ga0501032_1077348 | 3300049569 | Bacteria | 504 |
| 532 | Ga0501034_0010352 | 3300049571 | Bacteria | 9718 |
| 533 | Ga0501036_0526928 | 3300049572 | Bacteria | 982 |
| 534 | Ga0501036_1383744 | 3300049572 | Unclassified | 571 |
| 535 | Ga0501037_0084228 | 3300049573 | Bacteria | 2303 |
| 536 | Ga0501039_0903335 | 3300049575 | Bacteria | 687 |
| 537 | Ga0501041_0039068 | 3300049577 | Bacteria | 2880 |
| 538 | Ga0501043_0191907 | 3300049579 | Bacteria | 1588 |
| 539 | Ga0501046_0189668 | 3300049580 | Bacteria | 1534 |
| 540 | Ga0501047_0019674 | 3300049581 | Bacteria | 6478 |
| 541 | Ga0501048_0310822 | 3300049582 | Bacteria | 1122 |
| 542 | Ga0501048_0515112 | 3300049582 | Bacteria | 858 |
| 543 | Ga0501067_0197742 | 3300049583 | Bacteria | 1120 |
| 544 | Ga0501067_0394728 | 3300049583 | Bacteria | 771 |
| 545 | Ga0501068_0161645 | 3300049584 | Bacteria | 1411 |
| 546 | Ga0501069_0320188 | 3300049585 | Bacteria | 911 |
| 547 | Ga0501069_0759488 | 3300049585 | Bacteria | 586 |
| 548 | Ga0501070_0006315 | 3300049586 | Bacteria | 10087 |
| 549 | Ga0501071_0102282 | 3300049587 | Bacteria | 2113 |
| 550 | Ga0501072_0650353 | 3300049588 | Bacteria | 830 |
| 551 | Ga0501072_1174719 | 3300049588 | Bacteria | 596 |
| 552 | Ga0501075_0673979 | 3300049591 | Bacteria | 788 |
| 553 | Ga0501076_0418869 | 3300049592 | Bacteria | 1102 |
| 554 | Ga0501077_0081447 | 3300049593 | Bacteria | 2051 |
| 555 | Ga0501227_164124 | 3300049665 | Bacteria | 619 |
| 556 | Ga0501233_288041 | 3300049668 | Bacteria | 504 |
| 557 | Ga0501079_0926165 | 3300049741 | Bacteria | 686 |
| 558 | Ga0501080_0121403 | 3300049742 | Bacteria | 2421 |
| 559 | Ga0501080_0702632 | 3300049742 | Bacteria | 892 |
| 560 | Ga0501081_0481455 | 3300049743 | Bacteria | 924 |
| 561 | Ga0501081_1301576 | 3300049743 | Bacteria | 551 |
| 562 | Ga0501035_1555114 | 3300049822 | Bacteria | 503 |
| 563 | Ga0501044_0377866 | 3300049823 | Bacteria | 1332 |
| 564 | Ga0501045_0126064 | 3300049824 | Bacteria | 1902 |
| 565 | Ga0501045_0363814 | 3300049824 | Bacteria | 1077 |
| 566 | Ga0501045_0820232 | 3300049824 | Bacteria | 685 |
| 567 | Ga0501204_020965 | 3300049850 | Bacteria | 853 |
| 568 | nmdc:mga03n38_307289_c1 | 3300050490 | Bacteria | 853 |
| 569 | nmdc:mga00v17_837303_c1 | 3300050491 | Bacteria | 585 |
| 570 | nmdc:mga0yw44_1010116_c1 | 3300050492 | Bacteria | 563 |
| 571 | nmdc:mga05p37_1059781_c1 | 3300050507 | Bacteria | 854 |
| 572 | nmdc:mga05p37_367756_c1 | 3300050507 | Unclassified | 1688 |
| 573 | nmdc:mga09592_248037_c1 | 3300050508 | Bacteria | 1543 |
| 574 | nmdc:mga0qj67_375646_c1 | 3300050509 | Bacteria | 1148 |
| 575 | nmdc:mga0n895_153555_c1 | 3300050512 | Bacteria | 2333 |
| 576 | nmdc:mga0n895_480950_c1 | 3300050512 | Bacteria | 1252 |
| 577 | nmdc:mga0n895_614288_c1 | 3300050512 | Bacteria | 1088 |
| 578 | nmdc:mga0n895_672732_c1 | 3300050512 | Bacteria | 1032 |
| 579 | nmdc:mga0rr50_1483212_c1 | 3300050513 | Unclassified | 573 |
| 580 | nmdc:mga0rr50_56289_c1 | 3300050513 | Bacteria | 2938 |
| 581 | nmdc:mga0rr50_62880_c1 | 3300050513 | Bacteria | 2802 |
| 582 | nmdc:mga0rr50_73910_c1 | 3300050513 | Unclassified | 2608 |
| 583 | nmdc:mga08x19_241348_c1 | 3300050514 | Bacteria | 1246 |
| 584 | nmdc:mga08x19_30223_c1 | 3300050514 | Bacteria | 3403 |
| 585 | nmdc:mga08x19_38787_c1 | 3300050514 | Bacteria | 3026 |
| 586 | nmdc:mga08x19_42481_c1 | 3300050514 | Bacteria | 2899 |
| 587 | nmdc:mga08x19_545412_c1 | 3300050514 | Bacteria | 820 |
| 588 | nmdc:mga0a205_132886_c1 | 3300050515 | Bacteria | 2389 |
| 589 | nmdc:mga0a205_7575_c1 | 3300050515 | Bacteria | 9837 |
| 590 | Ga0495612_0208146 | 3300053078 | Bacteria | 864 |
| 591 | Ga0495612_0297233 | 3300053078 | Unclassified | 724 |
| 592 | Ga0495595_0016448 | 3300053084 | Bacteria | 3165 |
| 593 | Ga0495595_0056441 | 3300053084 | Bacteria | 1830 |
| 594 | Ga0495619_0009341 | 3300053085 | Bacteria | 6190 |
| 595 | Ga0500616_0182173 | 3300053153 | Bacteria | 945 |
| 596 | Ga0501084_1651706 | 3300054114 | Bacteria | 535 |
| 597 | Ga0587066_221604 | 3300059490 | Bacteria | 507 |
| 598 | Ga0587109_150123 | 3300059624 | Bacteria | 575 |
| 599 | Ga0587128_050250 | 3300059630 | Bacteria | 759 |
| 600 | Ga0587079_033080 | 3300059647 | Bacteria | 1005 |
| 601 | Ga0587107_102056 | 3300059652 | Bacteria | 569 |
| 602 | Ga0587114_013716 | 3300059655 | Bacteria | 1047 |
| 603 | Ga0587111_0159589 | 3300060346 | Bacteria | 612 |
| 604 | Ga0466962_0218746 | 3300061719 | Bacteria | 933 |
| 605 | Ga0530510_0290668 | 3300061734 | Bacteria | 1222 |
| 606 | Ga0530510_0583561 | 3300061734 | Bacteria | 850 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003203 | JGI25406J46586_10068133 | JGI25406J46586_100681331 | 85 |
| 2 | 3300005329 | Ga0070683_101276346 | Ga0070683_1012763461 | 85 |
| 3 | 3300005330 | Ga0070690_101078506 | Ga0070690_1010785061 | 85 |
| 4 | 3300005331 | Ga0070670_101202171 | Ga0070670_1012021712 | 85 |
| 5 | 3300005337 | Ga0070682_100277708 | Ga0070682_1002777082 | 85 |
| 6 | 3300005337 | Ga0070682_100388772 | Ga0070682_1003887721 | 85 |
| 7 | 3300005338 | Ga0068868_100247312 | Ga0068868_1002473122 | 85 |
| 8 | 3300005338 | Ga0068868_101164155 | Ga0068868_1011641551 | 85 |
| 9 | 3300005338 | Ga0068868_102180316 | Ga0068868_1021803162 | 85 |
| 10 | 3300005345 | Ga0070692_10462039 | Ga0070692_104620392 | 85 |
| 11 | 3300005347 | Ga0070668_100375507 | Ga0070668_1003755072 | 85 |
| 12 | 3300005364 | Ga0070673_101818462 | Ga0070673_1018184621 | 85 |
| 13 | 3300005365 | Ga0070688_101062758 | Ga0070688_1010627581 | 85 |
| 14 | 3300005367 | Ga0070667_100721170 | Ga0070667_1007211702 | 85 |
| 15 | 3300005367 | Ga0070667_101870658 | Ga0070667_1018706581 | 85 |
| 16 | 3300005367 | Ga0070667_102173896 | Ga0070667_1021738961 | 85 |
| 17 | 3300005434 | Ga0070709_10302412 | Ga0070709_103024122 | 85 |
| 18 | 3300005436 | Ga0070713_101612968 | Ga0070713_1016129681 | 85 |
| 19 | 3300005436 | Ga0070713_102070899 | Ga0070713_1020708991 | 85 |
| 20 | 3300005437 | Ga0070710_10055018 | Ga0070710_100550182 | 85 |
| 21 | 3300005437 | Ga0070710_10990335 | Ga0070710_109903351 | 85 |
| 22 | 3300005439 | Ga0070711_100102559 | Ga0070711_1001025591 | 85 |
| 23 | 3300005444 | Ga0070694_100955108 | Ga0070694_1009551081 | 85 |
| 24 | 3300005445 | Ga0070708_100396353 | Ga0070708_1003963531 | 85 |
| 25 | 3300005445 | Ga0070708_101383269 | Ga0070708_1013832692 | 85 |
| 26 | 3300005456 | Ga0070678_100564606 | Ga0070678_1005646062 | 85 |
| 27 | 3300005458 | Ga0070681_10023478 | Ga0070681_100234782 | 85 |
| 28 | 3300005458 | Ga0070681_10431463 | Ga0070681_104314632 | 85 |
| 29 | 3300005466 | Ga0070685_10261075 | Ga0070685_102610752 | 85 |
| 30 | 3300005467 | Ga0070706_100076019 | Ga0070706_1000760194 | 85 |
| 31 | 3300005467 | Ga0070706_100205211 | Ga0070706_1002052112 | 85 |
| 32 | 3300005468 | Ga0070707_100127427 | Ga0070707_1001274273 | 85 |
| 33 | 3300005471 | Ga0070698_100151399 | Ga0070698_1001513992 | 85 |
| 34 | 3300005471 | Ga0070698_100474803 | Ga0070698_1004748033 | 85 |
| 35 | 3300005471 | Ga0070698_101139192 | Ga0070698_1011391921 | 85 |
| 36 | 3300005518 | Ga0070699_100107882 | Ga0070699_1001078824 | 85 |
| 37 | 3300005518 | Ga0070699_100730478 | Ga0070699_1007304781 | 85 |
| 38 | 3300005518 | Ga0070699_101104485 | Ga0070699_1011044851 | 85 |
| 39 | 3300005530 | Ga0070679_100405982 | Ga0070679_1004059822 | 85 |
| 40 | 3300005530 | Ga0070679_101894915 | Ga0070679_1018949151 | 85 |
| 41 | 3300005536 | Ga0070697_100076813 | Ga0070697_1000768131 | 85 |
| 42 | 3300005536 | Ga0070697_100156127 | Ga0070697_1001561272 | 85 |
| 43 | 3300005536 | Ga0070697_100679095 | Ga0070697_1006790952 | 85 |
| 44 | 3300005539 | Ga0068853_100794987 | Ga0068853_1007949871 | 85 |
| 45 | 3300005543 | Ga0070672_101065898 | Ga0070672_1010658981 | 85 |
| 46 | 3300005545 | Ga0070695_100226829 | Ga0070695_1002268292 | 85 |
| 47 | 3300005545 | Ga0070695_100896683 | Ga0070695_1008966831 | 85 |
| 48 | 3300005546 | Ga0070696_100656285 | Ga0070696_1006562851 | 85 |
| 49 | 3300005548 | Ga0070665_101194011 | Ga0070665_1011940111 | 85 |
| 50 | 3300005549 | Ga0070704_100016423 | Ga0070704_1000164233 | 85 |
| 51 | 3300005549 | Ga0070704_100866133 | Ga0070704_1008661332 | 85 |
| 52 | 3300005578 | Ga0068854_101436264 | Ga0068854_1014362642 | 85 |
| 53 | 3300005615 | Ga0070702_100288478 | Ga0070702_1002884782 | 85 |
| 54 | 3300005617 | Ga0068859_100640950 | Ga0068859_1006409503 | 85 |
| 55 | 3300005718 | Ga0068866_10481288 | Ga0068866_104812882 | 85 |
| 56 | 3300005840 | Ga0068870_10630906 | Ga0068870_106309061 | 85 |
| 57 | 3300005842 | Ga0068858_101129382 | Ga0068858_1011293821 | 85 |
| 58 | 3300005844 | Ga0068862_101192247 | Ga0068862_1011922472 | 85 |
| 59 | 3300005844 | Ga0068862_101774516 | Ga0068862_1017745161 | 85 |
| 60 | 3300005937 | Ga0081455_10148147 | Ga0081455_101481472 | 85 |
| 61 | 3300005937 | Ga0081455_10201992 | Ga0081455_102019922 | 85 |
| 62 | 3300005985 | Ga0081539_10009284 | Ga0081539_100092843 | 85 |
| 63 | 3300006163 | Ga0070715_10625405 | Ga0070715_106254051 | 85 |
| 64 | 3300006173 | Ga0070716_100499620 | Ga0070716_1004996202 | 85 |
| 65 | 3300006173 | Ga0070716_100717084 | Ga0070716_1007170842 | 85 |
| 66 | 3300006175 | Ga0070712_100176452 | Ga0070712_1001764522 | 85 |
| 67 | 3300006237 | Ga0097621_100554149 | Ga0097621_1005541492 | 85 |
| 68 | 3300006844 | Ga0075428_100027485 | Ga0075428_1000274854 | 85 |
| 69 | 3300006844 | Ga0075428_100330527 | Ga0075428_1003305272 | 85 |
| 70 | 3300006846 | Ga0075430_100036063 | Ga0075430_1000360632 | 85 |
| 71 | 3300006847 | Ga0075431_100008760 | Ga0075431_1000087608 | 85 |
| 72 | 3300006852 | Ga0075433_10012628 | Ga0075433_100126285 | 85 |
| 73 | 3300006871 | Ga0075434_100008137 | Ga0075434_1000081372 | 85 |
| 74 | 3300006880 | Ga0075429_100002108 | Ga0075429_10000210810 | 85 |
| 75 | 3300006880 | Ga0075429_100695665 | Ga0075429_1006956652 | 85 |
| 76 | 3300006881 | Ga0068865_100549299 | Ga0068865_1005492992 | 85 |
| 77 | 3300006881 | Ga0068865_100825046 | Ga0068865_1008250461 | 85 |
| 78 | 3300006914 | Ga0075436_100211207 | Ga0075436_1002112072 | 85 |
| 79 | 3300006931 | Ga0097620_100640977 | Ga0097620_1006409773 | 85 |
| 80 | 3300007076 | Ga0075435_100010534 | Ga0075435_1000105342 | 85 |
| 81 | 3300007076 | Ga0075435_100025259 | Ga0075435_1000252592 | 85 |
| 82 | 3300009094 | Ga0111539_10696624 | Ga0111539_106966242 | 85 |
| 83 | 3300009094 | Ga0111539_11023538 | Ga0111539_110235382 | 85 |
| 84 | 3300009098 | Ga0105245_10317863 | Ga0105245_103178632 | 85 |
| 85 | 3300009098 | Ga0105245_10801620 | Ga0105245_108016202 | 85 |
| 86 | 3300009098 | Ga0105245_11822737 | Ga0105245_118227371 | 85 |
| 87 | 3300009147 | Ga0114129_10418308 | Ga0114129_104183082 | 85 |
| 88 | 3300009147 | Ga0114129_11714529 | Ga0114129_117145291 | 85 |
| 89 | 3300009176 | Ga0105242_10664087 | Ga0105242_106640872 | 85 |
| 90 | 3300009176 | Ga0105242_11905771 | Ga0105242_119057712 | 85 |
| 91 | 3300009176 | Ga0105242_13005503 | Ga0105242_130055031 | 85 |
| 92 | 3300009177 | Ga0105248_13130913 | Ga0105248_131309131 | 85 |
| 93 | 3300009177 | Ga0105248_13434819 | Ga0105248_134348191 | 85 |
| 94 | 3300009545 | Ga0105237_10872536 | Ga0105237_108725362 | 85 |
| 95 | 3300009551 | Ga0105238_11566264 | Ga0105238_115662641 | 85 |
| 96 | 3300009551 | Ga0105238_11817152 | Ga0105238_118171521 | 85 |
| 97 | 3300009551 | Ga0105238_12029912 | Ga0105238_120299122 | 85 |
| 98 | 3300009551 | Ga0105238_12230505 | Ga0105238_122305051 | 85 |
| 99 | 3300009553 | Ga0105249_10712482 | Ga0105249_107124822 | 85 |
| 100 | 3300010375 | Ga0105239_12412216 | Ga0105239_124122162 | 85 |
| 101 | 3300013296 | Ga0157374_11090196 | Ga0157374_110901962 | 85 |
| 102 | 3300013296 | Ga0157374_11585707 | Ga0157374_115857071 | 85 |
| 103 | 3300013296 | Ga0157374_12283756 | Ga0157374_122837561 | 85 |
| 104 | 3300013297 | Ga0157378_10969379 | Ga0157378_109693792 | 85 |
| 105 | 3300013297 | Ga0157378_13170646 | Ga0157378_131706461 | 85 |
| 106 | 3300013306 | Ga0163162_10583164 | Ga0163162_105831641 | 85 |
| 107 | 3300013306 | Ga0163162_12199277 | Ga0163162_121992772 | 85 |
| 108 | 3300013306 | Ga0163162_12757277 | Ga0163162_127572771 | 85 |
| 109 | 3300013307 | Ga0157372_11063923 | Ga0157372_110639232 | 85 |
| 110 | 3300013308 | Ga0157375_11018221 | Ga0157375_110182211 | 85 |
| 111 | 3300013308 | Ga0157375_11576696 | Ga0157375_115766961 | 85 |
| 112 | 3300014325 | Ga0163163_12415470 | Ga0163163_124154701 | 85 |
| 113 | 3300014326 | Ga0157380_10452083 | Ga0157380_104520833 | 85 |
| 114 | 3300014326 | Ga0157380_10926813 | Ga0157380_109268131 | 85 |
| 115 | 3300014745 | Ga0157377_11240233 | Ga0157377_112402331 | 85 |
| 116 | 3300014968 | Ga0157379_11343470 | Ga0157379_113434702 | 85 |
| 117 | 3300014968 | Ga0157379_12308675 | Ga0157379_123086752 | 85 |
| 118 | 3300014969 | Ga0157376_11460886 | Ga0157376_114608862 | 85 |
| 119 | 3300014969 | Ga0157376_12372247 | Ga0157376_123722471 | 85 |
| 120 | 3300049593 | Ga0501077_0081447 | Ga0501077_0081447_1730_1993 | 85 |
| 121 | 3300049743 | Ga0501081_0481455 | Ga0501081_0481455_647_910 | 85 |
| 122 | 3300049824 | Ga0501045_0126064 | Ga0501045_0126064_1471_1734 | 85 |
| 123 | 3300061734 | Ga0530510_0290668 | Ga0530510_0290668_347_610 | 85 |
| 124 | 3300013105 | Ga0157369_12450237 | Ga0157369_124502372 | 87 |
| 125 | 3300025898 | Ga0207692_11091529 | Ga0207692_110915291 | 87 |
| 126 | 3300025906 | Ga0207699_10874655 | Ga0207699_108746551 | 87 |
| 127 | 3300031727 | Ga0316576_10098103 | Ga0316576_100981032 | 87 |
| 128 | 3300033541 | Ga0316596_1157851 | Ga0316596_11578511 | 87 |
| 129 | 3300035170 | Ga0373943_0015929 | Ga0373943_0015929_1671_1934 | 87 |
| 130 | 3300036712 | Ga0316584_0306123 | Ga0316584_0306123_114_377 | 87 |
| 131 | 3300041496 | Ga0451839_0700365 | Ga0451839_0700365_722_985 | 87 |
| 132 | 3300003203 | JGI25406J46586_10083903 | JGI25406J46586_100839032 | 88 |
| 133 | 3300005985 | Ga0081539_10000078 | Ga0081539_10000078110 | 88 |
| 134 | 3300026116 | Ga0207674_10107858 | Ga0207674_101078582 | 88 |
| 135 | 3300031824 | Ga0307413_10147317 | Ga0307413_101473171 | 88 |
| 136 | 3300031852 | Ga0307410_10648596 | Ga0307410_106485962 | 88 |
| 137 | 3300031852 | Ga0307410_11058586 | Ga0307410_110585862 | 88 |
| 138 | 3300031901 | Ga0307406_12145234 | Ga0307406_121452341 | 88 |
| 139 | 3300031903 | Ga0307407_10327843 | Ga0307407_103278432 | 88 |
| 140 | 3300031911 | Ga0307412_10273814 | Ga0307412_102738142 | 88 |
| 141 | 3300031995 | Ga0307409_100095541 | Ga0307409_1000955413 | 88 |
| 142 | 3300031995 | Ga0307409_100438501 | Ga0307409_1004385012 | 88 |
| 143 | 3300031995 | Ga0307409_102027496 | Ga0307409_1020274962 | 88 |
| 144 | 3300032002 | Ga0307416_100082015 | Ga0307416_1000820153 | 88 |
| 145 | 3300032002 | Ga0307416_100437860 | Ga0307416_1004378602 | 88 |
| 146 | 3300032002 | Ga0307416_101277553 | Ga0307416_1012775532 | 88 |
| 147 | 3300032005 | Ga0307411_10052797 | Ga0307411_100527974 | 88 |
| 148 | 3300032005 | Ga0307411_11447217 | Ga0307411_114472172 | 88 |
| 149 | 3300032126 | Ga0307415_100064831 | Ga0307415_1000648312 | 88 |
| 150 | 3300032126 | Ga0307415_100689933 | Ga0307415_1006899332 | 88 |
| 151 | 3300036712 | Ga0316584_0537016 | Ga0316584_0537016_46_312 | 88 |
| 152 | 3300048927 | Ga0496124_0838770 | Ga0496124_0838770_206_475 | 88 |
| 153 | 3300049514 | Ga0501291_080443 | Ga0501291_080443_189_455 | 88 |
| 154 | 3300049520 | Ga0501297_017044 | Ga0501297_017044_159_425 | 88 |
| 155 | 3300049522 | Ga0501299_019448 | Ga0501299_019448_466_732 | 88 |
| 156 | 3300049665 | Ga0501227_164124 | Ga0501227_164124_116_382 | 88 |
| 157 | 3300049668 | Ga0501233_288041 | Ga0501233_288041_200_466 | 88 |
| 158 | 3300049850 | Ga0501204_020965 | Ga0501204_020965_369_635 | 88 |
| 159 | 3300002074 | JGI24748J21848_1000245 | JGI24748J21848_10002452 | 89 |
| 160 | 3300002239 | JGI24034J26672_10000228 | JGI24034J26672_100002286 | 89 |
| 161 | 3300002244 | JGI24742J22300_10002179 | JGI24742J22300_100021792 | 89 |
| 162 | 3300002987 | JGI25159J45721_1043792 | JGI25159J45721_10437922 | 89 |
| 163 | 3300003187 | JGI25151J46595_10000335 | JGI25151J46595_1000033546 | 89 |
| 164 | 3300003215 | JGI25153J46596_10036352 | JGI25153J46596_100363522 | 89 |
| 165 | 3300003354 | JGI25160J50197_1013448 | JGI25160J50197_10134481 | 89 |
| 166 | 3300003579 | Ga0007429J51699_1051436 | Ga0007429J51699_10514361 | 89 |
| 167 | 3300004803 | Ga0058862_12812905 | Ga0058862_128129051 | 89 |
| 168 | 3300005262 | Ga0065165_1043725 | Ga0065165_10437252 | 89 |
| 169 | 3300005329 | Ga0070683_100077533 | Ga0070683_1000775332 | 89 |
| 170 | 3300005329 | Ga0070683_100696874 | Ga0070683_1006968743 | 89 |
| 171 | 3300005338 | Ga0068868_100135247 | Ga0068868_1001352473 | 89 |
| 172 | 3300005356 | Ga0070674_100000012 | Ga0070674_10000001258 | 89 |
| 173 | 3300005356 | Ga0070674_100354732 | Ga0070674_1003547322 | 89 |
| 174 | 3300005365 | Ga0070688_100000860 | Ga0070688_10000086011 | 89 |
| 175 | 3300005406 | Ga0070703_10001676 | Ga0070703_100016762 | 89 |
| 176 | 3300005435 | Ga0070714_100640646 | Ga0070714_1006406462 | 89 |
| 177 | 3300005435 | Ga0070714_101127546 | Ga0070714_1011275462 | 89 |
| 178 | 3300005436 | Ga0070713_100000010 | Ga0070713_10000001060 | 89 |
| 179 | 3300005436 | Ga0070713_100105340 | Ga0070713_1001053402 | 89 |
| 180 | 3300005436 | Ga0070713_100208016 | Ga0070713_1002080162 | 89 |
| 181 | 3300005436 | Ga0070713_101271984 | Ga0070713_1012719842 | 89 |
| 182 | 3300005440 | Ga0070705_100139831 | Ga0070705_1001398312 | 89 |
| 183 | 3300005440 | Ga0070705_101683561 | Ga0070705_1016835611 | 89 |
| 184 | 3300005445 | Ga0070708_100004731 | Ga0070708_1000047313 | 89 |
| 185 | 3300005445 | Ga0070708_100010345 | Ga0070708_1000103452 | 89 |
| 186 | 3300005445 | Ga0070708_101363358 | Ga0070708_1013633582 | 89 |
| 187 | 3300005457 | Ga0070662_100000002 | Ga0070662_100000002253 | 89 |
| 188 | 3300005458 | Ga0070681_10092805 | Ga0070681_100928052 | 89 |
| 189 | 3300005459 | Ga0068867_101868435 | Ga0068867_1018684351 | 89 |
| 190 | 3300005466 | Ga0070685_10001018 | Ga0070685_1000101811 | 89 |
| 191 | 3300005467 | Ga0070706_100000606 | Ga0070706_10000060639 | 89 |
| 192 | 3300005467 | Ga0070706_100000697 | Ga0070706_10000069715 | 89 |
| 193 | 3300005467 | Ga0070706_100162673 | Ga0070706_1001626732 | 89 |
| 194 | 3300005467 | Ga0070706_100177064 | Ga0070706_1001770642 | 89 |
| 195 | 3300005468 | Ga0070707_100008348 | Ga0070707_1000083482 | 89 |
| 196 | 3300005468 | Ga0070707_100011695 | Ga0070707_1000116952 | 89 |
| 197 | 3300005468 | Ga0070707_100021792 | Ga0070707_1000217924 | 89 |
| 198 | 3300005468 | Ga0070707_100375453 | Ga0070707_1003754532 | 89 |
| 199 | 3300005468 | Ga0070707_100749667 | Ga0070707_1007496672 | 89 |
| 200 | 3300005468 | Ga0070707_101696158 | Ga0070707_1016961581 | 89 |
| 201 | 3300005468 | Ga0070707_101911416 | Ga0070707_1019114161 | 89 |
| 202 | 3300005471 | Ga0070698_100003666 | Ga0070698_1000036662 | 89 |
| 203 | 3300005471 | Ga0070698_100352901 | Ga0070698_1003529012 | 89 |
| 204 | 3300005471 | Ga0070698_100941981 | Ga0070698_1009419812 | 89 |
| 205 | 3300005471 | Ga0070698_101062863 | Ga0070698_1010628632 | 89 |
| 206 | 3300005518 | Ga0070699_100000907 | Ga0070699_10000090723 | 89 |
| 207 | 3300005518 | Ga0070699_100001226 | Ga0070699_1000012262 | 89 |
| 208 | 3300005518 | Ga0070699_100029831 | Ga0070699_1000298313 | 89 |
| 209 | 3300005518 | Ga0070699_100277250 | Ga0070699_1002772502 | 89 |
| 210 | 3300005518 | Ga0070699_100423891 | Ga0070699_1004238912 | 89 |
| 211 | 3300005518 | Ga0070699_101025761 | Ga0070699_1010257612 | 89 |
| 212 | 3300005518 | Ga0070699_101451450 | Ga0070699_1014514501 | 89 |
| 213 | 3300005530 | Ga0070679_101137335 | Ga0070679_1011373352 | 89 |
| 214 | 3300005536 | Ga0070697_100000025 | Ga0070697_10000002554 | 89 |
| 215 | 3300005536 | Ga0070697_100001828 | Ga0070697_10000182817 | 89 |
| 216 | 3300005536 | Ga0070697_100004167 | Ga0070697_1000041672 | 89 |
| 217 | 3300005536 | Ga0070697_100007410 | Ga0070697_1000074108 | 89 |
| 218 | 3300005536 | Ga0070697_100017925 | Ga0070697_1000179254 | 89 |
| 219 | 3300005536 | Ga0070697_100099541 | Ga0070697_1000995412 | 89 |
| 220 | 3300005536 | Ga0070697_100179201 | Ga0070697_1001792012 | 89 |
| 221 | 3300005536 | Ga0070697_100353274 | Ga0070697_1003532742 | 89 |
| 222 | 3300005536 | Ga0070697_100579113 | Ga0070697_1005791132 | 89 |
| 223 | 3300005536 | Ga0070697_100760371 | Ga0070697_1007603712 | 89 |
| 224 | 3300005536 | Ga0070697_101304508 | Ga0070697_1013045082 | 89 |
| 225 | 3300005544 | Ga0070686_100749561 | Ga0070686_1007495612 | 89 |
| 226 | 3300005545 | Ga0070695_100625310 | Ga0070695_1006253102 | 89 |
| 227 | 3300005545 | Ga0070695_100700112 | Ga0070695_1007001121 | 89 |
| 228 | 3300005545 | Ga0070695_101744173 | Ga0070695_1017441731 | 89 |
| 229 | 3300005546 | Ga0070696_100188979 | Ga0070696_1001889792 | 89 |
| 230 | 3300005546 | Ga0070696_100628282 | Ga0070696_1006282821 | 89 |
| 231 | 3300005546 | Ga0070696_100966752 | Ga0070696_1009667521 | 89 |
| 232 | 3300005547 | Ga0070693_100003273 | Ga0070693_1000032733 | 89 |
| 233 | 3300005549 | Ga0070704_101438972 | Ga0070704_1014389722 | 89 |
| 234 | 3300005549 | Ga0070704_101552381 | Ga0070704_1015523811 | 89 |
| 235 | 3300005549 | Ga0070704_101710239 | Ga0070704_1017102392 | 89 |
| 236 | 3300005563 | Ga0068855_100032833 | Ga0068855_1000328336 | 89 |
| 237 | 3300005577 | Ga0068857_101264343 | Ga0068857_1012643432 | 89 |
| 238 | 3300005578 | Ga0068854_101818638 | Ga0068854_1018186382 | 89 |
| 239 | 3300005614 | Ga0068856_101175506 | Ga0068856_1011755061 | 89 |
| 240 | 3300005616 | Ga0068852_100160942 | Ga0068852_1001609423 | 89 |
| 241 | 3300005718 | Ga0068866_10000460 | Ga0068866_100004604 | 89 |
| 242 | 3300005718 | Ga0068866_11446976 | Ga0068866_114469761 | 89 |
| 243 | 3300005719 | Ga0068861_100866300 | Ga0068861_1008663002 | 89 |
| 244 | 3300005842 | Ga0068858_101842137 | Ga0068858_1018421371 | 89 |
| 245 | 3300005842 | Ga0068858_102266387 | Ga0068858_1022663872 | 89 |
| 246 | 3300005937 | Ga0081455_10035539 | Ga0081455_100355395 | 89 |
| 247 | 3300005937 | Ga0081455_10075713 | Ga0081455_100757134 | 89 |
| 248 | 3300005937 | Ga0081455_10143574 | Ga0081455_101435743 | 89 |
| 249 | 3300005937 | Ga0081455_10190393 | Ga0081455_101903933 | 89 |
| 250 | 3300005981 | Ga0081538_10000141 | Ga0081538_1000014142 | 89 |
| 251 | 3300005981 | Ga0081538_10048844 | Ga0081538_100488444 | 89 |
| 252 | 3300005981 | Ga0081538_10053005 | Ga0081538_100530053 | 89 |
| 253 | 3300006028 | Ga0070717_10000368 | Ga0070717_1000036822 | 89 |
| 254 | 3300006028 | Ga0070717_10238562 | Ga0070717_102385622 | 89 |
| 255 | 3300006028 | Ga0070717_10474277 | Ga0070717_104742771 | 89 |
| 256 | 3300006028 | Ga0070717_12106142 | Ga0070717_121061422 | 89 |
| 257 | 3300006048 | Ga0075363_100183933 | Ga0075363_1001839332 | 89 |
| 258 | 3300006048 | Ga0075363_100424893 | Ga0075363_1004248932 | 89 |
| 259 | 3300006163 | Ga0070715_10345475 | Ga0070715_103454751 | 89 |
| 260 | 3300006173 | Ga0070716_100278013 | Ga0070716_1002780132 | 89 |
| 261 | 3300006173 | Ga0070716_100411991 | Ga0070716_1004119912 | 89 |
| 262 | 3300006173 | Ga0070716_101457997 | Ga0070716_1014579971 | 89 |
| 263 | 3300006175 | Ga0070712_100295163 | Ga0070712_1002951632 | 89 |
| 264 | 3300006175 | Ga0070712_100782902 | Ga0070712_1007829022 | 89 |
| 265 | 3300006237 | Ga0097621_100551822 | Ga0097621_1005518222 | 89 |
| 266 | 3300006353 | Ga0075370_11038241 | Ga0075370_110382411 | 89 |
| 267 | 3300006358 | Ga0068871_101534530 | Ga0068871_1015345301 | 89 |
| 268 | 3300006844 | Ga0075428_100016707 | Ga0075428_1000167076 | 89 |
| 269 | 3300006846 | Ga0075430_100118082 | Ga0075430_1001180822 | 89 |
| 270 | 3300006847 | Ga0075431_100422763 | Ga0075431_1004227633 | 89 |
| 271 | 3300006852 | Ga0075433_10008217 | Ga0075433_100082173 | 89 |
| 272 | 3300006871 | Ga0075434_100092162 | Ga0075434_1000921621 | 89 |
| 273 | 3300006871 | Ga0075434_100986117 | Ga0075434_1009861171 | 89 |
| 274 | 3300006880 | Ga0075429_100044834 | Ga0075429_1000448345 | 89 |
| 275 | 3300006881 | Ga0068865_101103566 | Ga0068865_1011035662 | 89 |
| 276 | 3300006914 | Ga0075436_100478181 | Ga0075436_1004781812 | 89 |
| 277 | 3300007076 | Ga0075435_101375497 | Ga0075435_1013754972 | 89 |
| 278 | 3300007265 | Ga0099794_10076976 | Ga0099794_100769762 | 89 |
| 279 | 3300007265 | Ga0099794_10078534 | Ga0099794_100785342 | 89 |
| 280 | 3300007265 | Ga0099794_10232651 | Ga0099794_102326512 | 89 |
| 281 | 3300009093 | Ga0105240_12469473 | Ga0105240_124694731 | 89 |
| 282 | 3300009093 | Ga0105240_12498236 | Ga0105240_124982361 | 89 |
| 283 | 3300009094 | Ga0111539_10896175 | Ga0111539_108961751 | 89 |
| 284 | 3300009101 | Ga0105247_10433313 | Ga0105247_104333132 | 89 |
| 285 | 3300009147 | Ga0114129_10918290 | Ga0114129_109182902 | 89 |
| 286 | 3300009148 | Ga0105243_10200652 | Ga0105243_102006522 | 89 |
| 287 | 3300009148 | Ga0105243_10328460 | Ga0105243_103284602 | 89 |
| 288 | 3300009148 | Ga0105243_13015027 | Ga0105243_130150271 | 89 |
| 289 | 3300009174 | Ga0105241_11064549 | Ga0105241_110645492 | 89 |
| 290 | 3300009176 | Ga0105242_10066584 | Ga0105242_100665844 | 89 |
| 291 | 3300009176 | Ga0105242_11113140 | Ga0105242_111131402 | 89 |
| 292 | 3300009176 | Ga0105242_12599107 | Ga0105242_125991071 | 89 |
| 293 | 3300009177 | Ga0105248_10521005 | Ga0105248_105210052 | 89 |
| 294 | 3300009553 | Ga0105249_10035662 | Ga0105249_100356622 | 89 |
| 295 | 3300010159 | Ga0099796_10009902 | Ga0099796_100099022 | 89 |
| 296 | 3300010375 | Ga0105239_10865192 | Ga0105239_108651922 | 89 |
| 297 | 3300010375 | Ga0105239_13182732 | Ga0105239_131827322 | 89 |
| 298 | 3300012507 | Ga0157342_1083339 | Ga0157342_10833391 | 89 |
| 299 | 3300013104 | Ga0157370_10076189 | Ga0157370_100761892 | 89 |
| 300 | 3300013105 | Ga0157369_10577821 | Ga0157369_105778212 | 89 |
| 301 | 3300013296 | Ga0157374_12031578 | Ga0157374_120315781 | 89 |
| 302 | 3300013297 | Ga0157378_11063798 | Ga0157378_110637982 | 89 |
| 303 | 3300013306 | Ga0163162_11249490 | Ga0163162_112494902 | 89 |
| 304 | 3300013308 | Ga0157375_10472782 | Ga0157375_104727822 | 89 |
| 305 | 3300014325 | Ga0163163_11755949 | Ga0163163_117559492 | 89 |
| 306 | 3300014326 | Ga0157380_10417700 | Ga0157380_104177002 | 89 |
| 307 | 3300014968 | Ga0157379_10090236 | Ga0157379_100902362 | 89 |
| 308 | 3300017792 | Ga0163161_10578720 | Ga0163161_105787202 | 89 |
| 309 | 3300020069 | Ga0197907_10928300 | Ga0197907_109283001 | 89 |
| 310 | 3300020069 | Ga0197907_10961597 | Ga0197907_109615972 | 89 |
| 311 | 3300020070 | Ga0206356_10556947 | Ga0206356_105569472 | 89 |
| 312 | 3300020070 | Ga0206356_10923357 | Ga0206356_109233571 | 89 |
| 313 | 3300020076 | Ga0206355_1703326 | Ga0206355_17033261 | 89 |
| 314 | 3300020078 | Ga0206352_10134164 | Ga0206352_101341642 | 89 |
| 315 | 3300020078 | Ga0206352_11055209 | Ga0206352_110552092 | 89 |
| 316 | 3300020080 | Ga0206350_10782470 | Ga0206350_107824701 | 89 |
| 317 | 3300020081 | Ga0206354_10028481 | Ga0206354_100284811 | 89 |
| 318 | 3300020081 | Ga0206354_10261121 | Ga0206354_102611212 | 89 |
| 319 | 3300020082 | Ga0206353_10733172 | Ga0206353_107331721 | 89 |
| 320 | 3300020082 | Ga0206353_11913518 | Ga0206353_119135182 | 89 |
| 321 | 3300021361 | Ga0213872_10052478 | Ga0213872_100524782 | 89 |
| 322 | 3300021388 | Ga0213875_10015036 | Ga0213875_100150362 | 89 |
| 323 | 3300021388 | Ga0213875_10027132 | Ga0213875_100271322 | 89 |
| 324 | 3300021388 | Ga0213875_10334401 | Ga0213875_103344012 | 89 |
| 325 | 3300021388 | Ga0213875_10355905 | Ga0213875_103559051 | 89 |
| 326 | 3300021441 | Ga0213871_10008809 | Ga0213871_100088092 | 89 |
| 327 | 3300022467 | Ga0224712_10003013 | Ga0224712_100030133 | 89 |
| 328 | 3300022467 | Ga0224712_10194969 | Ga0224712_101949691 | 89 |
| 329 | 3300022467 | Ga0224712_10340242 | Ga0224712_103402421 | 89 |
| 330 | 3300022467 | Ga0224712_10532763 | Ga0224712_105327632 | 89 |
| 331 | 3300025284 | Ga0209130_1007500 | Ga0209130_10075003 | 89 |
| 332 | 3300025294 | Ga0209025_1000179 | Ga0209025_1000179100 | 89 |
| 333 | 3300025297 | Ga0209758_1002708 | Ga0209758_10027082 | 89 |
| 334 | 3300025302 | Ga0207426_1000191 | Ga0207426_1000191121 | 89 |
| 335 | 3300025885 | Ga0207653_10005689 | Ga0207653_100056894 | 89 |
| 336 | 3300025893 | Ga0207682_10000091 | Ga0207682_1000009126 | 89 |
| 337 | 3300025899 | Ga0207642_10000275 | Ga0207642_1000027514 | 89 |
| 338 | 3300025899 | Ga0207642_10268251 | Ga0207642_102682511 | 89 |
| 339 | 3300025904 | Ga0207647_10527386 | Ga0207647_105273862 | 89 |
| 340 | 3300025910 | Ga0207684_10000014 | Ga0207684_10000014165 | 89 |
| 341 | 3300025910 | Ga0207684_10000027 | Ga0207684_10000027299 | 89 |
| 342 | 3300025910 | Ga0207684_10152163 | Ga0207684_101521632 | 89 |
| 343 | 3300025910 | Ga0207684_10171476 | Ga0207684_101714762 | 89 |
| 344 | 3300025910 | Ga0207684_10273662 | Ga0207684_102736622 | 89 |
| 345 | 3300025910 | Ga0207684_11297081 | Ga0207684_112970811 | 89 |
| 346 | 3300025911 | Ga0207654_11229480 | Ga0207654_112294801 | 89 |
| 347 | 3300025912 | Ga0207707_10434644 | Ga0207707_104346442 | 89 |
| 348 | 3300025916 | Ga0207663_11320352 | Ga0207663_113203521 | 89 |
| 349 | 3300025916 | Ga0207663_11622702 | Ga0207663_116227021 | 89 |
| 350 | 3300025917 | Ga0207660_10418690 | Ga0207660_104186902 | 89 |
| 351 | 3300025920 | Ga0207649_10000127 | Ga0207649_1000012730 | 89 |
| 352 | 3300025921 | Ga0207652_10660557 | Ga0207652_106605572 | 89 |
| 353 | 3300025922 | Ga0207646_10005694 | Ga0207646_100056944 | 89 |
| 354 | 3300025922 | Ga0207646_10040687 | Ga0207646_100406872 | 89 |
| 355 | 3300025922 | Ga0207646_10115916 | Ga0207646_101159162 | 89 |
| 356 | 3300025922 | Ga0207646_10486774 | Ga0207646_104867742 | 89 |
| 357 | 3300025922 | Ga0207646_10760385 | Ga0207646_107603852 | 89 |
| 358 | 3300025927 | Ga0207687_10195706 | Ga0207687_101957062 | 89 |
| 359 | 3300025928 | Ga0207700_10000007 | Ga0207700_10000007261 | 89 |
| 360 | 3300025928 | Ga0207700_10358341 | Ga0207700_103583412 | 89 |
| 361 | 3300025928 | Ga0207700_10490166 | Ga0207700_104901662 | 89 |
| 362 | 3300025928 | Ga0207700_10895682 | Ga0207700_108956822 | 89 |
| 363 | 3300025929 | Ga0207664_10137588 | Ga0207664_101375882 | 89 |
| 364 | 3300025929 | Ga0207664_10395288 | Ga0207664_103952882 | 89 |
| 365 | 3300025929 | Ga0207664_10457703 | Ga0207664_104577032 | 89 |
| 366 | 3300025929 | Ga0207664_10994015 | Ga0207664_109940152 | 89 |
| 367 | 3300025933 | Ga0207706_10000001 | Ga0207706_10000001434 | 89 |
| 368 | 3300025934 | Ga0207686_10085344 | Ga0207686_100853443 | 89 |
| 369 | 3300025935 | Ga0207709_10449005 | Ga0207709_104490052 | 89 |
| 370 | 3300025935 | Ga0207709_10758580 | Ga0207709_107585802 | 89 |
| 371 | 3300025937 | Ga0207669_10000017 | Ga0207669_1000001743 | 89 |
| 372 | 3300025937 | Ga0207669_11078839 | Ga0207669_110788392 | 89 |
| 373 | 3300025939 | Ga0207665_10477905 | Ga0207665_104779052 | 89 |
| 374 | 3300025939 | Ga0207665_10510797 | Ga0207665_105107972 | 89 |
| 375 | 3300025944 | Ga0207661_10236297 | Ga0207661_102362972 | 89 |
| 376 | 3300025949 | Ga0207667_10256850 | Ga0207667_102568502 | 89 |
| 377 | 3300025949 | Ga0207667_10584167 | Ga0207667_105841672 | 89 |
| 378 | 3300025961 | Ga0207712_10850918 | Ga0207712_108509182 | 89 |
| 379 | 3300025972 | Ga0207668_11149948 | Ga0207668_111499482 | 89 |
| 380 | 3300025981 | Ga0207640_11407553 | Ga0207640_114075532 | 89 |
| 381 | 3300026023 | Ga0207677_10000284 | Ga0207677_1000028427 | 89 |
| 382 | 3300026075 | Ga0207708_10339341 | Ga0207708_103393412 | 89 |
| 383 | 3300026078 | Ga0207702_10379083 | Ga0207702_103790832 | 89 |
| 384 | 3300026089 | Ga0207648_10792678 | Ga0207648_107926782 | 89 |
| 385 | 3300026142 | Ga0207698_10067576 | Ga0207698_100675764 | 89 |
| 386 | 3300026142 | Ga0207698_11386403 | Ga0207698_113864032 | 89 |
| 387 | 3300028558 | Ga0265326_10106596 | Ga0265326_101065961 | 89 |
| 388 | 3300028563 | Ga0265319_1000317 | Ga0265319_100031715 | 89 |
| 389 | 3300028800 | Ga0265338_10007586 | Ga0265338_100075866 | 89 |
| 390 | 3300029957 | Ga0265324_10099004 | Ga0265324_100990042 | 89 |
| 391 | 3300030863 | Ga0265766_1006649 | Ga0265766_10066491 | 89 |
| 392 | 3300030863 | Ga0265766_1012905 | Ga0265766_10129052 | 89 |
| 393 | 3300030882 | Ga0265764_117031 | Ga0265764_1170311 | 89 |
| 394 | 3300030889 | Ga0265761_107232 | Ga0265761_1072322 | 89 |
| 395 | 3300031240 | Ga0265320_10155254 | Ga0265320_101552542 | 89 |
| 396 | 3300031241 | Ga0265325_10045108 | Ga0265325_100451082 | 89 |
| 397 | 3300031250 | Ga0265331_10119764 | Ga0265331_101197641 | 89 |
| 398 | 3300031251 | Ga0265327_10008558 | Ga0265327_100085582 | 89 |
| 399 | 3300031251 | Ga0265327_10284809 | Ga0265327_102848092 | 89 |
| 400 | 3300031852 | Ga0307410_11307720 | Ga0307410_113077202 | 89 |
| 401 | 3300031995 | Ga0307409_101045752 | Ga0307409_1010457521 | 89 |
| 402 | 3300035085 | Ga0373929_0081084 | Ga0373929_0081084_206_475 | 89 |
| 403 | 3300035170 | Ga0373943_0046463 | Ga0373943_0046463_438_707 | 89 |
| 404 | 3300035170 | Ga0373943_0387769 | Ga0373943_0387769_183_452 | 89 |
| 405 | 3300035691 | Ga0373931_0968056 | Ga0373931_0968056_238_507 | 89 |
| 406 | 3300035692 | Ga0373935_0058765 | Ga0373935_0058765_596_865 | 89 |
| 407 | 3300035692 | Ga0373935_0223762 | Ga0373935_0223762_687_956 | 89 |
| 408 | 3300035724 | Ga0373933_0379390 | Ga0373933_0379390_60_329 | 89 |
| 409 | 3300035725 | Ga0373947_0022670 | Ga0373947_0022670_1229_1498 | 89 |
| 410 | 3300035725 | Ga0373947_0567634 | Ga0373947_0567634_118_387 | 89 |
| 411 | 3300036401 | Ga0373937_0748140 | Ga0373937_0748140_569_838 | 89 |
| 412 | 3300037068 | Ga0373925_0149551 | Ga0373925_0149551_1527_1796 | 89 |
| 413 | 3300037068 | Ga0373925_0499243 | Ga0373925_0499243_146_415 | 89 |
| 414 | 3300037418 | Ga0395900_1777016 | Ga0395900_1777016_197_466 | 89 |
| 415 | 3300037466 | Ga0395898_0235185 | Ga0395898_0235185_1363_1632 | 89 |
| 416 | 3300037466 | Ga0395898_0405918 | Ga0395898_0405918_107_376 | 89 |
| 417 | 3300037471 | Ga0395905_0509410 | Ga0395905_0509410_176_445 | 89 |
| 418 | 3300037853 | Ga0436364_0569107 | Ga0436364_0569107_3532_3813 | 89 |
| 419 | 3300037853 | Ga0436364_0655107 | Ga0436364_0655107_280_549 | 89 |
| 420 | 3300037853 | Ga0436364_0880037 | Ga0436364_0880037_255_524 | 89 |
| 421 | 3300037853 | Ga0436364_1370940 | Ga0436364_1370940_900_1169 | 89 |
| 422 | 3300037853 | Ga0436364_1509934 | Ga0436364_1509934_287_556 | 89 |
| 423 | 3300038443 | Ga0395901_0030683 | Ga0395901_0030683_3474_3743 | 89 |
| 424 | 3300038443 | Ga0395901_0078553 | Ga0395901_0078553_2831_3100 | 89 |
| 425 | 3300038443 | Ga0395901_0983908 | Ga0395901_0983908_309_578 | 89 |
| 426 | 3300038698 | Ga0242419_007706 | Ga0242419_007706_438_713 | 89 |
| 427 | 3300038996 | Ga0242420_040487 | Ga0242420_040487_114_383 | 89 |
| 428 | 3300039437 | Ga0436365_0206254 | Ga0436365_0206254_226_495 | 89 |
| 429 | 3300039437 | Ga0436365_1873661 | Ga0436365_1873661_122_391 | 89 |
| 430 | 3300039438 | Ga0436360_0295789 | Ga0436360_0295789_1310_1579 | 89 |
| 431 | 3300039438 | Ga0436360_1305965 | Ga0436360_1305965_120_389 | 89 |
| 432 | 3300039447 | Ga0436361_0951225 | Ga0436361_0951225_160_429 | 89 |
| 433 | 3300039447 | Ga0436361_0971748 | Ga0436361_0971748_1602_1871 | 89 |
| 434 | 3300039450 | Ga0436363_1103378 | Ga0436363_1103378_124_393 | 89 |
| 435 | 3300039450 | Ga0436363_1360105 | Ga0436363_1360105_791_1060 | 89 |
| 436 | 3300039450 | Ga0436363_1525352 | Ga0436363_1525352_26_295 | 89 |
| 437 | 3300039453 | Ga0436362_0435610 | Ga0436362_0435610_153_422 | 89 |
| 438 | 3300039453 | Ga0436362_0555315 | Ga0436362_0555315_324_593 | 89 |
| 439 | 3300041491 | Ga0451833_0944410 | Ga0451833_0944410_83_361 | 89 |
| 440 | 3300042436 | Ga0439435_0157046 | Ga0439435_0157046_246_515 | 89 |
| 441 | 3300042461 | Ga0439460_0096683 | Ga0439460_0096683_128_397 | 89 |
| 442 | 3300044683 | Ga0466965_0914157 | Ga0466965_0914157_159_428 | 89 |
| 443 | 3300044684 | Ga0466966_0948802 | Ga0466966_0948802_35_304 | 89 |
| 444 | 3300044694 | Ga0466963_0033204 | Ga0466963_0033204_3029_3298 | 89 |
| 445 | 3300044694 | Ga0466963_0107569 | Ga0466963_0107569_1132_1401 | 89 |
| 446 | 3300044694 | Ga0466963_0688143 | Ga0466963_0688143_13_282 | 89 |
| 447 | 3300044706 | Ga0466964_0078019 | Ga0466964_0078019_1084_1353 | 89 |
| 448 | 3300044842 | Ga0466957_0057232 | Ga0466957_0057232_338_607 | 89 |
| 449 | 3300044842 | Ga0466957_0222677 | Ga0466957_0222677_86_355 | 89 |
| 450 | 3300044842 | Ga0466957_0366291 | Ga0466957_0366291_445_714 | 89 |
| 451 | 3300045836 | Ga0466958_0273776 | Ga0466958_0273776_330_599 | 89 |
| 452 | 3300045976 | Ga0466967_0052271 | Ga0466967_0052271_1865_2134 | 89 |
| 453 | 3300045976 | Ga0466967_1598276 | Ga0466967_1598276_288_557 | 89 |
| 454 | 3300045976 | Ga0466967_1972804 | Ga0466967_1972804_59_328 | 89 |
| 455 | 3300046455 | Ga0495603_0112464 | Ga0495603_0112464_191_460 | 89 |
| 456 | 3300046459 | Ga0495629_0384977 | Ga0495629_0384977_645_914 | 89 |
| 457 | 3300046461 | Ga0495641_0056549 | Ga0495641_0056549_356_625 | 89 |
| 458 | 3300046462 | Ga0495651_0558096 | Ga0495651_0558096_68_337 | 89 |
| 459 | 3300046463 | Ga0495653_0520824 | Ga0495653_0520824_390_659 | 89 |
| 460 | 3300046477 | Ga0495664_0542511 | Ga0495664_0542511_111_380 | 89 |
| 461 | 3300046477 | Ga0495664_0661526 | Ga0495664_0661526_18_290 | 89 |
| 462 | 3300046492 | Ga0495585_0243690 | Ga0495585_0243690_354_623 | 89 |
| 463 | 3300046499 | Ga0495594_0457867 | Ga0495594_0457867_282_551 | 89 |
| 464 | 3300046500 | Ga0495596_0225152 | Ga0495596_0225152_176_445 | 89 |
| 465 | 3300046523 | Ga0495644_0218880 | Ga0495644_0218880_435_704 | 89 |
| 466 | 3300046525 | Ga0495663_0211714 | Ga0495663_0211714_245_514 | 89 |
| 467 | 3300046535 | Ga0495586_0212357 | Ga0495586_0212357_126_395 | 89 |
| 468 | 3300046535 | Ga0495586_0612825 | Ga0495586_0612825_320_589 | 89 |
| 469 | 3300046615 | Ga0495656_0001446 | Ga0495656_0001446_5905_6174 | 89 |
| 470 | 3300046615 | Ga0495656_0186515 | Ga0495656_0186515_637_906 | 89 |
| 471 | 3300046642 | Ga0495634_0311431 | Ga0495634_0311431_206_475 | 89 |
| 472 | 3300046675 | Ga0495657_0097013 | Ga0495657_0097013_100_369 | 89 |
| 473 | 3300046679 | Ga0495623_0424481 | Ga0495623_0424481_347_616 | 89 |
| 474 | 3300046681 | Ga0495647_0228224 | Ga0495647_0228224_452_721 | 89 |
| 475 | 3300046683 | Ga0495658_0172617 | Ga0495658_0172617_653_922 | 89 |
| 476 | 3300046683 | Ga0495658_0264955 | Ga0495658_0264955_315_584 | 89 |
| 477 | 3300046683 | Ga0495658_0402242 | Ga0495658_0402242_206_475 | 89 |
| 478 | 3300046684 | Ga0495669_0000113 | Ga0495669_0000113_1054_1323 | 89 |
| 479 | 3300046689 | Ga0495613_0000041 | Ga0495613_0000041_94036_94305 | 89 |
| 480 | 3300046689 | Ga0495613_0128764 | Ga0495613_0128764_372_641 | 89 |
| 481 | 3300046690 | Ga0495624_0530851 | Ga0495624_0530851_332_601 | 89 |
| 482 | 3300046809 | Ga0495600_0004414 | Ga0495600_0004414_257_526 | 89 |
| 483 | 3300047317 | Ga0495604_0000704 | Ga0495604_0000704_6127_6396 | 89 |
| 484 | 3300047317 | Ga0495604_0006922 | Ga0495604_0006922_965_1234 | 89 |
| 485 | 3300047319 | Ga0495674_0043790 | Ga0495674_0043790_2454_2723 | 89 |
| 486 | 3300047319 | Ga0495674_1044418 | Ga0495674_1044418_241_510 | 89 |
| 487 | 3300047321 | Ga0495676_0328376 | Ga0495676_0328376_222_491 | 89 |
| 488 | 3300047321 | Ga0495676_0937537 | Ga0495676_0937537_96_365 | 89 |
| 489 | 3300047444 | Ga0495675_0474971 | Ga0495675_0474971_33_302 | 89 |
| 490 | 3300047471 | Ga0495684_0786521 | Ga0495684_0786521_286_555 | 89 |
| 491 | 3300047472 | Ga0495686_0237138 | Ga0495686_0237138_115_384 | 89 |
| 492 | 3300047673 | Ga0495593_0136807 | Ga0495593_0136807_494_763 | 89 |
| 493 | 3300047673 | Ga0495593_0475560 | Ga0495593_0475560_307_576 | 89 |
| 494 | 3300048088 | Ga0495602_0000007 | Ga0495602_0000007_178002_178271 | 89 |
| 495 | 3300048088 | Ga0495602_0352041 | Ga0495602_0352041_427_696 | 89 |
| 496 | 3300048903 | Ga0496100_0176236 | Ga0496100_0176236_456_731 | 89 |
| 497 | 3300048903 | Ga0496100_0311329 | Ga0496100_0311329_262_531 | 89 |
| 498 | 3300048903 | Ga0496100_0687234 | Ga0496100_0687234_417_686 | 89 |
| 499 | 3300048904 | Ga0496101_0289985 | Ga0496101_0289985_577_852 | 89 |
| 500 | 3300048904 | Ga0496101_1142141 | Ga0496101_1142141_200_472 | 89 |
| 501 | 3300048904 | Ga0496101_1156448 | Ga0496101_1156448_255_524 | 89 |
| 502 | 3300048905 | Ga0496102_0713488 | Ga0496102_0713488_398_667 | 89 |
| 503 | 3300048905 | Ga0496102_0920690 | Ga0496102_0920690_56_325 | 89 |
| 504 | 3300048905 | Ga0496102_1349967 | Ga0496102_1349967_347_616 | 89 |
| 505 | 3300048907 | Ga0496104_0092499 | Ga0496104_0092499_581_850 | 89 |
| 506 | 3300048907 | Ga0496104_0099694 | Ga0496104_0099694_1843_2112 | 89 |
| 507 | 3300048907 | Ga0496104_0847004 | Ga0496104_0847004_175_444 | 89 |
| 508 | 3300048907 | Ga0496104_1517833 | Ga0496104_1517833_54_323 | 89 |
| 509 | 3300048908 | Ga0496105_0783182 | Ga0496105_0783182_387_656 | 89 |
| 510 | 3300048909 | Ga0496106_0274829 | Ga0496106_0274829_772_1041 | 89 |
| 511 | 3300048909 | Ga0496106_1070014 | Ga0496106_1070014_217_486 | 89 |
| 512 | 3300048909 | Ga0496106_1133595 | Ga0496106_1133595_193_462 | 89 |
| 513 | 3300048910 | Ga0496107_0034339 | Ga0496107_0034339_2464_2733 | 89 |
| 514 | 3300048910 | Ga0496107_0372728 | Ga0496107_0372728_217_492 | 89 |
| 515 | 3300048910 | Ga0496107_1225407 | Ga0496107_1225407_184_453 | 89 |
| 516 | 3300048911 | Ga0496108_0000006 | Ga0496108_0000006_317000_317269 | 89 |
| 517 | 3300048912 | Ga0496109_0000009 | Ga0496109_0000009_84088_84357 | 89 |
| 518 | 3300048912 | Ga0496109_0030582 | Ga0496109_0030582_3239_3508 | 89 |
| 519 | 3300048912 | Ga0496109_0197332 | Ga0496109_0197332_928_1197 | 89 |
| 520 | 3300048912 | Ga0496109_0774926 | Ga0496109_0774926_529_798 | 89 |
| 521 | 3300048912 | Ga0496109_1392222 | Ga0496109_1392222_96_365 | 89 |
| 522 | 3300048913 | Ga0496110_0471689 | Ga0496110_0471689_53_322 | 89 |
| 523 | 3300048913 | Ga0496110_0490250 | Ga0496110_0490250_639_914 | 89 |
| 524 | 3300048913 | Ga0496110_1730996 | Ga0496110_1730996_253_522 | 89 |
| 525 | 3300048914 | Ga0496111_0060055 | Ga0496111_0060055_204_473 | 89 |
| 526 | 3300048915 | Ga0496112_0325571 | Ga0496112_0325571_252_521 | 89 |
| 527 | 3300048915 | Ga0496112_0357847 | Ga0496112_0357847_280_549 | 89 |
| 528 | 3300048915 | Ga0496112_0458864 | Ga0496112_0458864_669_938 | 89 |
| 529 | 3300048916 | Ga0496113_0021043 | Ga0496113_0021043_1337_1606 | 89 |
| 530 | 3300048916 | Ga0496113_0188617 | Ga0496113_0188617_867_1136 | 89 |
| 531 | 3300048916 | Ga0496113_1192072 | Ga0496113_1192072_67_336 | 89 |
| 532 | 3300048917 | Ga0496114_0202385 | Ga0496114_0202385_1380_1655 | 89 |
| 533 | 3300048918 | Ga0496115_0029166 | Ga0496115_0029166_3044_3313 | 89 |
| 534 | 3300048920 | Ga0496117_0258385 | Ga0496117_0258385_358_627 | 89 |
| 535 | 3300048924 | Ga0496121_0175642 | Ga0496121_0175642_1097_1366 | 89 |
| 536 | 3300048927 | Ga0496124_0230554 | Ga0496124_0230554_1059_1328 | 89 |
| 537 | 3300048928 | Ga0496125_0144539 | Ga0496125_0144539_238_507 | 89 |
| 538 | 3300049569 | Ga0501032_1077348 | Ga0501032_1077348_101_373 | 89 |
| 539 | 3300049571 | Ga0501034_0010352 | Ga0501034_0010352_5638_5910 | 89 |
| 540 | 3300049572 | Ga0501036_0526928 | Ga0501036_0526928_588_860 | 89 |
| 541 | 3300049572 | Ga0501036_1383744 | Ga0501036_1383744_70_354 | 89 |
| 542 | 3300049573 | Ga0501037_0084228 | Ga0501037_0084228_1386_1658 | 89 |
| 543 | 3300049575 | Ga0501039_0903335 | Ga0501039_0903335_111_383 | 89 |
| 544 | 3300049577 | Ga0501041_0039068 | Ga0501041_0039068_1923_2207 | 89 |
| 545 | 3300049579 | Ga0501043_0191907 | Ga0501043_0191907_863_1135 | 89 |
| 546 | 3300049580 | Ga0501046_0189668 | Ga0501046_0189668_1148_1420 | 89 |
| 547 | 3300049581 | Ga0501047_0019674 | Ga0501047_0019674_202_474 | 89 |
| 548 | 3300049582 | Ga0501048_0310822 | Ga0501048_0310822_492_764 | 89 |
| 549 | 3300049582 | Ga0501048_0515112 | Ga0501048_0515112_549_833 | 89 |
| 550 | 3300049583 | Ga0501067_0197742 | Ga0501067_0197742_305_577 | 89 |
| 551 | 3300049583 | Ga0501067_0394728 | Ga0501067_0394728_438_707 | 89 |
| 552 | 3300049584 | Ga0501068_0161645 | Ga0501068_0161645_598_867 | 89 |
| 553 | 3300049585 | Ga0501069_0320188 | Ga0501069_0320188_512_781 | 89 |
| 554 | 3300049585 | Ga0501069_0759488 | Ga0501069_0759488_16_285 | 89 |
| 555 | 3300049586 | Ga0501070_0006315 | Ga0501070_0006315_546_818 | 89 |
| 556 | 3300049587 | Ga0501071_0102282 | Ga0501071_0102282_898_1182 | 89 |
| 557 | 3300049588 | Ga0501072_0650353 | Ga0501072_0650353_267_539 | 89 |
| 558 | 3300049588 | Ga0501072_1174719 | Ga0501072_1174719_252_536 | 89 |
| 559 | 3300049591 | Ga0501075_0673979 | Ga0501075_0673979_331_615 | 89 |
| 560 | 3300049592 | Ga0501076_0418869 | Ga0501076_0418869_50_334 | 89 |
| 561 | 3300049741 | Ga0501079_0926165 | Ga0501079_0926165_204_473 | 89 |
| 562 | 3300049742 | Ga0501080_0121403 | Ga0501080_0121403_1020_1292 | 89 |
| 563 | 3300049742 | Ga0501080_0702632 | Ga0501080_0702632_192_476 | 89 |
| 564 | 3300049743 | Ga0501081_1301576 | Ga0501081_1301576_227_511 | 89 |
| 565 | 3300049822 | Ga0501035_1555114 | Ga0501035_1555114_16_300 | 89 |
| 566 | 3300049823 | Ga0501044_0377866 | Ga0501044_0377866_189_461 | 89 |
| 567 | 3300049824 | Ga0501045_0363814 | Ga0501045_0363814_476_745 | 89 |
| 568 | 3300049824 | Ga0501045_0820232 | Ga0501045_0820232_70_354 | 89 |
| 569 | 3300050490 | nmdc:mga03n38_307289_c1 | nmdc:mga03n38_307289_c1_474_743 | 89 |
| 570 | 3300050491 | nmdc:mga00v17_837303_c1 | nmdc:mga00v17_837303_c1_91_360 | 89 |
| 571 | 3300050492 | nmdc:mga0yw44_1010116_c1 | nmdc:mga0yw44_1010116_c1_179_448 | 89 |
| 572 | 3300050507 | nmdc:mga05p37_1059781_c1 | nmdc:mga05p37_1059781_c1_531_800 | 89 |
| 573 | 3300050507 | nmdc:mga05p37_367756_c1 | nmdc:mga05p37_367756_c1_146_415 | 89 |
| 574 | 3300050508 | nmdc:mga09592_248037_c1 | nmdc:mga09592_248037_c1_170_439 | 89 |
| 575 | 3300050509 | nmdc:mga0qj67_375646_c1 | nmdc:mga0qj67_375646_c1_353_622 | 89 |
| 576 | 3300050512 | nmdc:mga0n895_153555_c1 | nmdc:mga0n895_153555_c1_717_986 | 89 |
| 577 | 3300050512 | nmdc:mga0n895_480950_c1 | nmdc:mga0n895_480950_c1_157_426 | 89 |
| 578 | 3300050512 | nmdc:mga0n895_614288_c1 | nmdc:mga0n895_614288_c1_131_400 | 89 |
| 579 | 3300050512 | nmdc:mga0n895_672732_c1 | nmdc:mga0n895_672732_c1_187_456 | 89 |
| 580 | 3300050513 | nmdc:mga0rr50_1483212_c1 | nmdc:mga0rr50_1483212_c1_83_352 | 89 |
| 581 | 3300050513 | nmdc:mga0rr50_56289_c1 | nmdc:mga0rr50_56289_c1_2356_2625 | 89 |
| 582 | 3300050513 | nmdc:mga0rr50_62880_c1 | nmdc:mga0rr50_62880_c1_309_578 | 89 |
| 583 | 3300050513 | nmdc:mga0rr50_73910_c1 | nmdc:mga0rr50_73910_c1_428_697 | 89 |
| 584 | 3300050514 | nmdc:mga08x19_241348_c1 | nmdc:mga08x19_241348_c1_139_408 | 89 |
| 585 | 3300050514 | nmdc:mga08x19_30223_c1 | nmdc:mga08x19_30223_c1_1020_1289 | 89 |
| 586 | 3300050514 | nmdc:mga08x19_38787_c1 | nmdc:mga08x19_38787_c1_2467_2736 | 89 |
| 587 | 3300050514 | nmdc:mga08x19_42481_c1 | nmdc:mga08x19_42481_c1_24_293 | 89 |
| 588 | 3300050514 | nmdc:mga08x19_545412_c1 | nmdc:mga08x19_545412_c1_493_762 | 89 |
| 589 | 3300050515 | nmdc:mga0a205_132886_c1 | nmdc:mga0a205_132886_c1_553_822 | 89 |
| 590 | 3300050515 | nmdc:mga0a205_7575_c1 | nmdc:mga0a205_7575_c1_7197_7466 | 89 |
| 591 | 3300053078 | Ga0495612_0208146 | Ga0495612_0208146_76_345 | 89 |
| 592 | 3300053078 | Ga0495612_0297233 | Ga0495612_0297233_109_378 | 89 |
| 593 | 3300053084 | Ga0495595_0016448 | Ga0495595_0016448_2687_2956 | 89 |
| 594 | 3300053084 | Ga0495595_0056441 | Ga0495595_0056441_403_672 | 89 |
| 595 | 3300053085 | Ga0495619_0009341 | Ga0495619_0009341_4999_5268 | 89 |
| 596 | 3300053153 | Ga0500616_0182173 | Ga0500616_0182173_144_416 | 89 |
| 597 | 3300054114 | Ga0501084_1651706 | Ga0501084_1651706_111_395 | 89 |
| 598 | 3300059490 | Ga0587066_221604 | Ga0587066_221604_150_434 | 89 |
| 599 | 3300059624 | Ga0587109_150123 | Ga0587109_150123_140_409 | 89 |
| 600 | 3300059630 | Ga0587128_050250 | Ga0587128_050250_145_414 | 89 |
| 601 | 3300059647 | Ga0587079_033080 | Ga0587079_033080_613_882 | 89 |
| 602 | 3300059652 | Ga0587107_102056 | Ga0587107_102056_134_403 | 89 |
| 603 | 3300059655 | Ga0587114_013716 | Ga0587114_013716_223_492 | 89 |
| 604 | 3300060346 | Ga0587111_0159589 | Ga0587111_0159589_273_542 | 89 |
| 605 | 3300061719 | Ga0466962_0218746 | Ga0466962_0218746_497_766 | 89 |
| 606 | 3300061734 | Ga0530510_0583561 | Ga0530510_0583561_527_796 | 89 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qv2-assembly1.cif.gz_o | bacillus subtilis collided disome (collided 70s) | 0.9963 | 4 | 88 |
| 8cdu-assembly1.cif.gz_O | rnase r bound to a 30s degradation intermediate (main state) | 0.9957 | 4 | 88 |
| 6th6-assembly1.cif.gz_Aq | cryo-em structure of t. kodakarensis 70s ribosome | 0.9935 | 29 | 74 |
| 7oya-assembly1.cif.gz_N2 | cryo-em structure of the 1 hpf zebrafish embryo 80s ribosome | 0.9929 | 29 | 72 |
| 7p7q-assembly1.cif.gz_p | e. faecalis 70s ribosome bound by poxta-eq2, high-resolution combined volume | 0.9924 | 4 | 88 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5optR02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9912 | 29 | 74 | 1.10.287.10 |
| 4ujrr02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.99 | 29 | 72 | 1.10.287.10 |
| 5xyiN02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9856 | 29 | 72 | 1.10.287.10 |
| 6az1T02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9856 | 29 | 74 | 1.10.287.10 |
| 6faiN02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9831 | 29 | 72 | 1.10.287.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C8BUQ1-F1-model_v4 | Small ribosomal subunit protein uS15 | 1.006 | 8 | 89 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A838XFQ7-F1-model_v4 | Small ribosomal subunit protein uS15 | 1.006 | 8 | 89 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A829I361-F1-model_v4 | deleted | 1.006 | 13 | 89 |
|
| AF-A0A3C0PAU3-F1-model_v4 | Small ribosomal subunit protein uS15 | 1.005 | 8 | 88 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A2N6A8N2-F1-model_v4 | Small ribosomal subunit protein uS15 | 1.005 | 3 | 88 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar