F468561

General Info

Members Datasets Scaffolds Average Seq Length
606 318 606 88

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100011695|Ga0070707_1000116952
Length 106
Sequence VASKTRHAGAPVYFPASLAVENEVKGKLIAEHRRADKDTGSPEVQVALHTARIRELTEHLKTHAKDHHSRRGLLLLVGKQRRLLNYLRDTDVERYRALVAKLGIRR

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
116 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
165 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
198 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
205 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
206 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
207 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
224 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
225 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
265 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
266 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
287 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
295 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
304 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
305 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
306 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
318 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.05
Metatranscriptomes 4.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.64
Nodule 0
Rhizoplane 6.27
Rhizosphere 87.62
Stem 0
Stem Tuber 0
Unclassified 3.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000245 3300002074 Bacteria 6465
2 JGI24034J26672_10000228 3300002239 Bacteria 7405
3 JGI24742J22300_10002179 3300002244 Bacteria 3122
4 JGI25159J45721_1043792 3300002987 Bacteria 641
5 JGI25151J46595_10000335 3300003187 Bacteria 50415
6 JGI25406J46586_10068133 3300003203 Bacteria 1125
7 JGI25406J46586_10083903 3300003203 Bacteria 972
8 JGI25153J46596_10036352 3300003215 Bacteria 1580
9 JGI25160J50197_1013448 3300003354 Bacteria 2790
10 Ga0007429J51699_1051436 3300003579 Bacteria 871
11 Ga0058862_12812905 3300004803 Bacteria 678
12 Ga0065165_1043725 3300005262 Bacteria 1314
13 Ga0070683_100077533 3300005329 Bacteria 3108
14 Ga0070683_100696874 3300005329 Bacteria 973
15 Ga0070683_101276346 3300005329 Bacteria 706
16 Ga0070690_101078506 3300005330 Bacteria 636
17 Ga0070670_101202171 3300005331 Bacteria 693
18 Ga0070682_100277708 3300005337 Bacteria 1220
19 Ga0070682_100388772 3300005337 Bacteria 1051
20 Ga0068868_100135247 3300005338 Bacteria 2020
21 Ga0068868_100247312 3300005338 Bacteria 1500
22 Ga0068868_101164155 3300005338 Bacteria 712
23 Ga0068868_102180316 3300005338 Bacteria 528
24 Ga0070692_10462039 3300005345 Bacteria 815
25 Ga0070668_100375507 3300005347 Bacteria 1209
26 Ga0070674_100000012 3300005356 Bacteria 130773
27 Ga0070674_100354732 3300005356 Bacteria 1186
28 Ga0070673_101818462 3300005364 Bacteria 577
29 Ga0070688_100000860 3300005365 Bacteria 15092
30 Ga0070688_101062758 3300005365 Bacteria 646
31 Ga0070667_100721170 3300005367 Bacteria 923
32 Ga0070667_101870658 3300005367 Bacteria 565
33 Ga0070667_102173896 3300005367 Bacteria 523
34 Ga0070703_10001676 3300005406 Bacteria 6579
35 Ga0070709_10302412 3300005434 Bacteria 1169
36 Ga0070714_100640646 3300005435 Bacteria 1022
37 Ga0070714_101127546 3300005435 Bacteria 765
38 Ga0070713_100000010 3300005436 Bacteria 151790
39 Ga0070713_100105340 3300005436 Bacteria 2450
40 Ga0070713_100208016 3300005436 Bacteria 1770
41 Ga0070713_101271984 3300005436 Bacteria 713
42 Ga0070713_101612968 3300005436 Bacteria 630
43 Ga0070713_102070899 3300005436 Bacteria 552
44 Ga0070710_10055018 3300005437 Bacteria 2247
45 Ga0070710_10990335 3300005437 Bacteria 612
46 Ga0070711_100102559 3300005439 Bacteria 2084
47 Ga0070705_100139831 3300005440 Bacteria 1592
48 Ga0070705_101683561 3300005440 Bacteria 536
49 Ga0070694_100955108 3300005444 Bacteria 710
50 Ga0070708_100004731 3300005445 Bacteria 10724
51 Ga0070708_100010345 3300005445 Bacteria 7555
52 Ga0070708_100396353 3300005445 Bacteria 1302
53 Ga0070708_101363358 3300005445 Bacteria 662
54 Ga0070708_101383269 3300005445 Bacteria 657
55 Ga0070678_100564606 3300005456 Bacteria 1012
56 Ga0070662_100000002 3300005457 Bacteria 253208
57 Ga0070681_10023478 3300005458 Bacteria 6203
58 Ga0070681_10092805 3300005458 Bacteria 2968
59 Ga0070681_10431463 3300005458 Bacteria 1230
60 Ga0068867_101868435 3300005459 Bacteria 566
61 Ga0070685_10001018 3300005466 Bacteria 15078
62 Ga0070685_10261075 3300005466 Bacteria 1152
63 Ga0070706_100000606 3300005467 Bacteria 41522
64 Ga0070706_100000697 3300005467 Bacteria 38037
65 Ga0070706_100076019 3300005467 Bacteria 3108
66 Ga0070706_100162673 3300005467 Unclassified 2084
67 Ga0070706_100177064 3300005467 Bacteria 1991
68 Ga0070706_100205211 3300005467 Bacteria 1841
69 Ga0070707_100008348 3300005468 Bacteria 9616
70 Ga0070707_100011695 3300005468 Bacteria 8189
71 Ga0070707_100021792 3300005468 Bacteria 6056
72 Ga0070707_100127427 3300005468 Bacteria 2474
73 Ga0070707_100375453 3300005468 Unclassified 1381
74 Ga0070707_100749667 3300005468 Bacteria 940
75 Ga0070707_101696158 3300005468 Bacteria 599
76 Ga0070707_101911416 3300005468 Bacteria 561
77 Ga0070698_100003666 3300005471 Bacteria 16870
78 Ga0070698_100151399 3300005471 Bacteria 2267
79 Ga0070698_100352901 3300005471 Bacteria 1402
80 Ga0070698_100474803 3300005471 Bacteria 1187
81 Ga0070698_100941981 3300005471 Unclassified 810
82 Ga0070698_101062863 3300005471 Unclassified 757
83 Ga0070698_101139192 3300005471 Bacteria 729
84 Ga0070699_100000907 3300005518 Bacteria 27639
85 Ga0070699_100001226 3300005518 Bacteria 23641
86 Ga0070699_100029831 3300005518 Bacteria 4704
87 Ga0070699_100107882 3300005518 Bacteria 2443
88 Ga0070699_100277250 3300005518 Bacteria 1501
89 Ga0070699_100423891 3300005518 Bacteria 1204
90 Ga0070699_100730478 3300005518 Bacteria 905
91 Ga0070699_101025761 3300005518 Bacteria 757
92 Ga0070699_101104485 3300005518 Bacteria 727
93 Ga0070699_101451450 3300005518 Bacteria 629
94 Ga0070679_100405982 3300005530 Bacteria 1308
95 Ga0070679_101137335 3300005530 Bacteria 726
96 Ga0070679_101894915 3300005530 Bacteria 545
97 Ga0070697_100000025 3300005536 Bacteria 128895
98 Ga0070697_100001828 3300005536 Bacteria 16269
99 Ga0070697_100004167 3300005536 Bacteria 11076
100 Ga0070697_100007410 3300005536 Bacteria 8545
101 Ga0070697_100017925 3300005536 Bacteria 5578
102 Ga0070697_100076813 3300005536 Bacteria 2746
103 Ga0070697_100099541 3300005536 Bacteria 2413
104 Ga0070697_100156127 3300005536 Bacteria 1926
105 Ga0070697_100179201 3300005536 Bacteria 1796
106 Ga0070697_100353274 3300005536 Bacteria 1270
107 Ga0070697_100579113 3300005536 Bacteria 985
108 Ga0070697_100679095 3300005536 Bacteria 908
109 Ga0070697_100760371 3300005536 Unclassified 856
110 Ga0070697_101304508 3300005536 Bacteria 648
111 Ga0068853_100794987 3300005539 Bacteria 906
112 Ga0070672_101065898 3300005543 Bacteria 718
113 Ga0070686_100749561 3300005544 Bacteria 783
114 Ga0070695_100226829 3300005545 Bacteria 1348
115 Ga0070695_100625310 3300005545 Bacteria 848
116 Ga0070695_100700112 3300005545 Bacteria 804
117 Ga0070695_100896683 3300005545 Bacteria 716
118 Ga0070695_101744173 3300005545 Bacteria 522
119 Ga0070696_100188979 3300005546 Bacteria 1532
120 Ga0070696_100628282 3300005546 Bacteria 868
121 Ga0070696_100656285 3300005546 Bacteria 851
122 Ga0070696_100966752 3300005546 Bacteria 710
123 Ga0070693_100003273 3300005547 Bacteria 7521
124 Ga0070665_101194011 3300005548 Bacteria 772
125 Ga0070704_100016423 3300005549 Bacteria 4677
126 Ga0070704_100866133 3300005549 Bacteria 811
127 Ga0070704_101438972 3300005549 Bacteria 633
128 Ga0070704_101552381 3300005549 Bacteria 610
129 Ga0070704_101710239 3300005549 Unclassified 581
130 Ga0068855_100032833 3300005563 Bacteria 6197
131 Ga0068857_101264343 3300005577 Bacteria 716
132 Ga0068854_101436264 3300005578 Bacteria 625
133 Ga0068854_101818638 3300005578 Bacteria 559
134 Ga0068856_101175506 3300005614 Bacteria 784
135 Ga0070702_100288478 3300005615 Bacteria 1130
136 Ga0068852_100160942 3300005616 Bacteria 2096
137 Ga0068859_100640950 3300005617 Bacteria 1155
138 Ga0068866_10000460 3300005718 Bacteria 18634
139 Ga0068866_10481288 3300005718 Bacteria 818
140 Ga0068866_11446976 3300005718 Unclassified 504
141 Ga0068861_100866300 3300005719 Bacteria 853
142 Ga0068870_10630906 3300005840 Bacteria 732
143 Ga0068858_101129382 3300005842 Bacteria 770
144 Ga0068858_101842137 3300005842 Bacteria 598
145 Ga0068858_102266387 3300005842 Bacteria 537
146 Ga0068862_101192247 3300005844 Bacteria 760
147 Ga0068862_101774516 3300005844 Bacteria 626
148 Ga0081455_10035539 3300005937 Bacteria 4451
149 Ga0081455_10075713 3300005937 Bacteria 2775
150 Ga0081455_10143574 3300005937 Bacteria 1850
151 Ga0081455_10148147 3300005937 Bacteria 1812
152 Ga0081455_10190393 3300005937 Bacteria 1545
153 Ga0081455_10201992 3300005937 Bacteria 1488
154 Ga0081538_10000141 3300005981 Bacteria 74085
155 Ga0081538_10048844 3300005981 Bacteria 2574
156 Ga0081538_10053005 3300005981 Bacteria 2417
157 Ga0081539_10000078 3300005985 Bacteria 226113
158 Ga0081539_10009284 3300005985 Bacteria 8266
159 Ga0070717_10000368 3300006028 Bacteria 28942
160 Ga0070717_10238562 3300006028 Unclassified 1602
161 Ga0070717_10474277 3300006028 Unclassified 1129
162 Ga0070717_12106142 3300006028 Unclassified 507
163 Ga0075363_100183933 3300006048 Bacteria 1190
164 Ga0075363_100424893 3300006048 Bacteria 783
165 Ga0070715_10345475 3300006163 Bacteria 811
166 Ga0070715_10625405 3300006163 Bacteria 634
167 Ga0070716_100278013 3300006173 Bacteria 1154
168 Ga0070716_100411991 3300006173 Bacteria 975
169 Ga0070716_100499620 3300006173 Bacteria 897
170 Ga0070716_100717084 3300006173 Bacteria 766
171 Ga0070716_101457997 3300006173 Unclassified 558
172 Ga0070712_100176452 3300006175 Bacteria 1662
173 Ga0070712_100295163 3300006175 Bacteria 1310
174 Ga0070712_100782902 3300006175 Bacteria 818
175 Ga0097621_100551822 3300006237 Bacteria 1049
176 Ga0097621_100554149 3300006237 Bacteria 1047
177 Ga0075370_11038241 3300006353 Bacteria 503
178 Ga0068871_101534530 3300006358 Bacteria 630
179 Ga0075428_100016707 3300006844 Bacteria 8101
180 Ga0075428_100027485 3300006844 Bacteria 6294
181 Ga0075428_100330527 3300006844 Bacteria 1637
182 Ga0075430_100036063 3300006846 Bacteria 4193
183 Ga0075430_100118082 3300006846 Bacteria 2211
184 Ga0075431_100008760 3300006847 Bacteria 10136
185 Ga0075431_100422763 3300006847 Bacteria 1332
186 Ga0075433_10008217 3300006852 Bacteria 8315
187 Ga0075433_10012628 3300006852 Bacteria 6832
188 Ga0075434_100008137 3300006871 Bacteria 9724
189 Ga0075434_100092162 3300006871 Bacteria 3032
190 Ga0075434_100986117 3300006871 Bacteria 857
191 Ga0075429_100002108 3300006880 Bacteria 16603
192 Ga0075429_100044834 3300006880 Bacteria 3846
193 Ga0075429_100695665 3300006880 Bacteria 890
194 Ga0068865_100549299 3300006881 Bacteria 970
195 Ga0068865_100825046 3300006881 Bacteria 802
196 Ga0068865_101103566 3300006881 Bacteria 699
197 Ga0075436_100211207 3300006914 Bacteria 1376
198 Ga0075436_100478181 3300006914 Unclassified 909
199 Ga0097620_100640977 3300006931 Bacteria 1155
200 Ga0075435_100010534 3300007076 Bacteria 6765
201 Ga0075435_100025259 3300007076 Bacteria 4623
202 Ga0075435_101375497 3300007076 Bacteria 618
203 Ga0099794_10076976 3300007265 Bacteria 1640
204 Ga0099794_10078534 3300007265 Bacteria 1625
205 Ga0099794_10232651 3300007265 Bacteria 948
206 Ga0105240_12469473 3300009093 Bacteria 538
207 Ga0105240_12498236 3300009093 Bacteria 534
208 Ga0111539_10696624 3300009094 Bacteria 1182
209 Ga0111539_10896175 3300009094 Bacteria 1032
210 Ga0111539_11023538 3300009094 Bacteria 960
211 Ga0105245_10317863 3300009098 Bacteria 1533
212 Ga0105245_10801620 3300009098 Bacteria 980
213 Ga0105245_11822737 3300009098 Bacteria 661
214 Ga0105247_10433313 3300009101 Bacteria 944
215 Ga0114129_10418308 3300009147 Bacteria 1763
216 Ga0114129_10918290 3300009147 Bacteria 1108
217 Ga0114129_11714529 3300009147 Bacteria 766
218 Ga0105243_10200652 3300009148 Bacteria 1749
219 Ga0105243_10328460 3300009148 Bacteria 1396
220 Ga0105243_13015027 3300009148 Bacteria 511
221 Ga0105241_11064549 3300009174 Bacteria 760
222 Ga0105242_10066584 3300009176 Bacteria 2976
223 Ga0105242_10664087 3300009176 Bacteria 1015
224 Ga0105242_11113140 3300009176 Bacteria 804
225 Ga0105242_11905771 3300009176 Bacteria 635
226 Ga0105242_12599107 3300009176 Bacteria 555
227 Ga0105242_13005503 3300009176 Bacteria 522
228 Ga0105248_10521005 3300009177 Bacteria 1340
229 Ga0105248_13130913 3300009177 Bacteria 526
230 Ga0105248_13434819 3300009177 Bacteria 503
231 Ga0105237_10872536 3300009545 Bacteria 907
232 Ga0105238_11566264 3300009551 Bacteria 688
233 Ga0105238_11817152 3300009551 Bacteria 642
234 Ga0105238_12029912 3300009551 Bacteria 609
235 Ga0105238_12230505 3300009551 Bacteria 582
236 Ga0105249_10035662 3300009553 Bacteria 4510
237 Ga0105249_10712482 3300009553 Bacteria 1064
238 Ga0099796_10009902 3300010159 Bacteria 2599
239 Ga0105239_10865192 3300010375 Bacteria 1037
240 Ga0105239_12412216 3300010375 Bacteria 613
241 Ga0105239_13182732 3300010375 Bacteria 534
242 Ga0157342_1083339 3300012507 Bacteria 506
243 Ga0157370_10076189 3300013104 Bacteria 3160
244 Ga0157369_10577821 3300013105 Bacteria 1161
245 Ga0157369_12450237 3300013105 Unclassified 528
246 Ga0157374_11090196 3300013296 Bacteria 819
247 Ga0157374_11585707 3300013296 Bacteria 679
248 Ga0157374_12031578 3300013296 Bacteria 601
249 Ga0157374_12283756 3300013296 Bacteria 568
250 Ga0157378_10969379 3300013297 Bacteria 883
251 Ga0157378_11063798 3300013297 Bacteria 845
252 Ga0157378_13170646 3300013297 Bacteria 511
253 Ga0163162_10583164 3300013306 Bacteria 1245
254 Ga0163162_11249490 3300013306 Bacteria 843
255 Ga0163162_12199277 3300013306 Bacteria 633
256 Ga0163162_12757277 3300013306 Bacteria 566
257 Ga0157372_11063923 3300013307 Bacteria 936
258 Ga0157375_10472782 3300013308 Bacteria 1419
259 Ga0157375_11018221 3300013308 Bacteria 967
260 Ga0157375_11576696 3300013308 Bacteria 776
261 Ga0163163_11755949 3300014325 Bacteria 681
262 Ga0163163_12415470 3300014325 Bacteria 584
263 Ga0157380_10417700 3300014326 Bacteria 1278
264 Ga0157380_10452083 3300014326 Bacteria 1234
265 Ga0157380_10926813 3300014326 Bacteria 899
266 Ga0157377_11240233 3300014745 Bacteria 579
267 Ga0157379_10090236 3300014968 Bacteria 2749
268 Ga0157379_11343470 3300014968 Bacteria 691
269 Ga0157379_12308675 3300014968 Bacteria 536
270 Ga0157376_11460886 3300014969 Bacteria 716
271 Ga0157376_12372247 3300014969 Bacteria 570
272 Ga0163161_10578720 3300017792 Bacteria 923
273 Ga0197907_10928300 3300020069 Bacteria 863
274 Ga0197907_10961597 3300020069 Bacteria 624
275 Ga0206356_10556947 3300020070 Bacteria 3311
276 Ga0206356_10923357 3300020070 Bacteria 870
277 Ga0206355_1703326 3300020076 Unclassified 772
278 Ga0206352_10134164 3300020078 Bacteria 1235
279 Ga0206352_11055209 3300020078 Bacteria 922
280 Ga0206350_10782470 3300020080 Bacteria 545
281 Ga0206354_10028481 3300020081 Bacteria 594
282 Ga0206354_10261121 3300020081 Bacteria 556
283 Ga0206353_10733172 3300020082 Bacteria 865
284 Ga0206353_11913518 3300020082 Bacteria 707
285 Ga0213872_10052478 3300021361 Bacteria 1850
286 Ga0213875_10015036 3300021388 Bacteria 3768
287 Ga0213875_10027132 3300021388 Bacteria 2724
288 Ga0213875_10334401 3300021388 Bacteria 718
289 Ga0213875_10355905 3300021388 Bacteria 696
290 Ga0213871_10008809 3300021441 Bacteria 2239
291 Ga0224712_10003013 3300022467 Bacteria 4287
292 Ga0224712_10194969 3300022467 Bacteria 919
293 Ga0224712_10340242 3300022467 Bacteria 708
294 Ga0224712_10532763 3300022467 Bacteria 570
295 Ga0209130_1007500 3300025284 Bacteria 3357
296 Ga0209025_1000179 3300025294 Bacteria 157965
297 Ga0209758_1002708 3300025297 Bacteria 17456
298 Ga0207426_1000191 3300025302 Bacteria 151850
299 Ga0207653_10005689 3300025885 Bacteria 3890
300 Ga0207682_10000091 3300025893 Bacteria 41479
301 Ga0207692_11091529 3300025898 Unclassified 528
302 Ga0207642_10000275 3300025899 Bacteria 15398
303 Ga0207642_10268251 3300025899 Bacteria 976
304 Ga0207647_10527386 3300025904 Bacteria 657
305 Ga0207699_10874655 3300025906 Unclassified 662
306 Ga0207684_10000014 3300025910 Bacteria 440027
307 Ga0207684_10000027 3300025910 Bacteria 313272
308 Ga0207684_10152163 3300025910 Bacteria 1991
309 Ga0207684_10171476 3300025910 Unclassified 1870
310 Ga0207684_10273662 3300025910 Unclassified 1457
311 Ga0207684_11297081 3300025910 Bacteria 600
312 Ga0207654_11229480 3300025911 Bacteria 546
313 Ga0207707_10434644 3300025912 Bacteria 1124
314 Ga0207663_11320352 3300025916 Bacteria 581
315 Ga0207663_11622702 3300025916 Bacteria 520
316 Ga0207660_10418690 3300025917 Bacteria 1080
317 Ga0207649_10000127 3300025920 Bacteria 64603
318 Ga0207652_10660557 3300025921 Bacteria 934
319 Ga0207646_10005694 3300025922 Bacteria 13068
320 Ga0207646_10040687 3300025922 Bacteria 4179
321 Ga0207646_10115916 3300025922 Bacteria 2406
322 Ga0207646_10486774 3300025922 Bacteria 1112
323 Ga0207646_10760385 3300025922 Bacteria 864
324 Ga0207687_10195706 3300025927 Bacteria 1576
325 Ga0207700_10000007 3300025928 Bacteria 345720
326 Ga0207700_10358341 3300025928 Unclassified 1271
327 Ga0207700_10490166 3300025928 Bacteria 1087
328 Ga0207700_10895682 3300025928 Unclassified 794
329 Ga0207664_10137588 3300025929 Unclassified 2062
330 Ga0207664_10395288 3300025929 Bacteria 1229
331 Ga0207664_10457703 3300025929 Bacteria 1139
332 Ga0207664_10994015 3300025929 Unclassified 752
333 Ga0207706_10000001 3300025933 Bacteria 423014
334 Ga0207686_10085344 3300025934 Bacteria 2071
335 Ga0207709_10449005 3300025935 Bacteria 996
336 Ga0207709_10758580 3300025935 Bacteria 780
337 Ga0207669_10000017 3300025937 Bacteria 119878
338 Ga0207669_11078839 3300025937 Unclassified 677
339 Ga0207665_10477905 3300025939 Bacteria 960
340 Ga0207665_10510797 3300025939 Bacteria 929
341 Ga0207661_10236297 3300025944 Bacteria 1620
342 Ga0207667_10256850 3300025949 Bacteria 1787
343 Ga0207667_10584167 3300025949 Bacteria 1127
344 Ga0207712_10850918 3300025961 Bacteria 804
345 Ga0207668_11149948 3300025972 Bacteria 697
346 Ga0207640_11407553 3300025981 Bacteria 625
347 Ga0207677_10000284 3300026023 Bacteria 37886
348 Ga0207708_10339341 3300026075 Bacteria 1230
349 Ga0207702_10379083 3300026078 Unclassified 1360
350 Ga0207648_10792678 3300026089 Bacteria 882
351 Ga0207674_10107858 3300026116 Bacteria 2762
352 Ga0207698_10067576 3300026142 Bacteria 2819
353 Ga0207698_11386403 3300026142 Bacteria 718
354 Ga0265326_10106596 3300028558 Bacteria 795
355 Ga0265319_1000317 3300028563 Bacteria 35915
356 Ga0265338_10007586 3300028800 Bacteria 13402
357 Ga0265324_10099004 3300029957 Bacteria 991
358 Ga0265766_1006649 3300030863 Bacteria 761
359 Ga0265766_1012905 3300030863 Bacteria 622
360 Ga0265764_117031 3300030882 Unclassified 509
361 Ga0265761_107232 3300030889 Bacteria 604
362 Ga0265320_10155254 3300031240 Bacteria 1032
363 Ga0265325_10045108 3300031241 Bacteria 2292
364 Ga0265331_10119764 3300031250 Bacteria 1204
365 Ga0265327_10008558 3300031251 Bacteria 7594
366 Ga0265327_10284809 3300031251 Bacteria 730
367 Ga0316576_10098103 3300031727 Bacteria 2188
368 Ga0307413_10147317 3300031824 Bacteria 1636
369 Ga0307410_10648596 3300031852 Bacteria 885
370 Ga0307410_11058586 3300031852 Bacteria 702
371 Ga0307410_11307720 3300031852 Bacteria 634
372 Ga0307406_12145234 3300031901 Bacteria 501
373 Ga0307407_10327843 3300031903 Bacteria 1077
374 Ga0307412_10273814 3300031911 Bacteria 1322
375 Ga0307409_100095541 3300031995 Bacteria 2449
376 Ga0307409_100438501 3300031995 Bacteria 1258
377 Ga0307409_101045752 3300031995 Bacteria 836
378 Ga0307409_102027496 3300031995 Unclassified 605
379 Ga0307416_100082015 3300032002 Bacteria 2730
380 Ga0307416_100437860 3300032002 Bacteria 1356
381 Ga0307416_101277553 3300032002 Bacteria 840
382 Ga0307411_10052797 3300032005 Bacteria 2660
383 Ga0307411_11447217 3300032005 Bacteria 630
384 Ga0307415_100064831 3300032126 Bacteria 2543
385 Ga0307415_100689933 3300032126 Bacteria 920
386 Ga0316596_1157851 3300033541 Bacteria 624
387 Ga0373929_0081084 3300035085 Unclassified 791
388 Ga0373943_0015929 3300035170 Bacteria 3422
389 Ga0373943_0046463 3300035170 Bacteria 2119
390 Ga0373943_0387769 3300035170 Bacteria 805
391 Ga0373931_0968056 3300035691 Bacteria 575
392 Ga0373935_0058765 3300035692 Bacteria 2457
393 Ga0373935_0223762 3300035692 Bacteria 1308
394 Ga0373933_0379390 3300035724 Bacteria 921
395 Ga0373947_0022670 3300035725 Bacteria 3643
396 Ga0373947_0567634 3300035725 Bacteria 773
397 Ga0373937_0748140 3300036401 Unclassified 925
398 Ga0316584_0306123 3300036712 Bacteria 1150
399 Ga0316584_0537016 3300036712 Unclassified 818
400 Ga0373925_0149551 3300037068 Bacteria 1833
401 Ga0373925_0499243 3300037068 Bacteria 999
402 Ga0395900_1777016 3300037418 Bacteria 527
403 Ga0395898_0235185 3300037466 Bacteria 1747
404 Ga0395898_0405918 3300037466 Bacteria 1299
405 Ga0395905_0509410 3300037471 Unclassified 1104
406 Ga0436364_0569107 3300037853 Bacteria 14260
407 Ga0436364_0655107 3300037853 Bacteria 652
408 Ga0436364_0880037 3300037853 Bacteria 536
409 Ga0436364_1370940 3300037853 Bacteria 1399
410 Ga0436364_1509934 3300037853 Bacteria 734
411 Ga0395901_0030683 3300038443 Bacteria 5539
412 Ga0395901_0078553 3300038443 Bacteria 3446
413 Ga0395901_0983908 3300038443 Bacteria 820
414 Ga0242419_007706 3300038698 Bacteria 797
415 Ga0242420_040487 3300038996 Bacteria 889
416 Ga0436365_0206254 3300039437 Bacteria 1132
417 Ga0436365_1873661 3300039437 Bacteria 704
418 Ga0436360_0295789 3300039438 Bacteria 8520
419 Ga0436360_1305965 3300039438 Bacteria 1005
420 Ga0436361_0951225 3300039447 Bacteria 873
421 Ga0436361_0971748 3300039447 Bacteria 2799
422 Ga0436363_1103378 3300039450 Bacteria 517
423 Ga0436363_1360105 3300039450 Bacteria 1405
424 Ga0436363_1525352 3300039450 Bacteria 871
425 Ga0436362_0435610 3300039453 Bacteria 620
426 Ga0436362_0555315 3300039453 Bacteria 995
427 Ga0451833_0944410 3300041491 Bacteria 707
428 Ga0451839_0700365 3300041496 Bacteria 1017
429 Ga0439435_0157046 3300042436 Unclassified 733
430 Ga0439460_0096683 3300042461 Bacteria 944
431 Ga0466965_0914157 3300044683 Bacteria 512
432 Ga0466966_0948802 3300044684 Bacteria 519
433 Ga0466963_0033204 3300044694 Bacteria 3348
434 Ga0466963_0107569 3300044694 Bacteria 1912
435 Ga0466963_0688143 3300044694 Bacteria 722
436 Ga0466964_0078019 3300044706 Bacteria 1415
437 Ga0466957_0057232 3300044842 Bacteria 2386
438 Ga0466957_0222677 3300044842 Bacteria 1246
439 Ga0466957_0366291 3300044842 Bacteria 980
440 Ga0466958_0273776 3300045836 Bacteria 1081
441 Ga0466967_0052271 3300045976 Bacteria 3585
442 Ga0466967_1598276 3300045976 Unclassified 649
443 Ga0466967_1972804 3300045976 Bacteria 580
444 Ga0495603_0112464 3300046455 Bacteria 1588
445 Ga0495629_0384977 3300046459 Bacteria 954
446 Ga0495641_0056549 3300046461 Bacteria 1778
447 Ga0495651_0558096 3300046462 Bacteria 727
448 Ga0495653_0520824 3300046463 Bacteria 739
449 Ga0495664_0542511 3300046477 Bacteria 693
450 Ga0495664_0661526 3300046477 Bacteria 619
451 Ga0495585_0243690 3300046492 Bacteria 899
452 Ga0495594_0457867 3300046499 Bacteria 725
453 Ga0495596_0225152 3300046500 Bacteria 728
454 Ga0495644_0218880 3300046523 Bacteria 736
455 Ga0495663_0211714 3300046525 Bacteria 679
456 Ga0495586_0212357 3300046535 Bacteria 1098
457 Ga0495586_0612825 3300046535 Bacteria 629
458 Ga0495656_0001446 3300046615 Bacteria 7763
459 Ga0495656_0186515 3300046615 Bacteria 1022
460 Ga0495634_0311431 3300046642 Bacteria 950
461 Ga0495657_0097013 3300046675 Bacteria 1883
462 Ga0495623_0424481 3300046679 Bacteria 712
463 Ga0495647_0228224 3300046681 Bacteria 824
464 Ga0495658_0172617 3300046683 Bacteria 1339
465 Ga0495658_0264955 3300046683 Bacteria 1082
466 Ga0495658_0402242 3300046683 Unclassified 873
467 Ga0495669_0000113 3300046684 Bacteria 52780
468 Ga0495613_0000041 3300046689 Bacteria 130784
469 Ga0495613_0128764 3300046689 Bacteria 1813
470 Ga0495624_0530851 3300046690 Bacteria 703
471 Ga0495600_0004414 3300046809 Bacteria 8414
472 Ga0495604_0000704 3300047317 Bacteria 28417
473 Ga0495604_0006922 3300047317 Bacteria 8988
474 Ga0495674_0043790 3300047319 Bacteria 3982
475 Ga0495674_1044418 3300047319 Bacteria 624
476 Ga0495676_0328376 3300047321 Bacteria 1026
477 Ga0495676_0937537 3300047321 Bacteria 554
478 Ga0495675_0474971 3300047444 Bacteria 721
479 Ga0495684_0786521 3300047471 Bacteria 623
480 Ga0495686_0237138 3300047472 Bacteria 1030
481 Ga0495593_0136807 3300047673 Bacteria 1242
482 Ga0495593_0475560 3300047673 Bacteria 626
483 Ga0495602_0000007 3300048088 Bacteria 273212
484 Ga0495602_0352041 3300048088 Bacteria 1063
485 Ga0496100_0176236 3300048903 Bacteria 1544
486 Ga0496100_0311329 3300048903 Bacteria 1181
487 Ga0496100_0687234 3300048903 Bacteria 798
488 Ga0496101_0289985 3300048904 Bacteria 1280
489 Ga0496101_1142141 3300048904 Bacteria 611
490 Ga0496101_1156448 3300048904 Bacteria 607
491 Ga0496102_0713488 3300048905 Bacteria 926
492 Ga0496102_0920690 3300048905 Bacteria 796
493 Ga0496102_1349967 3300048905 Bacteria 632
494 Ga0496104_0092499 3300048907 Bacteria 2892
495 Ga0496104_0099694 3300048907 Bacteria 2781
496 Ga0496104_0847004 3300048907 Bacteria 820
497 Ga0496104_1517833 3300048907 Bacteria 573
498 Ga0496105_0783182 3300048908 Bacteria 726
499 Ga0496106_0274829 3300048909 Bacteria 1349
500 Ga0496106_1070014 3300048909 Bacteria 633
501 Ga0496106_1133595 3300048909 Bacteria 612
502 Ga0496107_0034339 3300048910 Bacteria 3633
503 Ga0496107_0372728 3300048910 Bacteria 1062
504 Ga0496107_1225407 3300048910 Bacteria 539
505 Ga0496108_0000006 3300048911 Bacteria 469473
506 Ga0496109_0000009 3300048912 Bacteria 236561
507 Ga0496109_0030582 3300048912 Bacteria 4827
508 Ga0496109_0197332 3300048912 Bacteria 1892
509 Ga0496109_0774926 3300048912 Bacteria 897
510 Ga0496109_1392222 3300048912 Bacteria 637
511 Ga0496110_0471689 3300048913 Bacteria 1143
512 Ga0496110_0490250 3300048913 Bacteria 1119
513 Ga0496110_1730996 3300048913 Bacteria 535
514 Ga0496111_0060055 3300048914 Bacteria 2755
515 Ga0496112_0325571 3300048915 Bacteria 1481
516 Ga0496112_0357847 3300048915 Bacteria 1402
517 Ga0496112_0458864 3300048915 Bacteria 1212
518 Ga0496113_0021043 3300048916 Bacteria 4597
519 Ga0496113_0188617 3300048916 Bacteria 1636
520 Ga0496113_1192072 3300048916 Bacteria 595
521 Ga0496114_0202385 3300048917 Bacteria 1739
522 Ga0496115_0029166 3300048918 Bacteria 4332
523 Ga0496117_0258385 3300048920 Bacteria 946
524 Ga0496121_0175642 3300048924 Bacteria 1551
525 Ga0496124_0230554 3300048927 Bacteria 1385
526 Ga0496124_0838770 3300048927 Bacteria 565
527 Ga0496125_0144539 3300048928 Bacteria 1647
528 Ga0501291_080443 3300049514 Bacteria 648
529 Ga0501297_017044 3300049520 Bacteria 882
530 Ga0501299_019448 3300049522 Bacteria 1229
531 Ga0501032_1077348 3300049569 Bacteria 504
532 Ga0501034_0010352 3300049571 Bacteria 9718
533 Ga0501036_0526928 3300049572 Bacteria 982
534 Ga0501036_1383744 3300049572 Unclassified 571
535 Ga0501037_0084228 3300049573 Bacteria 2303
536 Ga0501039_0903335 3300049575 Bacteria 687
537 Ga0501041_0039068 3300049577 Bacteria 2880
538 Ga0501043_0191907 3300049579 Bacteria 1588
539 Ga0501046_0189668 3300049580 Bacteria 1534
540 Ga0501047_0019674 3300049581 Bacteria 6478
541 Ga0501048_0310822 3300049582 Bacteria 1122
542 Ga0501048_0515112 3300049582 Bacteria 858
543 Ga0501067_0197742 3300049583 Bacteria 1120
544 Ga0501067_0394728 3300049583 Bacteria 771
545 Ga0501068_0161645 3300049584 Bacteria 1411
546 Ga0501069_0320188 3300049585 Bacteria 911
547 Ga0501069_0759488 3300049585 Bacteria 586
548 Ga0501070_0006315 3300049586 Bacteria 10087
549 Ga0501071_0102282 3300049587 Bacteria 2113
550 Ga0501072_0650353 3300049588 Bacteria 830
551 Ga0501072_1174719 3300049588 Bacteria 596
552 Ga0501075_0673979 3300049591 Bacteria 788
553 Ga0501076_0418869 3300049592 Bacteria 1102
554 Ga0501077_0081447 3300049593 Bacteria 2051
555 Ga0501227_164124 3300049665 Bacteria 619
556 Ga0501233_288041 3300049668 Bacteria 504
557 Ga0501079_0926165 3300049741 Bacteria 686
558 Ga0501080_0121403 3300049742 Bacteria 2421
559 Ga0501080_0702632 3300049742 Bacteria 892
560 Ga0501081_0481455 3300049743 Bacteria 924
561 Ga0501081_1301576 3300049743 Bacteria 551
562 Ga0501035_1555114 3300049822 Bacteria 503
563 Ga0501044_0377866 3300049823 Bacteria 1332
564 Ga0501045_0126064 3300049824 Bacteria 1902
565 Ga0501045_0363814 3300049824 Bacteria 1077
566 Ga0501045_0820232 3300049824 Bacteria 685
567 Ga0501204_020965 3300049850 Bacteria 853
568 nmdc:mga03n38_307289_c1 3300050490 Bacteria 853
569 nmdc:mga00v17_837303_c1 3300050491 Bacteria 585
570 nmdc:mga0yw44_1010116_c1 3300050492 Bacteria 563
571 nmdc:mga05p37_1059781_c1 3300050507 Bacteria 854
572 nmdc:mga05p37_367756_c1 3300050507 Unclassified 1688
573 nmdc:mga09592_248037_c1 3300050508 Bacteria 1543
574 nmdc:mga0qj67_375646_c1 3300050509 Bacteria 1148
575 nmdc:mga0n895_153555_c1 3300050512 Bacteria 2333
576 nmdc:mga0n895_480950_c1 3300050512 Bacteria 1252
577 nmdc:mga0n895_614288_c1 3300050512 Bacteria 1088
578 nmdc:mga0n895_672732_c1 3300050512 Bacteria 1032
579 nmdc:mga0rr50_1483212_c1 3300050513 Unclassified 573
580 nmdc:mga0rr50_56289_c1 3300050513 Bacteria 2938
581 nmdc:mga0rr50_62880_c1 3300050513 Bacteria 2802
582 nmdc:mga0rr50_73910_c1 3300050513 Unclassified 2608
583 nmdc:mga08x19_241348_c1 3300050514 Bacteria 1246
584 nmdc:mga08x19_30223_c1 3300050514 Bacteria 3403
585 nmdc:mga08x19_38787_c1 3300050514 Bacteria 3026
586 nmdc:mga08x19_42481_c1 3300050514 Bacteria 2899
587 nmdc:mga08x19_545412_c1 3300050514 Bacteria 820
588 nmdc:mga0a205_132886_c1 3300050515 Bacteria 2389
589 nmdc:mga0a205_7575_c1 3300050515 Bacteria 9837
590 Ga0495612_0208146 3300053078 Bacteria 864
591 Ga0495612_0297233 3300053078 Unclassified 724
592 Ga0495595_0016448 3300053084 Bacteria 3165
593 Ga0495595_0056441 3300053084 Bacteria 1830
594 Ga0495619_0009341 3300053085 Bacteria 6190
595 Ga0500616_0182173 3300053153 Bacteria 945
596 Ga0501084_1651706 3300054114 Bacteria 535
597 Ga0587066_221604 3300059490 Bacteria 507
598 Ga0587109_150123 3300059624 Bacteria 575
599 Ga0587128_050250 3300059630 Bacteria 759
600 Ga0587079_033080 3300059647 Bacteria 1005
601 Ga0587107_102056 3300059652 Bacteria 569
602 Ga0587114_013716 3300059655 Bacteria 1047
603 Ga0587111_0159589 3300060346 Bacteria 612
604 Ga0466962_0218746 3300061719 Bacteria 933
605 Ga0530510_0290668 3300061734 Bacteria 1222
606 Ga0530510_0583561 3300061734 Bacteria 850

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003203 JGI25406J46586_10068133 JGI25406J46586_100681331 85
2 3300005329 Ga0070683_101276346 Ga0070683_1012763461 85
3 3300005330 Ga0070690_101078506 Ga0070690_1010785061 85
4 3300005331 Ga0070670_101202171 Ga0070670_1012021712 85
5 3300005337 Ga0070682_100277708 Ga0070682_1002777082 85
6 3300005337 Ga0070682_100388772 Ga0070682_1003887721 85
7 3300005338 Ga0068868_100247312 Ga0068868_1002473122 85
8 3300005338 Ga0068868_101164155 Ga0068868_1011641551 85
9 3300005338 Ga0068868_102180316 Ga0068868_1021803162 85
10 3300005345 Ga0070692_10462039 Ga0070692_104620392 85
11 3300005347 Ga0070668_100375507 Ga0070668_1003755072 85
12 3300005364 Ga0070673_101818462 Ga0070673_1018184621 85
13 3300005365 Ga0070688_101062758 Ga0070688_1010627581 85
14 3300005367 Ga0070667_100721170 Ga0070667_1007211702 85
15 3300005367 Ga0070667_101870658 Ga0070667_1018706581 85
16 3300005367 Ga0070667_102173896 Ga0070667_1021738961 85
17 3300005434 Ga0070709_10302412 Ga0070709_103024122 85
18 3300005436 Ga0070713_101612968 Ga0070713_1016129681 85
19 3300005436 Ga0070713_102070899 Ga0070713_1020708991 85
20 3300005437 Ga0070710_10055018 Ga0070710_100550182 85
21 3300005437 Ga0070710_10990335 Ga0070710_109903351 85
22 3300005439 Ga0070711_100102559 Ga0070711_1001025591 85
23 3300005444 Ga0070694_100955108 Ga0070694_1009551081 85
24 3300005445 Ga0070708_100396353 Ga0070708_1003963531 85
25 3300005445 Ga0070708_101383269 Ga0070708_1013832692 85
26 3300005456 Ga0070678_100564606 Ga0070678_1005646062 85
27 3300005458 Ga0070681_10023478 Ga0070681_100234782 85
28 3300005458 Ga0070681_10431463 Ga0070681_104314632 85
29 3300005466 Ga0070685_10261075 Ga0070685_102610752 85
30 3300005467 Ga0070706_100076019 Ga0070706_1000760194 85
31 3300005467 Ga0070706_100205211 Ga0070706_1002052112 85
32 3300005468 Ga0070707_100127427 Ga0070707_1001274273 85
33 3300005471 Ga0070698_100151399 Ga0070698_1001513992 85
34 3300005471 Ga0070698_100474803 Ga0070698_1004748033 85
35 3300005471 Ga0070698_101139192 Ga0070698_1011391921 85
36 3300005518 Ga0070699_100107882 Ga0070699_1001078824 85
37 3300005518 Ga0070699_100730478 Ga0070699_1007304781 85
38 3300005518 Ga0070699_101104485 Ga0070699_1011044851 85
39 3300005530 Ga0070679_100405982 Ga0070679_1004059822 85
40 3300005530 Ga0070679_101894915 Ga0070679_1018949151 85
41 3300005536 Ga0070697_100076813 Ga0070697_1000768131 85
42 3300005536 Ga0070697_100156127 Ga0070697_1001561272 85
43 3300005536 Ga0070697_100679095 Ga0070697_1006790952 85
44 3300005539 Ga0068853_100794987 Ga0068853_1007949871 85
45 3300005543 Ga0070672_101065898 Ga0070672_1010658981 85
46 3300005545 Ga0070695_100226829 Ga0070695_1002268292 85
47 3300005545 Ga0070695_100896683 Ga0070695_1008966831 85
48 3300005546 Ga0070696_100656285 Ga0070696_1006562851 85
49 3300005548 Ga0070665_101194011 Ga0070665_1011940111 85
50 3300005549 Ga0070704_100016423 Ga0070704_1000164233 85
51 3300005549 Ga0070704_100866133 Ga0070704_1008661332 85
52 3300005578 Ga0068854_101436264 Ga0068854_1014362642 85
53 3300005615 Ga0070702_100288478 Ga0070702_1002884782 85
54 3300005617 Ga0068859_100640950 Ga0068859_1006409503 85
55 3300005718 Ga0068866_10481288 Ga0068866_104812882 85
56 3300005840 Ga0068870_10630906 Ga0068870_106309061 85
57 3300005842 Ga0068858_101129382 Ga0068858_1011293821 85
58 3300005844 Ga0068862_101192247 Ga0068862_1011922472 85
59 3300005844 Ga0068862_101774516 Ga0068862_1017745161 85
60 3300005937 Ga0081455_10148147 Ga0081455_101481472 85
61 3300005937 Ga0081455_10201992 Ga0081455_102019922 85
62 3300005985 Ga0081539_10009284 Ga0081539_100092843 85
63 3300006163 Ga0070715_10625405 Ga0070715_106254051 85
64 3300006173 Ga0070716_100499620 Ga0070716_1004996202 85
65 3300006173 Ga0070716_100717084 Ga0070716_1007170842 85
66 3300006175 Ga0070712_100176452 Ga0070712_1001764522 85
67 3300006237 Ga0097621_100554149 Ga0097621_1005541492 85
68 3300006844 Ga0075428_100027485 Ga0075428_1000274854 85
69 3300006844 Ga0075428_100330527 Ga0075428_1003305272 85
70 3300006846 Ga0075430_100036063 Ga0075430_1000360632 85
71 3300006847 Ga0075431_100008760 Ga0075431_1000087608 85
72 3300006852 Ga0075433_10012628 Ga0075433_100126285 85
73 3300006871 Ga0075434_100008137 Ga0075434_1000081372 85
74 3300006880 Ga0075429_100002108 Ga0075429_10000210810 85
75 3300006880 Ga0075429_100695665 Ga0075429_1006956652 85
76 3300006881 Ga0068865_100549299 Ga0068865_1005492992 85
77 3300006881 Ga0068865_100825046 Ga0068865_1008250461 85
78 3300006914 Ga0075436_100211207 Ga0075436_1002112072 85
79 3300006931 Ga0097620_100640977 Ga0097620_1006409773 85
80 3300007076 Ga0075435_100010534 Ga0075435_1000105342 85
81 3300007076 Ga0075435_100025259 Ga0075435_1000252592 85
82 3300009094 Ga0111539_10696624 Ga0111539_106966242 85
83 3300009094 Ga0111539_11023538 Ga0111539_110235382 85
84 3300009098 Ga0105245_10317863 Ga0105245_103178632 85
85 3300009098 Ga0105245_10801620 Ga0105245_108016202 85
86 3300009098 Ga0105245_11822737 Ga0105245_118227371 85
87 3300009147 Ga0114129_10418308 Ga0114129_104183082 85
88 3300009147 Ga0114129_11714529 Ga0114129_117145291 85
89 3300009176 Ga0105242_10664087 Ga0105242_106640872 85
90 3300009176 Ga0105242_11905771 Ga0105242_119057712 85
91 3300009176 Ga0105242_13005503 Ga0105242_130055031 85
92 3300009177 Ga0105248_13130913 Ga0105248_131309131 85
93 3300009177 Ga0105248_13434819 Ga0105248_134348191 85
94 3300009545 Ga0105237_10872536 Ga0105237_108725362 85
95 3300009551 Ga0105238_11566264 Ga0105238_115662641 85
96 3300009551 Ga0105238_11817152 Ga0105238_118171521 85
97 3300009551 Ga0105238_12029912 Ga0105238_120299122 85
98 3300009551 Ga0105238_12230505 Ga0105238_122305051 85
99 3300009553 Ga0105249_10712482 Ga0105249_107124822 85
100 3300010375 Ga0105239_12412216 Ga0105239_124122162 85
101 3300013296 Ga0157374_11090196 Ga0157374_110901962 85
102 3300013296 Ga0157374_11585707 Ga0157374_115857071 85
103 3300013296 Ga0157374_12283756 Ga0157374_122837561 85
104 3300013297 Ga0157378_10969379 Ga0157378_109693792 85
105 3300013297 Ga0157378_13170646 Ga0157378_131706461 85
106 3300013306 Ga0163162_10583164 Ga0163162_105831641 85
107 3300013306 Ga0163162_12199277 Ga0163162_121992772 85
108 3300013306 Ga0163162_12757277 Ga0163162_127572771 85
109 3300013307 Ga0157372_11063923 Ga0157372_110639232 85
110 3300013308 Ga0157375_11018221 Ga0157375_110182211 85
111 3300013308 Ga0157375_11576696 Ga0157375_115766961 85
112 3300014325 Ga0163163_12415470 Ga0163163_124154701 85
113 3300014326 Ga0157380_10452083 Ga0157380_104520833 85
114 3300014326 Ga0157380_10926813 Ga0157380_109268131 85
115 3300014745 Ga0157377_11240233 Ga0157377_112402331 85
116 3300014968 Ga0157379_11343470 Ga0157379_113434702 85
117 3300014968 Ga0157379_12308675 Ga0157379_123086752 85
118 3300014969 Ga0157376_11460886 Ga0157376_114608862 85
119 3300014969 Ga0157376_12372247 Ga0157376_123722471 85
120 3300049593 Ga0501077_0081447 Ga0501077_0081447_1730_1993 85
121 3300049743 Ga0501081_0481455 Ga0501081_0481455_647_910 85
122 3300049824 Ga0501045_0126064 Ga0501045_0126064_1471_1734 85
123 3300061734 Ga0530510_0290668 Ga0530510_0290668_347_610 85
124 3300013105 Ga0157369_12450237 Ga0157369_124502372 87
125 3300025898 Ga0207692_11091529 Ga0207692_110915291 87
126 3300025906 Ga0207699_10874655 Ga0207699_108746551 87
127 3300031727 Ga0316576_10098103 Ga0316576_100981032 87
128 3300033541 Ga0316596_1157851 Ga0316596_11578511 87
129 3300035170 Ga0373943_0015929 Ga0373943_0015929_1671_1934 87
130 3300036712 Ga0316584_0306123 Ga0316584_0306123_114_377 87
131 3300041496 Ga0451839_0700365 Ga0451839_0700365_722_985 87
132 3300003203 JGI25406J46586_10083903 JGI25406J46586_100839032 88
133 3300005985 Ga0081539_10000078 Ga0081539_10000078110 88
134 3300026116 Ga0207674_10107858 Ga0207674_101078582 88
135 3300031824 Ga0307413_10147317 Ga0307413_101473171 88
136 3300031852 Ga0307410_10648596 Ga0307410_106485962 88
137 3300031852 Ga0307410_11058586 Ga0307410_110585862 88
138 3300031901 Ga0307406_12145234 Ga0307406_121452341 88
139 3300031903 Ga0307407_10327843 Ga0307407_103278432 88
140 3300031911 Ga0307412_10273814 Ga0307412_102738142 88
141 3300031995 Ga0307409_100095541 Ga0307409_1000955413 88
142 3300031995 Ga0307409_100438501 Ga0307409_1004385012 88
143 3300031995 Ga0307409_102027496 Ga0307409_1020274962 88
144 3300032002 Ga0307416_100082015 Ga0307416_1000820153 88
145 3300032002 Ga0307416_100437860 Ga0307416_1004378602 88
146 3300032002 Ga0307416_101277553 Ga0307416_1012775532 88
147 3300032005 Ga0307411_10052797 Ga0307411_100527974 88
148 3300032005 Ga0307411_11447217 Ga0307411_114472172 88
149 3300032126 Ga0307415_100064831 Ga0307415_1000648312 88
150 3300032126 Ga0307415_100689933 Ga0307415_1006899332 88
151 3300036712 Ga0316584_0537016 Ga0316584_0537016_46_312 88
152 3300048927 Ga0496124_0838770 Ga0496124_0838770_206_475 88
153 3300049514 Ga0501291_080443 Ga0501291_080443_189_455 88
154 3300049520 Ga0501297_017044 Ga0501297_017044_159_425 88
155 3300049522 Ga0501299_019448 Ga0501299_019448_466_732 88
156 3300049665 Ga0501227_164124 Ga0501227_164124_116_382 88
157 3300049668 Ga0501233_288041 Ga0501233_288041_200_466 88
158 3300049850 Ga0501204_020965 Ga0501204_020965_369_635 88
159 3300002074 JGI24748J21848_1000245 JGI24748J21848_10002452 89
160 3300002239 JGI24034J26672_10000228 JGI24034J26672_100002286 89
161 3300002244 JGI24742J22300_10002179 JGI24742J22300_100021792 89
162 3300002987 JGI25159J45721_1043792 JGI25159J45721_10437922 89
163 3300003187 JGI25151J46595_10000335 JGI25151J46595_1000033546 89
164 3300003215 JGI25153J46596_10036352 JGI25153J46596_100363522 89
165 3300003354 JGI25160J50197_1013448 JGI25160J50197_10134481 89
166 3300003579 Ga0007429J51699_1051436 Ga0007429J51699_10514361 89
167 3300004803 Ga0058862_12812905 Ga0058862_128129051 89
168 3300005262 Ga0065165_1043725 Ga0065165_10437252 89
169 3300005329 Ga0070683_100077533 Ga0070683_1000775332 89
170 3300005329 Ga0070683_100696874 Ga0070683_1006968743 89
171 3300005338 Ga0068868_100135247 Ga0068868_1001352473 89
172 3300005356 Ga0070674_100000012 Ga0070674_10000001258 89
173 3300005356 Ga0070674_100354732 Ga0070674_1003547322 89
174 3300005365 Ga0070688_100000860 Ga0070688_10000086011 89
175 3300005406 Ga0070703_10001676 Ga0070703_100016762 89
176 3300005435 Ga0070714_100640646 Ga0070714_1006406462 89
177 3300005435 Ga0070714_101127546 Ga0070714_1011275462 89
178 3300005436 Ga0070713_100000010 Ga0070713_10000001060 89
179 3300005436 Ga0070713_100105340 Ga0070713_1001053402 89
180 3300005436 Ga0070713_100208016 Ga0070713_1002080162 89
181 3300005436 Ga0070713_101271984 Ga0070713_1012719842 89
182 3300005440 Ga0070705_100139831 Ga0070705_1001398312 89
183 3300005440 Ga0070705_101683561 Ga0070705_1016835611 89
184 3300005445 Ga0070708_100004731 Ga0070708_1000047313 89
185 3300005445 Ga0070708_100010345 Ga0070708_1000103452 89
186 3300005445 Ga0070708_101363358 Ga0070708_1013633582 89
187 3300005457 Ga0070662_100000002 Ga0070662_100000002253 89
188 3300005458 Ga0070681_10092805 Ga0070681_100928052 89
189 3300005459 Ga0068867_101868435 Ga0068867_1018684351 89
190 3300005466 Ga0070685_10001018 Ga0070685_1000101811 89
191 3300005467 Ga0070706_100000606 Ga0070706_10000060639 89
192 3300005467 Ga0070706_100000697 Ga0070706_10000069715 89
193 3300005467 Ga0070706_100162673 Ga0070706_1001626732 89
194 3300005467 Ga0070706_100177064 Ga0070706_1001770642 89
195 3300005468 Ga0070707_100008348 Ga0070707_1000083482 89
196 3300005468 Ga0070707_100011695 Ga0070707_1000116952 89
197 3300005468 Ga0070707_100021792 Ga0070707_1000217924 89
198 3300005468 Ga0070707_100375453 Ga0070707_1003754532 89
199 3300005468 Ga0070707_100749667 Ga0070707_1007496672 89
200 3300005468 Ga0070707_101696158 Ga0070707_1016961581 89
201 3300005468 Ga0070707_101911416 Ga0070707_1019114161 89
202 3300005471 Ga0070698_100003666 Ga0070698_1000036662 89
203 3300005471 Ga0070698_100352901 Ga0070698_1003529012 89
204 3300005471 Ga0070698_100941981 Ga0070698_1009419812 89
205 3300005471 Ga0070698_101062863 Ga0070698_1010628632 89
206 3300005518 Ga0070699_100000907 Ga0070699_10000090723 89
207 3300005518 Ga0070699_100001226 Ga0070699_1000012262 89
208 3300005518 Ga0070699_100029831 Ga0070699_1000298313 89
209 3300005518 Ga0070699_100277250 Ga0070699_1002772502 89
210 3300005518 Ga0070699_100423891 Ga0070699_1004238912 89
211 3300005518 Ga0070699_101025761 Ga0070699_1010257612 89
212 3300005518 Ga0070699_101451450 Ga0070699_1014514501 89
213 3300005530 Ga0070679_101137335 Ga0070679_1011373352 89
214 3300005536 Ga0070697_100000025 Ga0070697_10000002554 89
215 3300005536 Ga0070697_100001828 Ga0070697_10000182817 89
216 3300005536 Ga0070697_100004167 Ga0070697_1000041672 89
217 3300005536 Ga0070697_100007410 Ga0070697_1000074108 89
218 3300005536 Ga0070697_100017925 Ga0070697_1000179254 89
219 3300005536 Ga0070697_100099541 Ga0070697_1000995412 89
220 3300005536 Ga0070697_100179201 Ga0070697_1001792012 89
221 3300005536 Ga0070697_100353274 Ga0070697_1003532742 89
222 3300005536 Ga0070697_100579113 Ga0070697_1005791132 89
223 3300005536 Ga0070697_100760371 Ga0070697_1007603712 89
224 3300005536 Ga0070697_101304508 Ga0070697_1013045082 89
225 3300005544 Ga0070686_100749561 Ga0070686_1007495612 89
226 3300005545 Ga0070695_100625310 Ga0070695_1006253102 89
227 3300005545 Ga0070695_100700112 Ga0070695_1007001121 89
228 3300005545 Ga0070695_101744173 Ga0070695_1017441731 89
229 3300005546 Ga0070696_100188979 Ga0070696_1001889792 89
230 3300005546 Ga0070696_100628282 Ga0070696_1006282821 89
231 3300005546 Ga0070696_100966752 Ga0070696_1009667521 89
232 3300005547 Ga0070693_100003273 Ga0070693_1000032733 89
233 3300005549 Ga0070704_101438972 Ga0070704_1014389722 89
234 3300005549 Ga0070704_101552381 Ga0070704_1015523811 89
235 3300005549 Ga0070704_101710239 Ga0070704_1017102392 89
236 3300005563 Ga0068855_100032833 Ga0068855_1000328336 89
237 3300005577 Ga0068857_101264343 Ga0068857_1012643432 89
238 3300005578 Ga0068854_101818638 Ga0068854_1018186382 89
239 3300005614 Ga0068856_101175506 Ga0068856_1011755061 89
240 3300005616 Ga0068852_100160942 Ga0068852_1001609423 89
241 3300005718 Ga0068866_10000460 Ga0068866_100004604 89
242 3300005718 Ga0068866_11446976 Ga0068866_114469761 89
243 3300005719 Ga0068861_100866300 Ga0068861_1008663002 89
244 3300005842 Ga0068858_101842137 Ga0068858_1018421371 89
245 3300005842 Ga0068858_102266387 Ga0068858_1022663872 89
246 3300005937 Ga0081455_10035539 Ga0081455_100355395 89
247 3300005937 Ga0081455_10075713 Ga0081455_100757134 89
248 3300005937 Ga0081455_10143574 Ga0081455_101435743 89
249 3300005937 Ga0081455_10190393 Ga0081455_101903933 89
250 3300005981 Ga0081538_10000141 Ga0081538_1000014142 89
251 3300005981 Ga0081538_10048844 Ga0081538_100488444 89
252 3300005981 Ga0081538_10053005 Ga0081538_100530053 89
253 3300006028 Ga0070717_10000368 Ga0070717_1000036822 89
254 3300006028 Ga0070717_10238562 Ga0070717_102385622 89
255 3300006028 Ga0070717_10474277 Ga0070717_104742771 89
256 3300006028 Ga0070717_12106142 Ga0070717_121061422 89
257 3300006048 Ga0075363_100183933 Ga0075363_1001839332 89
258 3300006048 Ga0075363_100424893 Ga0075363_1004248932 89
259 3300006163 Ga0070715_10345475 Ga0070715_103454751 89
260 3300006173 Ga0070716_100278013 Ga0070716_1002780132 89
261 3300006173 Ga0070716_100411991 Ga0070716_1004119912 89
262 3300006173 Ga0070716_101457997 Ga0070716_1014579971 89
263 3300006175 Ga0070712_100295163 Ga0070712_1002951632 89
264 3300006175 Ga0070712_100782902 Ga0070712_1007829022 89
265 3300006237 Ga0097621_100551822 Ga0097621_1005518222 89
266 3300006353 Ga0075370_11038241 Ga0075370_110382411 89
267 3300006358 Ga0068871_101534530 Ga0068871_1015345301 89
268 3300006844 Ga0075428_100016707 Ga0075428_1000167076 89
269 3300006846 Ga0075430_100118082 Ga0075430_1001180822 89
270 3300006847 Ga0075431_100422763 Ga0075431_1004227633 89
271 3300006852 Ga0075433_10008217 Ga0075433_100082173 89
272 3300006871 Ga0075434_100092162 Ga0075434_1000921621 89
273 3300006871 Ga0075434_100986117 Ga0075434_1009861171 89
274 3300006880 Ga0075429_100044834 Ga0075429_1000448345 89
275 3300006881 Ga0068865_101103566 Ga0068865_1011035662 89
276 3300006914 Ga0075436_100478181 Ga0075436_1004781812 89
277 3300007076 Ga0075435_101375497 Ga0075435_1013754972 89
278 3300007265 Ga0099794_10076976 Ga0099794_100769762 89
279 3300007265 Ga0099794_10078534 Ga0099794_100785342 89
280 3300007265 Ga0099794_10232651 Ga0099794_102326512 89
281 3300009093 Ga0105240_12469473 Ga0105240_124694731 89
282 3300009093 Ga0105240_12498236 Ga0105240_124982361 89
283 3300009094 Ga0111539_10896175 Ga0111539_108961751 89
284 3300009101 Ga0105247_10433313 Ga0105247_104333132 89
285 3300009147 Ga0114129_10918290 Ga0114129_109182902 89
286 3300009148 Ga0105243_10200652 Ga0105243_102006522 89
287 3300009148 Ga0105243_10328460 Ga0105243_103284602 89
288 3300009148 Ga0105243_13015027 Ga0105243_130150271 89
289 3300009174 Ga0105241_11064549 Ga0105241_110645492 89
290 3300009176 Ga0105242_10066584 Ga0105242_100665844 89
291 3300009176 Ga0105242_11113140 Ga0105242_111131402 89
292 3300009176 Ga0105242_12599107 Ga0105242_125991071 89
293 3300009177 Ga0105248_10521005 Ga0105248_105210052 89
294 3300009553 Ga0105249_10035662 Ga0105249_100356622 89
295 3300010159 Ga0099796_10009902 Ga0099796_100099022 89
296 3300010375 Ga0105239_10865192 Ga0105239_108651922 89
297 3300010375 Ga0105239_13182732 Ga0105239_131827322 89
298 3300012507 Ga0157342_1083339 Ga0157342_10833391 89
299 3300013104 Ga0157370_10076189 Ga0157370_100761892 89
300 3300013105 Ga0157369_10577821 Ga0157369_105778212 89
301 3300013296 Ga0157374_12031578 Ga0157374_120315781 89
302 3300013297 Ga0157378_11063798 Ga0157378_110637982 89
303 3300013306 Ga0163162_11249490 Ga0163162_112494902 89
304 3300013308 Ga0157375_10472782 Ga0157375_104727822 89
305 3300014325 Ga0163163_11755949 Ga0163163_117559492 89
306 3300014326 Ga0157380_10417700 Ga0157380_104177002 89
307 3300014968 Ga0157379_10090236 Ga0157379_100902362 89
308 3300017792 Ga0163161_10578720 Ga0163161_105787202 89
309 3300020069 Ga0197907_10928300 Ga0197907_109283001 89
310 3300020069 Ga0197907_10961597 Ga0197907_109615972 89
311 3300020070 Ga0206356_10556947 Ga0206356_105569472 89
312 3300020070 Ga0206356_10923357 Ga0206356_109233571 89
313 3300020076 Ga0206355_1703326 Ga0206355_17033261 89
314 3300020078 Ga0206352_10134164 Ga0206352_101341642 89
315 3300020078 Ga0206352_11055209 Ga0206352_110552092 89
316 3300020080 Ga0206350_10782470 Ga0206350_107824701 89
317 3300020081 Ga0206354_10028481 Ga0206354_100284811 89
318 3300020081 Ga0206354_10261121 Ga0206354_102611212 89
319 3300020082 Ga0206353_10733172 Ga0206353_107331721 89
320 3300020082 Ga0206353_11913518 Ga0206353_119135182 89
321 3300021361 Ga0213872_10052478 Ga0213872_100524782 89
322 3300021388 Ga0213875_10015036 Ga0213875_100150362 89
323 3300021388 Ga0213875_10027132 Ga0213875_100271322 89
324 3300021388 Ga0213875_10334401 Ga0213875_103344012 89
325 3300021388 Ga0213875_10355905 Ga0213875_103559051 89
326 3300021441 Ga0213871_10008809 Ga0213871_100088092 89
327 3300022467 Ga0224712_10003013 Ga0224712_100030133 89
328 3300022467 Ga0224712_10194969 Ga0224712_101949691 89
329 3300022467 Ga0224712_10340242 Ga0224712_103402421 89
330 3300022467 Ga0224712_10532763 Ga0224712_105327632 89
331 3300025284 Ga0209130_1007500 Ga0209130_10075003 89
332 3300025294 Ga0209025_1000179 Ga0209025_1000179100 89
333 3300025297 Ga0209758_1002708 Ga0209758_10027082 89
334 3300025302 Ga0207426_1000191 Ga0207426_1000191121 89
335 3300025885 Ga0207653_10005689 Ga0207653_100056894 89
336 3300025893 Ga0207682_10000091 Ga0207682_1000009126 89
337 3300025899 Ga0207642_10000275 Ga0207642_1000027514 89
338 3300025899 Ga0207642_10268251 Ga0207642_102682511 89
339 3300025904 Ga0207647_10527386 Ga0207647_105273862 89
340 3300025910 Ga0207684_10000014 Ga0207684_10000014165 89
341 3300025910 Ga0207684_10000027 Ga0207684_10000027299 89
342 3300025910 Ga0207684_10152163 Ga0207684_101521632 89
343 3300025910 Ga0207684_10171476 Ga0207684_101714762 89
344 3300025910 Ga0207684_10273662 Ga0207684_102736622 89
345 3300025910 Ga0207684_11297081 Ga0207684_112970811 89
346 3300025911 Ga0207654_11229480 Ga0207654_112294801 89
347 3300025912 Ga0207707_10434644 Ga0207707_104346442 89
348 3300025916 Ga0207663_11320352 Ga0207663_113203521 89
349 3300025916 Ga0207663_11622702 Ga0207663_116227021 89
350 3300025917 Ga0207660_10418690 Ga0207660_104186902 89
351 3300025920 Ga0207649_10000127 Ga0207649_1000012730 89
352 3300025921 Ga0207652_10660557 Ga0207652_106605572 89
353 3300025922 Ga0207646_10005694 Ga0207646_100056944 89
354 3300025922 Ga0207646_10040687 Ga0207646_100406872 89
355 3300025922 Ga0207646_10115916 Ga0207646_101159162 89
356 3300025922 Ga0207646_10486774 Ga0207646_104867742 89
357 3300025922 Ga0207646_10760385 Ga0207646_107603852 89
358 3300025927 Ga0207687_10195706 Ga0207687_101957062 89
359 3300025928 Ga0207700_10000007 Ga0207700_10000007261 89
360 3300025928 Ga0207700_10358341 Ga0207700_103583412 89
361 3300025928 Ga0207700_10490166 Ga0207700_104901662 89
362 3300025928 Ga0207700_10895682 Ga0207700_108956822 89
363 3300025929 Ga0207664_10137588 Ga0207664_101375882 89
364 3300025929 Ga0207664_10395288 Ga0207664_103952882 89
365 3300025929 Ga0207664_10457703 Ga0207664_104577032 89
366 3300025929 Ga0207664_10994015 Ga0207664_109940152 89
367 3300025933 Ga0207706_10000001 Ga0207706_10000001434 89
368 3300025934 Ga0207686_10085344 Ga0207686_100853443 89
369 3300025935 Ga0207709_10449005 Ga0207709_104490052 89
370 3300025935 Ga0207709_10758580 Ga0207709_107585802 89
371 3300025937 Ga0207669_10000017 Ga0207669_1000001743 89
372 3300025937 Ga0207669_11078839 Ga0207669_110788392 89
373 3300025939 Ga0207665_10477905 Ga0207665_104779052 89
374 3300025939 Ga0207665_10510797 Ga0207665_105107972 89
375 3300025944 Ga0207661_10236297 Ga0207661_102362972 89
376 3300025949 Ga0207667_10256850 Ga0207667_102568502 89
377 3300025949 Ga0207667_10584167 Ga0207667_105841672 89
378 3300025961 Ga0207712_10850918 Ga0207712_108509182 89
379 3300025972 Ga0207668_11149948 Ga0207668_111499482 89
380 3300025981 Ga0207640_11407553 Ga0207640_114075532 89
381 3300026023 Ga0207677_10000284 Ga0207677_1000028427 89
382 3300026075 Ga0207708_10339341 Ga0207708_103393412 89
383 3300026078 Ga0207702_10379083 Ga0207702_103790832 89
384 3300026089 Ga0207648_10792678 Ga0207648_107926782 89
385 3300026142 Ga0207698_10067576 Ga0207698_100675764 89
386 3300026142 Ga0207698_11386403 Ga0207698_113864032 89
387 3300028558 Ga0265326_10106596 Ga0265326_101065961 89
388 3300028563 Ga0265319_1000317 Ga0265319_100031715 89
389 3300028800 Ga0265338_10007586 Ga0265338_100075866 89
390 3300029957 Ga0265324_10099004 Ga0265324_100990042 89
391 3300030863 Ga0265766_1006649 Ga0265766_10066491 89
392 3300030863 Ga0265766_1012905 Ga0265766_10129052 89
393 3300030882 Ga0265764_117031 Ga0265764_1170311 89
394 3300030889 Ga0265761_107232 Ga0265761_1072322 89
395 3300031240 Ga0265320_10155254 Ga0265320_101552542 89
396 3300031241 Ga0265325_10045108 Ga0265325_100451082 89
397 3300031250 Ga0265331_10119764 Ga0265331_101197641 89
398 3300031251 Ga0265327_10008558 Ga0265327_100085582 89
399 3300031251 Ga0265327_10284809 Ga0265327_102848092 89
400 3300031852 Ga0307410_11307720 Ga0307410_113077202 89
401 3300031995 Ga0307409_101045752 Ga0307409_1010457521 89
402 3300035085 Ga0373929_0081084 Ga0373929_0081084_206_475 89
403 3300035170 Ga0373943_0046463 Ga0373943_0046463_438_707 89
404 3300035170 Ga0373943_0387769 Ga0373943_0387769_183_452 89
405 3300035691 Ga0373931_0968056 Ga0373931_0968056_238_507 89
406 3300035692 Ga0373935_0058765 Ga0373935_0058765_596_865 89
407 3300035692 Ga0373935_0223762 Ga0373935_0223762_687_956 89
408 3300035724 Ga0373933_0379390 Ga0373933_0379390_60_329 89
409 3300035725 Ga0373947_0022670 Ga0373947_0022670_1229_1498 89
410 3300035725 Ga0373947_0567634 Ga0373947_0567634_118_387 89
411 3300036401 Ga0373937_0748140 Ga0373937_0748140_569_838 89
412 3300037068 Ga0373925_0149551 Ga0373925_0149551_1527_1796 89
413 3300037068 Ga0373925_0499243 Ga0373925_0499243_146_415 89
414 3300037418 Ga0395900_1777016 Ga0395900_1777016_197_466 89
415 3300037466 Ga0395898_0235185 Ga0395898_0235185_1363_1632 89
416 3300037466 Ga0395898_0405918 Ga0395898_0405918_107_376 89
417 3300037471 Ga0395905_0509410 Ga0395905_0509410_176_445 89
418 3300037853 Ga0436364_0569107 Ga0436364_0569107_3532_3813 89
419 3300037853 Ga0436364_0655107 Ga0436364_0655107_280_549 89
420 3300037853 Ga0436364_0880037 Ga0436364_0880037_255_524 89
421 3300037853 Ga0436364_1370940 Ga0436364_1370940_900_1169 89
422 3300037853 Ga0436364_1509934 Ga0436364_1509934_287_556 89
423 3300038443 Ga0395901_0030683 Ga0395901_0030683_3474_3743 89
424 3300038443 Ga0395901_0078553 Ga0395901_0078553_2831_3100 89
425 3300038443 Ga0395901_0983908 Ga0395901_0983908_309_578 89
426 3300038698 Ga0242419_007706 Ga0242419_007706_438_713 89
427 3300038996 Ga0242420_040487 Ga0242420_040487_114_383 89
428 3300039437 Ga0436365_0206254 Ga0436365_0206254_226_495 89
429 3300039437 Ga0436365_1873661 Ga0436365_1873661_122_391 89
430 3300039438 Ga0436360_0295789 Ga0436360_0295789_1310_1579 89
431 3300039438 Ga0436360_1305965 Ga0436360_1305965_120_389 89
432 3300039447 Ga0436361_0951225 Ga0436361_0951225_160_429 89
433 3300039447 Ga0436361_0971748 Ga0436361_0971748_1602_1871 89
434 3300039450 Ga0436363_1103378 Ga0436363_1103378_124_393 89
435 3300039450 Ga0436363_1360105 Ga0436363_1360105_791_1060 89
436 3300039450 Ga0436363_1525352 Ga0436363_1525352_26_295 89
437 3300039453 Ga0436362_0435610 Ga0436362_0435610_153_422 89
438 3300039453 Ga0436362_0555315 Ga0436362_0555315_324_593 89
439 3300041491 Ga0451833_0944410 Ga0451833_0944410_83_361 89
440 3300042436 Ga0439435_0157046 Ga0439435_0157046_246_515 89
441 3300042461 Ga0439460_0096683 Ga0439460_0096683_128_397 89
442 3300044683 Ga0466965_0914157 Ga0466965_0914157_159_428 89
443 3300044684 Ga0466966_0948802 Ga0466966_0948802_35_304 89
444 3300044694 Ga0466963_0033204 Ga0466963_0033204_3029_3298 89
445 3300044694 Ga0466963_0107569 Ga0466963_0107569_1132_1401 89
446 3300044694 Ga0466963_0688143 Ga0466963_0688143_13_282 89
447 3300044706 Ga0466964_0078019 Ga0466964_0078019_1084_1353 89
448 3300044842 Ga0466957_0057232 Ga0466957_0057232_338_607 89
449 3300044842 Ga0466957_0222677 Ga0466957_0222677_86_355 89
450 3300044842 Ga0466957_0366291 Ga0466957_0366291_445_714 89
451 3300045836 Ga0466958_0273776 Ga0466958_0273776_330_599 89
452 3300045976 Ga0466967_0052271 Ga0466967_0052271_1865_2134 89
453 3300045976 Ga0466967_1598276 Ga0466967_1598276_288_557 89
454 3300045976 Ga0466967_1972804 Ga0466967_1972804_59_328 89
455 3300046455 Ga0495603_0112464 Ga0495603_0112464_191_460 89
456 3300046459 Ga0495629_0384977 Ga0495629_0384977_645_914 89
457 3300046461 Ga0495641_0056549 Ga0495641_0056549_356_625 89
458 3300046462 Ga0495651_0558096 Ga0495651_0558096_68_337 89
459 3300046463 Ga0495653_0520824 Ga0495653_0520824_390_659 89
460 3300046477 Ga0495664_0542511 Ga0495664_0542511_111_380 89
461 3300046477 Ga0495664_0661526 Ga0495664_0661526_18_290 89
462 3300046492 Ga0495585_0243690 Ga0495585_0243690_354_623 89
463 3300046499 Ga0495594_0457867 Ga0495594_0457867_282_551 89
464 3300046500 Ga0495596_0225152 Ga0495596_0225152_176_445 89
465 3300046523 Ga0495644_0218880 Ga0495644_0218880_435_704 89
466 3300046525 Ga0495663_0211714 Ga0495663_0211714_245_514 89
467 3300046535 Ga0495586_0212357 Ga0495586_0212357_126_395 89
468 3300046535 Ga0495586_0612825 Ga0495586_0612825_320_589 89
469 3300046615 Ga0495656_0001446 Ga0495656_0001446_5905_6174 89
470 3300046615 Ga0495656_0186515 Ga0495656_0186515_637_906 89
471 3300046642 Ga0495634_0311431 Ga0495634_0311431_206_475 89
472 3300046675 Ga0495657_0097013 Ga0495657_0097013_100_369 89
473 3300046679 Ga0495623_0424481 Ga0495623_0424481_347_616 89
474 3300046681 Ga0495647_0228224 Ga0495647_0228224_452_721 89
475 3300046683 Ga0495658_0172617 Ga0495658_0172617_653_922 89
476 3300046683 Ga0495658_0264955 Ga0495658_0264955_315_584 89
477 3300046683 Ga0495658_0402242 Ga0495658_0402242_206_475 89
478 3300046684 Ga0495669_0000113 Ga0495669_0000113_1054_1323 89
479 3300046689 Ga0495613_0000041 Ga0495613_0000041_94036_94305 89
480 3300046689 Ga0495613_0128764 Ga0495613_0128764_372_641 89
481 3300046690 Ga0495624_0530851 Ga0495624_0530851_332_601 89
482 3300046809 Ga0495600_0004414 Ga0495600_0004414_257_526 89
483 3300047317 Ga0495604_0000704 Ga0495604_0000704_6127_6396 89
484 3300047317 Ga0495604_0006922 Ga0495604_0006922_965_1234 89
485 3300047319 Ga0495674_0043790 Ga0495674_0043790_2454_2723 89
486 3300047319 Ga0495674_1044418 Ga0495674_1044418_241_510 89
487 3300047321 Ga0495676_0328376 Ga0495676_0328376_222_491 89
488 3300047321 Ga0495676_0937537 Ga0495676_0937537_96_365 89
489 3300047444 Ga0495675_0474971 Ga0495675_0474971_33_302 89
490 3300047471 Ga0495684_0786521 Ga0495684_0786521_286_555 89
491 3300047472 Ga0495686_0237138 Ga0495686_0237138_115_384 89
492 3300047673 Ga0495593_0136807 Ga0495593_0136807_494_763 89
493 3300047673 Ga0495593_0475560 Ga0495593_0475560_307_576 89
494 3300048088 Ga0495602_0000007 Ga0495602_0000007_178002_178271 89
495 3300048088 Ga0495602_0352041 Ga0495602_0352041_427_696 89
496 3300048903 Ga0496100_0176236 Ga0496100_0176236_456_731 89
497 3300048903 Ga0496100_0311329 Ga0496100_0311329_262_531 89
498 3300048903 Ga0496100_0687234 Ga0496100_0687234_417_686 89
499 3300048904 Ga0496101_0289985 Ga0496101_0289985_577_852 89
500 3300048904 Ga0496101_1142141 Ga0496101_1142141_200_472 89
501 3300048904 Ga0496101_1156448 Ga0496101_1156448_255_524 89
502 3300048905 Ga0496102_0713488 Ga0496102_0713488_398_667 89
503 3300048905 Ga0496102_0920690 Ga0496102_0920690_56_325 89
504 3300048905 Ga0496102_1349967 Ga0496102_1349967_347_616 89
505 3300048907 Ga0496104_0092499 Ga0496104_0092499_581_850 89
506 3300048907 Ga0496104_0099694 Ga0496104_0099694_1843_2112 89
507 3300048907 Ga0496104_0847004 Ga0496104_0847004_175_444 89
508 3300048907 Ga0496104_1517833 Ga0496104_1517833_54_323 89
509 3300048908 Ga0496105_0783182 Ga0496105_0783182_387_656 89
510 3300048909 Ga0496106_0274829 Ga0496106_0274829_772_1041 89
511 3300048909 Ga0496106_1070014 Ga0496106_1070014_217_486 89
512 3300048909 Ga0496106_1133595 Ga0496106_1133595_193_462 89
513 3300048910 Ga0496107_0034339 Ga0496107_0034339_2464_2733 89
514 3300048910 Ga0496107_0372728 Ga0496107_0372728_217_492 89
515 3300048910 Ga0496107_1225407 Ga0496107_1225407_184_453 89
516 3300048911 Ga0496108_0000006 Ga0496108_0000006_317000_317269 89
517 3300048912 Ga0496109_0000009 Ga0496109_0000009_84088_84357 89
518 3300048912 Ga0496109_0030582 Ga0496109_0030582_3239_3508 89
519 3300048912 Ga0496109_0197332 Ga0496109_0197332_928_1197 89
520 3300048912 Ga0496109_0774926 Ga0496109_0774926_529_798 89
521 3300048912 Ga0496109_1392222 Ga0496109_1392222_96_365 89
522 3300048913 Ga0496110_0471689 Ga0496110_0471689_53_322 89
523 3300048913 Ga0496110_0490250 Ga0496110_0490250_639_914 89
524 3300048913 Ga0496110_1730996 Ga0496110_1730996_253_522 89
525 3300048914 Ga0496111_0060055 Ga0496111_0060055_204_473 89
526 3300048915 Ga0496112_0325571 Ga0496112_0325571_252_521 89
527 3300048915 Ga0496112_0357847 Ga0496112_0357847_280_549 89
528 3300048915 Ga0496112_0458864 Ga0496112_0458864_669_938 89
529 3300048916 Ga0496113_0021043 Ga0496113_0021043_1337_1606 89
530 3300048916 Ga0496113_0188617 Ga0496113_0188617_867_1136 89
531 3300048916 Ga0496113_1192072 Ga0496113_1192072_67_336 89
532 3300048917 Ga0496114_0202385 Ga0496114_0202385_1380_1655 89
533 3300048918 Ga0496115_0029166 Ga0496115_0029166_3044_3313 89
534 3300048920 Ga0496117_0258385 Ga0496117_0258385_358_627 89
535 3300048924 Ga0496121_0175642 Ga0496121_0175642_1097_1366 89
536 3300048927 Ga0496124_0230554 Ga0496124_0230554_1059_1328 89
537 3300048928 Ga0496125_0144539 Ga0496125_0144539_238_507 89
538 3300049569 Ga0501032_1077348 Ga0501032_1077348_101_373 89
539 3300049571 Ga0501034_0010352 Ga0501034_0010352_5638_5910 89
540 3300049572 Ga0501036_0526928 Ga0501036_0526928_588_860 89
541 3300049572 Ga0501036_1383744 Ga0501036_1383744_70_354 89
542 3300049573 Ga0501037_0084228 Ga0501037_0084228_1386_1658 89
543 3300049575 Ga0501039_0903335 Ga0501039_0903335_111_383 89
544 3300049577 Ga0501041_0039068 Ga0501041_0039068_1923_2207 89
545 3300049579 Ga0501043_0191907 Ga0501043_0191907_863_1135 89
546 3300049580 Ga0501046_0189668 Ga0501046_0189668_1148_1420 89
547 3300049581 Ga0501047_0019674 Ga0501047_0019674_202_474 89
548 3300049582 Ga0501048_0310822 Ga0501048_0310822_492_764 89
549 3300049582 Ga0501048_0515112 Ga0501048_0515112_549_833 89
550 3300049583 Ga0501067_0197742 Ga0501067_0197742_305_577 89
551 3300049583 Ga0501067_0394728 Ga0501067_0394728_438_707 89
552 3300049584 Ga0501068_0161645 Ga0501068_0161645_598_867 89
553 3300049585 Ga0501069_0320188 Ga0501069_0320188_512_781 89
554 3300049585 Ga0501069_0759488 Ga0501069_0759488_16_285 89
555 3300049586 Ga0501070_0006315 Ga0501070_0006315_546_818 89
556 3300049587 Ga0501071_0102282 Ga0501071_0102282_898_1182 89
557 3300049588 Ga0501072_0650353 Ga0501072_0650353_267_539 89
558 3300049588 Ga0501072_1174719 Ga0501072_1174719_252_536 89
559 3300049591 Ga0501075_0673979 Ga0501075_0673979_331_615 89
560 3300049592 Ga0501076_0418869 Ga0501076_0418869_50_334 89
561 3300049741 Ga0501079_0926165 Ga0501079_0926165_204_473 89
562 3300049742 Ga0501080_0121403 Ga0501080_0121403_1020_1292 89
563 3300049742 Ga0501080_0702632 Ga0501080_0702632_192_476 89
564 3300049743 Ga0501081_1301576 Ga0501081_1301576_227_511 89
565 3300049822 Ga0501035_1555114 Ga0501035_1555114_16_300 89
566 3300049823 Ga0501044_0377866 Ga0501044_0377866_189_461 89
567 3300049824 Ga0501045_0363814 Ga0501045_0363814_476_745 89
568 3300049824 Ga0501045_0820232 Ga0501045_0820232_70_354 89
569 3300050490 nmdc:mga03n38_307289_c1 nmdc:mga03n38_307289_c1_474_743 89
570 3300050491 nmdc:mga00v17_837303_c1 nmdc:mga00v17_837303_c1_91_360 89
571 3300050492 nmdc:mga0yw44_1010116_c1 nmdc:mga0yw44_1010116_c1_179_448 89
572 3300050507 nmdc:mga05p37_1059781_c1 nmdc:mga05p37_1059781_c1_531_800 89
573 3300050507 nmdc:mga05p37_367756_c1 nmdc:mga05p37_367756_c1_146_415 89
574 3300050508 nmdc:mga09592_248037_c1 nmdc:mga09592_248037_c1_170_439 89
575 3300050509 nmdc:mga0qj67_375646_c1 nmdc:mga0qj67_375646_c1_353_622 89
576 3300050512 nmdc:mga0n895_153555_c1 nmdc:mga0n895_153555_c1_717_986 89
577 3300050512 nmdc:mga0n895_480950_c1 nmdc:mga0n895_480950_c1_157_426 89
578 3300050512 nmdc:mga0n895_614288_c1 nmdc:mga0n895_614288_c1_131_400 89
579 3300050512 nmdc:mga0n895_672732_c1 nmdc:mga0n895_672732_c1_187_456 89
580 3300050513 nmdc:mga0rr50_1483212_c1 nmdc:mga0rr50_1483212_c1_83_352 89
581 3300050513 nmdc:mga0rr50_56289_c1 nmdc:mga0rr50_56289_c1_2356_2625 89
582 3300050513 nmdc:mga0rr50_62880_c1 nmdc:mga0rr50_62880_c1_309_578 89
583 3300050513 nmdc:mga0rr50_73910_c1 nmdc:mga0rr50_73910_c1_428_697 89
584 3300050514 nmdc:mga08x19_241348_c1 nmdc:mga08x19_241348_c1_139_408 89
585 3300050514 nmdc:mga08x19_30223_c1 nmdc:mga08x19_30223_c1_1020_1289 89
586 3300050514 nmdc:mga08x19_38787_c1 nmdc:mga08x19_38787_c1_2467_2736 89
587 3300050514 nmdc:mga08x19_42481_c1 nmdc:mga08x19_42481_c1_24_293 89
588 3300050514 nmdc:mga08x19_545412_c1 nmdc:mga08x19_545412_c1_493_762 89
589 3300050515 nmdc:mga0a205_132886_c1 nmdc:mga0a205_132886_c1_553_822 89
590 3300050515 nmdc:mga0a205_7575_c1 nmdc:mga0a205_7575_c1_7197_7466 89
591 3300053078 Ga0495612_0208146 Ga0495612_0208146_76_345 89
592 3300053078 Ga0495612_0297233 Ga0495612_0297233_109_378 89
593 3300053084 Ga0495595_0016448 Ga0495595_0016448_2687_2956 89
594 3300053084 Ga0495595_0056441 Ga0495595_0056441_403_672 89
595 3300053085 Ga0495619_0009341 Ga0495619_0009341_4999_5268 89
596 3300053153 Ga0500616_0182173 Ga0500616_0182173_144_416 89
597 3300054114 Ga0501084_1651706 Ga0501084_1651706_111_395 89
598 3300059490 Ga0587066_221604 Ga0587066_221604_150_434 89
599 3300059624 Ga0587109_150123 Ga0587109_150123_140_409 89
600 3300059630 Ga0587128_050250 Ga0587128_050250_145_414 89
601 3300059647 Ga0587079_033080 Ga0587079_033080_613_882 89
602 3300059652 Ga0587107_102056 Ga0587107_102056_134_403 89
603 3300059655 Ga0587114_013716 Ga0587114_013716_223_492 89
604 3300060346 Ga0587111_0159589 Ga0587111_0159589_273_542 89
605 3300061719 Ga0466962_0218746 Ga0466962_0218746_497_766 89
606 3300061734 Ga0530510_0583561 Ga0530510_0583561_527_796 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00312

Ribosomal_S15

Ribosomal protein S15

25

105

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qv2-assembly1.cif.gz_o bacillus subtilis collided disome (collided 70s) 0.9963 4 88
8cdu-assembly1.cif.gz_O rnase r bound to a 30s degradation intermediate (main state) 0.9957 4 88
6th6-assembly1.cif.gz_Aq cryo-em structure of t. kodakarensis 70s ribosome 0.9935 29 74
7oya-assembly1.cif.gz_N2 cryo-em structure of the 1 hpf zebrafish embryo 80s ribosome 0.9929 29 72
7p7q-assembly1.cif.gz_p e. faecalis 70s ribosome bound by poxta-eq2, high-resolution combined volume 0.9924 4 88
ID Description Score Start End Superfamily
5optR02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9912 29 74 1.10.287.10
4ujrr02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.99 29 72 1.10.287.10
5xyiN02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9856 29 72 1.10.287.10
6az1T02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9856 29 74 1.10.287.10
6faiN02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9831 29 72 1.10.287.10
ID Description Score Start End GO Terms
AF-A0A5C8BUQ1-F1-model_v4 Small ribosomal subunit protein uS15 1.006 8 89 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A838XFQ7-F1-model_v4 Small ribosomal subunit protein uS15 1.006 8 89 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A829I361-F1-model_v4 deleted 1.006 13 89
AF-A0A3C0PAU3-F1-model_v4 Small ribosomal subunit protein uS15 1.005 8 88 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A2N6A8N2-F1-model_v4 Small ribosomal subunit protein uS15 1.005 3 88 GO:0003735
GO:0006412
GO:0019843
GO:0022627

Feature Viewer

pLDDT pTM Quality
93.25 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map