F468418
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 604 | 342 | 597 | 75 |
Family's Representative Sequence
| Representative Sequence | 3300053087|Ga0500643_017450|Ga0500643_017450_876_1154 |
| Length | 92 |
| Sequence | LSRAFAICARAAYPLDPTMKQDTHPDYHFITVVMTDGTSYRTRSTYGKEGDTLNLDIDPRTHPAWTGGGHTMLDRGGRVSRFNNKFAGFVRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 2 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 3 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 4 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 5 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 117 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 120 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 121 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 191 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 210 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 211 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 228 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 234 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 241 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 242 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 243 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 244 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 245 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 246 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 247 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 248 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 249 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 250 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 251 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 274 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 275 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 276 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 277 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 278 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 291 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 295 | 3300049852 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control | Metagenome | Rhizosphere |
| 296 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 297 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 298 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 301 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 302 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 303 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 304 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 309 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 310 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 311 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 313 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 314 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 315 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 316 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 317 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 318 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 319 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 320 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 321 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 322 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 324 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 326 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 327 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 328 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 329 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 330 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 331 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 332 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 334 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 335 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 337 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 342 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.35 |
| Metatranscriptomes | 1.49 |
| Isolates | 1.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.37 |
| Nodule | 0.33 |
| Rhizoplane | 3.15 |
| Rhizosphere | 69.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10107549 | 3300001979 | Bacteria | 705 |
| 2 | JGI25153J46596_10086969 | 3300003215 | Bacteria | 764 |
| 3 | rootH1_10153469 | 3300003316 | Bacteria | 1140 |
| 4 | rootH2_10010501 | 3300003320 | Bacteria | 2910 |
| 5 | rootH2_10020043 | 3300003320 | Bacteria | 3019 |
| 6 | rootL2_10135826 | 3300003322 | Bacteria | 1833 |
| 7 | rootH1_10022222 | 3300003323 | Bacteria | 10266 |
| 8 | rootH1_10027576 | 3300003323 | Bacteria | 1160 |
| 9 | rootH1_10136079 | 3300003323 | Bacteria | 2694 |
| 10 | rootH1_10156035 | 3300003323 | Bacteria | 1341 |
| 11 | rootH1_10181512 | 3300003323 | Bacteria | 1978 |
| 12 | Ga0055524_1015750 | 3300003775 | Bacteria | 2744 |
| 13 | Ga0055536_1005094 | 3300003781 | Bacteria | 6521 |
| 14 | Ga0055536_1008341 | 3300003781 | Bacteria | 4471 |
| 15 | Ga0055530_10000571 | 3300003791 | Bacteria | 31903 |
| 16 | Ga0055530_10015556 | 3300003791 | Bacteria | 2475 |
| 17 | Ga0055530_10020754 | 3300003791 | Bacteria | 1954 |
| 18 | Ga0055540_1069762 | 3300003792 | Bacteria | 688 |
| 19 | Ga0055531_10001076 | 3300003794 | Bacteria | 21445 |
| 20 | Ga0055531_10008699 | 3300003794 | Bacteria | 5304 |
| 21 | Ga0055531_10042677 | 3300003794 | Bacteria | 1293 |
| 22 | Ga0055531_10058243 | 3300003794 | Bacteria | 962 |
| 23 | Ga0055543_1052995 | 3300004625 | Bacteria | 662 |
| 24 | Ga0065165_1003949 | 3300005262 | Bacteria | 9746 |
| 25 | Ga0070683_100414316 | 3300005329 | Bacteria | 1285 |
| 26 | Ga0070690_100683287 | 3300005330 | Bacteria | 787 |
| 27 | Ga0070670_101420061 | 3300005331 | Bacteria | 636 |
| 28 | Ga0068869_100048118 | 3300005334 | Bacteria | 3082 |
| 29 | Ga0070666_10249321 | 3300005335 | Bacteria | 1257 |
| 30 | Ga0070666_10331925 | 3300005335 | Bacteria | 1086 |
| 31 | Ga0070666_10925604 | 3300005335 | Bacteria | 645 |
| 32 | Ga0070666_11243970 | 3300005335 | Bacteria | 555 |
| 33 | Ga0070680_100448767 | 3300005336 | Bacteria | 1101 |
| 34 | Ga0070660_100256266 | 3300005339 | Bacteria | 1428 |
| 35 | Ga0070687_100894717 | 3300005343 | Bacteria | 636 |
| 36 | Ga0070661_101879898 | 3300005344 | Bacteria | 509 |
| 37 | Ga0070668_100001069 | 3300005347 | Bacteria | 19272 |
| 38 | Ga0070668_100002342 | 3300005347 | Bacteria | 13925 |
| 39 | Ga0070668_100083220 | 3300005347 | Bacteria | 2512 |
| 40 | Ga0070669_100010474 | 3300005353 | Bacteria | 6585 |
| 41 | Ga0070671_100005043 | 3300005355 | Bacteria | 10529 |
| 42 | Ga0070671_100433934 | 3300005355 | Bacteria | 1126 |
| 43 | Ga0070674_101674281 | 3300005356 | Bacteria | 575 |
| 44 | Ga0070673_100252580 | 3300005364 | Bacteria | 1537 |
| 45 | Ga0070667_100015181 | 3300005367 | Bacteria | 6362 |
| 46 | Ga0070667_100152833 | 3300005367 | Bacteria | 2028 |
| 47 | Ga0070667_100333278 | 3300005367 | Bacteria | 1371 |
| 48 | Ga0070667_100806493 | 3300005367 | Bacteria | 872 |
| 49 | Ga0070667_101348318 | 3300005367 | Bacteria | 669 |
| 50 | Ga0070667_102215475 | 3300005367 | Bacteria | 518 |
| 51 | Ga0070714_100384684 | 3300005435 | Bacteria | 1323 |
| 52 | Ga0070714_100546568 | 3300005435 | Bacteria | 1108 |
| 53 | Ga0070714_100769827 | 3300005435 | Bacteria | 931 |
| 54 | Ga0070714_100813971 | 3300005435 | Bacteria | 905 |
| 55 | Ga0070713_100259893 | 3300005436 | Bacteria | 1586 |
| 56 | Ga0070710_10178863 | 3300005437 | Bacteria | 1326 |
| 57 | Ga0070710_11271791 | 3300005437 | Bacteria | 546 |
| 58 | Ga0070711_100443768 | 3300005439 | Bacteria | 1061 |
| 59 | Ga0070700_101013400 | 3300005441 | Bacteria | 683 |
| 60 | Ga0070708_100091639 | 3300005445 | Bacteria | 2768 |
| 61 | Ga0070678_100341893 | 3300005456 | Bacteria | 1284 |
| 62 | Ga0070678_100517604 | 3300005456 | Bacteria | 1055 |
| 63 | Ga0070662_100115657 | 3300005457 | Bacteria | 2049 |
| 64 | Ga0070681_10047452 | 3300005458 | Bacteria | 4293 |
| 65 | Ga0068867_100570176 | 3300005459 | Bacteria | 983 |
| 66 | Ga0068867_101903846 | 3300005459 | Bacteria | 561 |
| 67 | Ga0070706_100018301 | 3300005467 | Bacteria | 6465 |
| 68 | Ga0070707_100006146 | 3300005468 | Bacteria | 11191 |
| 69 | Ga0070698_100022207 | 3300005471 | Bacteria | 6643 |
| 70 | Ga0070699_100022426 | 3300005518 | Bacteria | 5440 |
| 71 | Ga0070699_100085623 | 3300005518 | Bacteria | 2750 |
| 72 | Ga0070697_100118352 | 3300005536 | Bacteria | 2213 |
| 73 | Ga0068853_100022277 | 3300005539 | Bacteria | 5290 |
| 74 | Ga0068853_100062467 | 3300005539 | Bacteria | 3224 |
| 75 | Ga0068853_101909071 | 3300005539 | Bacteria | 576 |
| 76 | Ga0070696_101138998 | 3300005546 | Bacteria | 657 |
| 77 | Ga0070693_101145899 | 3300005547 | Bacteria | 595 |
| 78 | Ga0070693_101348769 | 3300005547 | Bacteria | 553 |
| 79 | Ga0070665_100849607 | 3300005548 | Bacteria | 926 |
| 80 | Ga0070704_101747046 | 3300005549 | Bacteria | 575 |
| 81 | Ga0068855_100086104 | 3300005563 | Bacteria | 3634 |
| 82 | Ga0068855_101472109 | 3300005563 | Bacteria | 700 |
| 83 | Ga0068855_101787214 | 3300005563 | Bacteria | 625 |
| 84 | Ga0070664_100394900 | 3300005564 | Bacteria | 1264 |
| 85 | Ga0070664_100643618 | 3300005564 | Bacteria | 985 |
| 86 | Ga0068857_100018018 | 3300005577 | Bacteria | 6194 |
| 87 | Ga0068857_100081543 | 3300005577 | Bacteria | 2889 |
| 88 | Ga0068854_100062173 | 3300005578 | Bacteria | 2706 |
| 89 | Ga0068856_100159164 | 3300005614 | Bacteria | 2268 |
| 90 | Ga0068856_100164433 | 3300005614 | Bacteria | 2230 |
| 91 | Ga0068856_100756330 | 3300005614 | Bacteria | 992 |
| 92 | Ga0068852_100194651 | 3300005616 | Bacteria | 1915 |
| 93 | Ga0068852_100237716 | 3300005616 | Bacteria | 1739 |
| 94 | Ga0068859_100000747 | 3300005617 | Bacteria | 32789 |
| 95 | Ga0068859_100152130 | 3300005617 | Bacteria | 2389 |
| 96 | Ga0068859_100570884 | 3300005617 | Bacteria | 1225 |
| 97 | Ga0068864_100121216 | 3300005618 | Bacteria | 2338 |
| 98 | Ga0068866_10542664 | 3300005718 | Bacteria | 776 |
| 99 | Ga0068861_100070157 | 3300005719 | Bacteria | 2713 |
| 100 | Ga0068861_100148174 | 3300005719 | Bacteria | 1923 |
| 101 | Ga0068861_101527760 | 3300005719 | Bacteria | 656 |
| 102 | Ga0068851_10065211 | 3300005834 | Bacteria | 1873 |
| 103 | Ga0068863_100006424 | 3300005841 | Bacteria | 11527 |
| 104 | Ga0068863_100040925 | 3300005841 | Bacteria | 4405 |
| 105 | Ga0068863_100743855 | 3300005841 | Bacteria | 976 |
| 106 | Ga0068858_100001493 | 3300005842 | Bacteria | 24115 |
| 107 | Ga0068858_100220377 | 3300005842 | Bacteria | 1796 |
| 108 | Ga0068858_101448640 | 3300005842 | Bacteria | 677 |
| 109 | Ga0068860_100000327 | 3300005843 | Bacteria | 64590 |
| 110 | Ga0068860_100010879 | 3300005843 | Bacteria | 8972 |
| 111 | Ga0068860_100011682 | 3300005843 | Bacteria | 8657 |
| 112 | Ga0068860_100079176 | 3300005843 | Bacteria | 3124 |
| 113 | Ga0068862_100045557 | 3300005844 | Bacteria | 3742 |
| 114 | Ga0068862_100078594 | 3300005844 | Bacteria | 2859 |
| 115 | Ga0068862_100098778 | 3300005844 | Bacteria | 2551 |
| 116 | Ga0068862_100146853 | 3300005844 | Bacteria | 2096 |
| 117 | Ga0068862_100182050 | 3300005844 | Bacteria | 1886 |
| 118 | Ga0068862_101340721 | 3300005844 | Bacteria | 718 |
| 119 | Ga0081455_10272502 | 3300005937 | Bacteria | 1227 |
| 120 | Ga0081455_10999887 | 3300005937 | Bacteria | 518 |
| 121 | Ga0070717_10401334 | 3300006028 | Bacteria | 1232 |
| 122 | Ga0070717_10468739 | 3300006028 | Bacteria | 1136 |
| 123 | Ga0070717_11473513 | 3300006028 | Bacteria | 618 |
| 124 | Ga0075365_10001302 | 3300006038 | Bacteria | 11130 |
| 125 | Ga0075365_10237254 | 3300006038 | Bacteria | 1281 |
| 126 | Ga0075368_10176781 | 3300006042 | Bacteria | 899 |
| 127 | Ga0075363_100043635 | 3300006048 | Bacteria | 2373 |
| 128 | Ga0075363_100104157 | 3300006048 | Bacteria | 1572 |
| 129 | Ga0075363_100213751 | 3300006048 | Bacteria | 1104 |
| 130 | Ga0075364_10060971 | 3300006051 | Bacteria | 2473 |
| 131 | Ga0075364_10064139 | 3300006051 | Bacteria | 2411 |
| 132 | Ga0075364_10219204 | 3300006051 | Bacteria | 1291 |
| 133 | Ga0075364_10579879 | 3300006051 | Bacteria | 766 |
| 134 | Ga0070716_100156838 | 3300006173 | Bacteria | 1471 |
| 135 | Ga0070712_100937602 | 3300006175 | Bacteria | 747 |
| 136 | Ga0075362_10083515 | 3300006177 | Bacteria | 1475 |
| 137 | Ga0075362_10224686 | 3300006177 | Bacteria | 918 |
| 138 | Ga0075362_10412972 | 3300006177 | Bacteria | 682 |
| 139 | Ga0075367_10197226 | 3300006178 | Bacteria | 1257 |
| 140 | Ga0075367_10307993 | 3300006178 | Bacteria | 997 |
| 141 | Ga0075369_10004445 | 3300006186 | Bacteria | 5179 |
| 142 | Ga0075369_10263727 | 3300006186 | Bacteria | 801 |
| 143 | Ga0075366_10022642 | 3300006195 | Bacteria | 3657 |
| 144 | Ga0075366_10885451 | 3300006195 | Bacteria | 556 |
| 145 | Ga0075370_10158892 | 3300006353 | Bacteria | 1326 |
| 146 | Ga0075370_10203624 | 3300006353 | Bacteria | 1168 |
| 147 | Ga0075430_100640983 | 3300006846 | Bacteria | 876 |
| 148 | Ga0075434_100700968 | 3300006871 | Bacteria | 1030 |
| 149 | Ga0075436_100076118 | 3300006914 | Bacteria | 2324 |
| 150 | Ga0097620_100000747 | 3300006931 | Bacteria | 32789 |
| 151 | Ga0097620_100152118 | 3300006931 | Bacteria | 2389 |
| 152 | Ga0097620_100570908 | 3300006931 | Bacteria | 1225 |
| 153 | Ga0075435_100071610 | 3300007076 | Bacteria | 2830 |
| 154 | Ga0099795_10004776 | 3300007788 | Bacteria | 3532 |
| 155 | Ga0099795_10013504 | 3300007788 | Bacteria | 2509 |
| 156 | Ga0105240_10049464 | 3300009093 | Bacteria | 5305 |
| 157 | Ga0105240_10492145 | 3300009093 | Bacteria | 1365 |
| 158 | Ga0105240_11031718 | 3300009093 | Bacteria | 878 |
| 159 | Ga0105240_11664757 | 3300009093 | Bacteria | 667 |
| 160 | Ga0105245_10762026 | 3300009098 | Bacteria | 1004 |
| 161 | Ga0105245_10924969 | 3300009098 | Bacteria | 914 |
| 162 | Ga0105247_10018423 | 3300009101 | Bacteria | 4188 |
| 163 | Ga0105247_10682395 | 3300009101 | Bacteria | 771 |
| 164 | Ga0105247_11177633 | 3300009101 | Bacteria | 609 |
| 165 | Ga0114129_13418963 | 3300009147 | Bacteria | 510 |
| 166 | Ga0105243_11953741 | 3300009148 | Bacteria | 620 |
| 167 | Ga0105241_10246070 | 3300009174 | Bacteria | 1514 |
| 168 | Ga0105241_10260766 | 3300009174 | Bacteria | 1473 |
| 169 | Ga0105241_11172373 | 3300009174 | Bacteria | 726 |
| 170 | Ga0105242_10699611 | 3300009176 | Bacteria | 991 |
| 171 | Ga0105248_10016266 | 3300009177 | Bacteria | 8188 |
| 172 | Ga0105248_10326116 | 3300009177 | Bacteria | 1729 |
| 173 | Ga0105248_12535967 | 3300009177 | Bacteria | 584 |
| 174 | Ga0105237_11458609 | 3300009545 | Bacteria | 691 |
| 175 | Ga0105238_10709853 | 3300009551 | Bacteria | 1018 |
| 176 | Ga0105238_11250396 | 3300009551 | Bacteria | 768 |
| 177 | Ga0105238_11381458 | 3300009551 | Bacteria | 731 |
| 178 | Ga0105238_11735673 | 3300009551 | Bacteria | 656 |
| 179 | Ga0105249_12489638 | 3300009553 | Bacteria | 590 |
| 180 | Ga0099796_10004450 | 3300010159 | Bacteria | 3390 |
| 181 | Ga0099796_10028192 | 3300010159 | Bacteria | 1800 |
| 182 | Ga0105239_10868399 | 3300010375 | Bacteria | 1035 |
| 183 | Ga0105239_12218423 | 3300010375 | Bacteria | 639 |
| 184 | Ga0157319_1007429 | 3300012497 | Bacteria | 813 |
| 185 | Ga0157373_10013213 | 3300013100 | Bacteria | 6061 |
| 186 | Ga0157373_10031568 | 3300013100 | Bacteria | 3812 |
| 187 | Ga0157373_11206471 | 3300013100 | Bacteria | 570 |
| 188 | Ga0157371_10006560 | 3300013102 | Bacteria | 9568 |
| 189 | Ga0157371_10438399 | 3300013102 | Bacteria | 959 |
| 190 | Ga0157370_10014798 | 3300013104 | Bacteria | 7962 |
| 191 | Ga0157370_10070380 | 3300013104 | Bacteria | 3302 |
| 192 | Ga0157370_10108920 | 3300013104 | Bacteria | 2590 |
| 193 | Ga0157370_11602071 | 3300013104 | Bacteria | 585 |
| 194 | Ga0157369_10075280 | 3300013105 | Bacteria | 3620 |
| 195 | Ga0157369_10180493 | 3300013105 | Bacteria | 2221 |
| 196 | Ga0157369_11086359 | 3300013105 | Bacteria | 818 |
| 197 | Ga0163162_10041689 | 3300013306 | Bacteria | 4593 |
| 198 | Ga0163162_11108893 | 3300013306 | Bacteria | 897 |
| 199 | Ga0157375_13294465 | 3300013308 | Bacteria | 538 |
| 200 | Ga0163163_10003065 | 3300014325 | Bacteria | 14146 |
| 201 | Ga0163163_12489537 | 3300014325 | Bacteria | 576 |
| 202 | Ga0157380_10148851 | 3300014326 | Bacteria | 2021 |
| 203 | Ga0157380_10554161 | 3300014326 | Bacteria | 1128 |
| 204 | Ga0157380_11403009 | 3300014326 | Bacteria | 749 |
| 205 | Ga0157380_11893286 | 3300014326 | Bacteria | 657 |
| 206 | Ga0157380_12289991 | 3300014326 | Bacteria | 605 |
| 207 | Ga0182008_10055060 | 3300014497 | Bacteria | 1968 |
| 208 | Ga0157377_10986890 | 3300014745 | Bacteria | 637 |
| 209 | Ga0157377_11547987 | 3300014745 | Bacteria | 529 |
| 210 | Ga0157379_10002854 | 3300014968 | Bacteria | 14564 |
| 211 | Ga0157379_10268730 | 3300014968 | Bacteria | 1550 |
| 212 | Ga0183365_10001 | 3300015684 | Bacteria | 2090444 |
| 213 | Ga0163161_10245295 | 3300017792 | Bacteria | 1394 |
| 214 | Ga0163161_10283381 | 3300017792 | Bacteria | 1300 |
| 215 | Ga0163161_10878350 | 3300017792 | Bacteria | 758 |
| 216 | Ga0163161_11218984 | 3300017792 | Bacteria | 651 |
| 217 | Ga0197907_10101668 | 3300020069 | Bacteria | 568 |
| 218 | Ga0213873_10279390 | 3300021358 | Bacteria | 535 |
| 219 | Ga0213872_10134824 | 3300021361 | Bacteria | 1086 |
| 220 | Ga0213876_10304202 | 3300021384 | Bacteria | 848 |
| 221 | Ga0213875_10166063 | 3300021388 | Bacteria | 1036 |
| 222 | Ga0213871_10094641 | 3300021441 | Unclassified | 869 |
| 223 | Ga0224712_10143637 | 3300022467 | Bacteria | 1052 |
| 224 | Ga0207427_101305 | 3300025231 | Bacteria | 9393 |
| 225 | Ga0209026_1005069 | 3300025250 | Bacteria | 3661 |
| 226 | Ga0209148_1029566 | 3300025254 | Bacteria | 826 |
| 227 | Ga0209148_1031523 | 3300025254 | Bacteria | 786 |
| 228 | Ga0209148_1049496 | 3300025254 | Bacteria | 547 |
| 229 | Ga0209233_1003261 | 3300025261 | Bacteria | 5754 |
| 230 | Ga0209676_1000046 | 3300025292 | Bacteria | 409173 |
| 231 | Ga0209676_1000163 | 3300025292 | Bacteria | 157845 |
| 232 | Ga0209676_1000188 | 3300025292 | Bacteria | 141232 |
| 233 | Ga0209676_1004867 | 3300025292 | Bacteria | 7269 |
| 234 | Ga0209564_1000031 | 3300025295 | Bacteria | 494703 |
| 235 | Ga0209758_1002155 | 3300025297 | Bacteria | 20717 |
| 236 | Ga0209050_1001123 | 3300025298 | Bacteria | 32326 |
| 237 | Ga0209050_1001136 | 3300025298 | Bacteria | 32037 |
| 238 | Ga0209050_1001523 | 3300025298 | Bacteria | 24437 |
| 239 | Ga0209050_1005527 | 3300025298 | Bacteria | 7897 |
| 240 | Ga0209256_1001496 | 3300025299 | Bacteria | 23700 |
| 241 | Ga0209256_1035465 | 3300025299 | Bacteria | 1318 |
| 242 | Ga0209051_1003588 | 3300025303 | Bacteria | 10093 |
| 243 | Ga0209257_1000370 | 3300025304 | Bacteria | 90934 |
| 244 | Ga0209257_1000409 | 3300025304 | Bacteria | 83301 |
| 245 | Ga0209257_1001224 | 3300025304 | Bacteria | 32015 |
| 246 | Ga0209257_1002160 | 3300025304 | Bacteria | 20420 |
| 247 | Ga0209257_1007513 | 3300025304 | Bacteria | 6555 |
| 248 | Ga0207682_10285371 | 3300025893 | Bacteria | 772 |
| 249 | Ga0207692_10229843 | 3300025898 | Bacteria | 1103 |
| 250 | Ga0207692_11176754 | 3300025898 | Bacteria | 509 |
| 251 | Ga0207710_10100034 | 3300025900 | Bacteria | 1366 |
| 252 | Ga0207688_10037428 | 3300025901 | Bacteria | 2691 |
| 253 | Ga0207680_10089091 | 3300025903 | Bacteria | 1958 |
| 254 | Ga0207680_10471894 | 3300025903 | Bacteria | 892 |
| 255 | Ga0207680_10550636 | 3300025903 | Bacteria | 824 |
| 256 | Ga0207699_10164444 | 3300025906 | Bacteria | 1480 |
| 257 | Ga0207699_10713343 | 3300025906 | Bacteria | 734 |
| 258 | Ga0207705_10679667 | 3300025909 | Bacteria | 800 |
| 259 | Ga0207684_10510356 | 3300025910 | Bacteria | 1030 |
| 260 | Ga0207654_10183940 | 3300025911 | Bacteria | 1365 |
| 261 | Ga0207707_10021959 | 3300025912 | Bacteria | 5578 |
| 262 | Ga0207695_10012854 | 3300025913 | Bacteria | 10022 |
| 263 | Ga0207695_10388088 | 3300025913 | Bacteria | 1281 |
| 264 | Ga0207693_10039298 | 3300025915 | Bacteria | 3726 |
| 265 | Ga0207693_10294563 | 3300025915 | Bacteria | 1271 |
| 266 | Ga0207660_10018742 | 3300025917 | Bacteria | 4619 |
| 267 | Ga0207646_10007709 | 3300025922 | Bacteria | 10895 |
| 268 | Ga0207681_10027072 | 3300025923 | Bacteria | 3704 |
| 269 | Ga0207694_10021272 | 3300025924 | Bacteria | 4915 |
| 270 | Ga0207650_10072640 | 3300025925 | Bacteria | 2589 |
| 271 | Ga0207687_11190614 | 3300025927 | Bacteria | 655 |
| 272 | Ga0207700_10045252 | 3300025928 | Bacteria | 3246 |
| 273 | Ga0207700_10254205 | 3300025928 | Bacteria | 1502 |
| 274 | Ga0207700_10384772 | 3300025928 | Bacteria | 1227 |
| 275 | Ga0207664_11984201 | 3300025929 | Bacteria | 505 |
| 276 | Ga0207644_10006651 | 3300025931 | Bacteria | 7534 |
| 277 | Ga0207644_10105263 | 3300025931 | Bacteria | 2125 |
| 278 | Ga0207690_11488251 | 3300025932 | Bacteria | 566 |
| 279 | Ga0207686_10491576 | 3300025934 | Bacteria | 951 |
| 280 | Ga0207709_10402871 | 3300025935 | Bacteria | 1046 |
| 281 | Ga0207669_11498392 | 3300025937 | Bacteria | 575 |
| 282 | Ga0207665_10036574 | 3300025939 | Bacteria | 3266 |
| 283 | Ga0207691_10830856 | 3300025940 | Bacteria | 775 |
| 284 | Ga0207711_10007833 | 3300025941 | Bacteria | 8930 |
| 285 | Ga0207689_11280218 | 3300025942 | Bacteria | 616 |
| 286 | Ga0207661_11375989 | 3300025944 | Bacteria | 648 |
| 287 | Ga0207679_10082560 | 3300025945 | Bacteria | 2461 |
| 288 | Ga0207667_10156302 | 3300025949 | Bacteria | 2346 |
| 289 | Ga0207651_10689479 | 3300025960 | Bacteria | 899 |
| 290 | Ga0207668_10000001 | 3300025972 | Bacteria | 266091 |
| 291 | Ga0207668_10000788 | 3300025972 | Bacteria | 19416 |
| 292 | Ga0207668_10009607 | 3300025972 | Bacteria | 5806 |
| 293 | Ga0207668_10050913 | 3300025972 | Bacteria | 2857 |
| 294 | Ga0207668_10059647 | 3300025972 | Bacteria | 2674 |
| 295 | Ga0207640_10048386 | 3300025981 | Bacteria | 2748 |
| 296 | Ga0207640_10178730 | 3300025981 | Bacteria | 1589 |
| 297 | Ga0207658_10033729 | 3300025986 | Bacteria | 3653 |
| 298 | Ga0207658_10281603 | 3300025986 | Bacteria | 1425 |
| 299 | Ga0207658_10428118 | 3300025986 | Bacteria | 1168 |
| 300 | Ga0207658_10480879 | 3300025986 | Bacteria | 1103 |
| 301 | Ga0207658_10685955 | 3300025986 | Bacteria | 925 |
| 302 | Ga0207658_11241639 | 3300025986 | Bacteria | 681 |
| 303 | Ga0207703_10000853 | 3300026035 | Bacteria | 29885 |
| 304 | Ga0207703_10398734 | 3300026035 | Bacteria | 1276 |
| 305 | Ga0207703_10685681 | 3300026035 | Bacteria | 974 |
| 306 | Ga0207639_10028193 | 3300026041 | Bacteria | 4098 |
| 307 | Ga0207708_11747807 | 3300026075 | Bacteria | 546 |
| 308 | Ga0207702_10014179 | 3300026078 | Bacteria | 6621 |
| 309 | Ga0207702_10382189 | 3300026078 | Bacteria | 1354 |
| 310 | Ga0207702_11670649 | 3300026078 | Bacteria | 630 |
| 311 | Ga0207641_10009231 | 3300026088 | Bacteria | 8134 |
| 312 | Ga0207641_10547196 | 3300026088 | Bacteria | 1128 |
| 313 | Ga0207641_12231524 | 3300026088 | Bacteria | 547 |
| 314 | Ga0207676_11316255 | 3300026095 | Bacteria | 717 |
| 315 | Ga0207674_10014006 | 3300026116 | Bacteria | 8864 |
| 316 | Ga0207674_11494785 | 3300026116 | Bacteria | 645 |
| 317 | Ga0207675_100123248 | 3300026118 | Bacteria | 2454 |
| 318 | Ga0207675_100150277 | 3300026118 | Bacteria | 2216 |
| 319 | Ga0207675_100560868 | 3300026118 | Bacteria | 1142 |
| 320 | Ga0207675_102072416 | 3300026118 | Bacteria | 586 |
| 321 | Ga0207683_10559549 | 3300026121 | Bacteria | 1057 |
| 322 | Ga0207698_10238154 | 3300026142 | Bacteria | 1656 |
| 323 | Ga0209179_1014467 | 3300027512 | Bacteria | 1449 |
| 324 | Ga0209813_10107888 | 3300027866 | Bacteria | 955 |
| 325 | Ga0209974_10082854 | 3300027876 | Bacteria | 1106 |
| 326 | Ga0268266_10000289 | 3300028379 | Bacteria | 82515 |
| 327 | Ga0268266_10515013 | 3300028379 | Bacteria | 1143 |
| 328 | Ga0268265_10009694 | 3300028380 | Bacteria | 6500 |
| 329 | Ga0268265_10032194 | 3300028380 | Bacteria | 3796 |
| 330 | Ga0268265_10034718 | 3300028380 | Bacteria | 3678 |
| 331 | Ga0268265_10038125 | 3300028380 | Bacteria | 3533 |
| 332 | Ga0268265_10047612 | 3300028380 | Bacteria | 3214 |
| 333 | Ga0268265_10129127 | 3300028380 | Bacteria | 2097 |
| 334 | Ga0268265_10672417 | 3300028380 | Bacteria | 997 |
| 335 | Ga0268265_11285093 | 3300028380 | Bacteria | 731 |
| 336 | Ga0268264_10000002 | 3300028381 | Bacteria | 1153045 |
| 337 | Ga0268264_10004796 | 3300028381 | Bacteria | 11473 |
| 338 | Ga0268264_10091280 | 3300028381 | Bacteria | 2627 |
| 339 | Ga0268264_10266544 | 3300028381 | Bacteria | 1598 |
| 340 | Ga0268264_10964839 | 3300028381 | Bacteria | 858 |
| 341 | Ga0268264_11161231 | 3300028381 | Bacteria | 781 |
| 342 | Ga0307517_10457111 | 3300028786 | Bacteria | 660 |
| 343 | Ga0307517_10502388 | 3300028786 | Bacteria | 617 |
| 344 | Ga0307515_10813774 | 3300028794 | Bacteria | 558 |
| 345 | Ga0265338_10485315 | 3300028800 | Bacteria | 871 |
| 346 | Ga0265338_10773414 | 3300028800 | Bacteria | 659 |
| 347 | Ga0265324_10031472 | 3300029957 | Bacteria | 1858 |
| 348 | Ga0265770_1075487 | 3300030878 | Bacteria | 651 |
| 349 | Ga0265328_10236457 | 3300031239 | Bacteria | 698 |
| 350 | Ga0265331_10183531 | 3300031250 | Bacteria | 945 |
| 351 | Ga0265327_10001376 | 3300031251 | Bacteria | 31183 |
| 352 | Ga0265327_10004207 | 3300031251 | Bacteria | 12935 |
| 353 | Ga0265316_11299408 | 3300031344 | Bacteria | 502 |
| 354 | Ga0307513_10000127 | 3300031456 | Bacteria | 107100 |
| 355 | Ga0307513_10158741 | 3300031456 | Bacteria | 2157 |
| 356 | Ga0307408_100457312 | 3300031548 | Bacteria | 1109 |
| 357 | Ga0265314_10083450 | 3300031711 | Bacteria | 2100 |
| 358 | Ga0307516_10000035 | 3300031730 | Bacteria | 152658 |
| 359 | Ga0307405_10336935 | 3300031731 | Bacteria | 1158 |
| 360 | Ga0307405_10893790 | 3300031731 | Bacteria | 751 |
| 361 | Ga0307413_10285044 | 3300031824 | Bacteria | 1244 |
| 362 | Ga0307413_10318329 | 3300031824 | Bacteria | 1187 |
| 363 | Ga0307413_10811507 | 3300031824 | Bacteria | 787 |
| 364 | Ga0307413_10847992 | 3300031824 | Bacteria | 772 |
| 365 | Ga0307413_11481006 | 3300031824 | Bacteria | 599 |
| 366 | Ga0307413_11806698 | 3300031824 | Bacteria | 547 |
| 367 | Ga0307410_11081204 | 3300031852 | Bacteria | 695 |
| 368 | Ga0307406_10008219 | 3300031901 | Bacteria | 5816 |
| 369 | Ga0307406_10044106 | 3300031901 | Bacteria | 2794 |
| 370 | Ga0307406_10938816 | 3300031901 | Bacteria | 739 |
| 371 | Ga0307412_10103883 | 3300031911 | Bacteria | 2015 |
| 372 | Ga0307412_10169917 | 3300031911 | Bacteria | 1629 |
| 373 | Ga0307412_10420421 | 3300031911 | Bacteria | 1093 |
| 374 | Ga0307409_101869999 | 3300031995 | Bacteria | 630 |
| 375 | Ga0307416_100957699 | 3300032002 | Bacteria | 958 |
| 376 | Ga0307414_10049981 | 3300032004 | Bacteria | 2894 |
| 377 | Ga0307414_10089771 | 3300032004 | Bacteria | 2278 |
| 378 | Ga0307414_10092398 | 3300032004 | Bacteria | 2252 |
| 379 | Ga0307414_10202473 | 3300032004 | Bacteria | 1616 |
| 380 | Ga0307414_10218078 | 3300032004 | Bacteria | 1564 |
| 381 | Ga0307414_10315927 | 3300032004 | Bacteria | 1327 |
| 382 | Ga0307414_10404496 | 3300032004 | Bacteria | 1186 |
| 383 | Ga0307414_10452242 | 3300032004 | Bacteria | 1126 |
| 384 | Ga0307414_10700980 | 3300032004 | Bacteria | 916 |
| 385 | Ga0307414_11221157 | 3300032004 | Bacteria | 696 |
| 386 | Ga0307414_11776761 | 3300032004 | Bacteria | 575 |
| 387 | Ga0307414_11942081 | 3300032004 | Bacteria | 549 |
| 388 | Ga0307411_10555384 | 3300032005 | Bacteria | 980 |
| 389 | Ga0307411_11523166 | 3300032005 | Bacteria | 615 |
| 390 | Ga0307411_12344798 | 3300032005 | Bacteria | 502 |
| 391 | Ga0307415_101521253 | 3300032126 | Bacteria | 641 |
| 392 | Ga0373950_0035310 | 3300034818 | Bacteria | 940 |
| 393 | Ga0373928_0192667 | 3300035084 | Bacteria | 584 |
| 394 | Ga0373929_0151606 | 3300035085 | Bacteria | 622 |
| 395 | Ga0373932_0016559 | 3300035112 | Bacteria | 1883 |
| 396 | Ga0373941_0019225 | 3300035115 | Bacteria | 1899 |
| 397 | Ga0373960_0028255 | 3300035121 | Bacteria | 1546 |
| 398 | Ga0373943_0044266 | 3300035170 | Bacteria | 2166 |
| 399 | Ga0373946_0275986 | 3300035171 | Bacteria | 826 |
| 400 | Ga0373961_0188346 | 3300035241 | Bacteria | 722 |
| 401 | Ga0373962_0013376 | 3300035242 | Bacteria | 2078 |
| 402 | Ga0373931_0003958 | 3300035691 | Bacteria | 6707 |
| 403 | Ga0373931_0046009 | 3300035691 | Bacteria | 2306 |
| 404 | Ga0373931_0513793 | 3300035691 | Bacteria | 774 |
| 405 | Ga0373935_0428854 | 3300035692 | Bacteria | 953 |
| 406 | Ga0373927_0633406 | 3300035695 | Bacteria | 707 |
| 407 | Ga0373927_0872616 | 3300035695 | Bacteria | 594 |
| 408 | Ga0373947_0073967 | 3300035725 | Bacteria | 2095 |
| 409 | Ga0373925_0890870 | 3300037068 | Bacteria | 733 |
| 410 | Ga0373925_1288224 | 3300037068 | Bacteria | 600 |
| 411 | Ga0395899_0078988 | 3300037312 | Bacteria | 2397 |
| 412 | Ga0395899_0168195 | 3300037312 | Bacteria | 1545 |
| 413 | Ga0395899_0233273 | 3300037312 | Bacteria | 1270 |
| 414 | Ga0395899_0739223 | 3300037312 | Bacteria | 613 |
| 415 | Ga0395900_0992964 | 3300037418 | Bacteria | 760 |
| 416 | Ga0395898_0126973 | 3300037466 | Bacteria | 2443 |
| 417 | Ga0395905_0000074 | 3300037471 | Bacteria | 167312 |
| 418 | Ga0395905_0038011 | 3300037471 | Bacteria | 4516 |
| 419 | Ga0395905_0261644 | 3300037471 | Bacteria | 1615 |
| 420 | Ga0395905_1268934 | 3300037471 | Bacteria | 640 |
| 421 | Ga0395905_1325201 | 3300037471 | Bacteria | 624 |
| 422 | Ga0436364_0024094 | 3300037853 | Bacteria | 578 |
| 423 | Ga0436364_0105293 | 3300037853 | Bacteria | 2010 |
| 424 | Ga0436364_0494145 | 3300037853 | Bacteria | 2475 |
| 425 | Ga0395901_0415239 | 3300038443 | Bacteria | 1381 |
| 426 | Ga0395901_1589395 | 3300038443 | Bacteria | 607 |
| 427 | Ga0395901_1777805 | 3300038443 | Bacteria | 566 |
| 428 | Ga0395901_1805916 | 3300038443 | Bacteria | 560 |
| 429 | Ga0436365_1205169 | 3300039437 | Bacteria | 1109 |
| 430 | Ga0436365_1302237 | 3300039437 | Bacteria | 1024 |
| 431 | Ga0436365_1302431 | 3300039437 | Bacteria | 1261 |
| 432 | Ga0436365_1869211 | 3300039437 | Bacteria | 2482 |
| 433 | Ga0436360_0352378 | 3300039438 | Unclassified | 1156 |
| 434 | Ga0436360_0397582 | 3300039438 | Bacteria | 571 |
| 435 | Ga0436360_0444055 | 3300039438 | Unclassified | 530 |
| 436 | Ga0436360_0610713 | 3300039438 | Bacteria | 513 |
| 437 | Ga0436360_1069376 | 3300039438 | Unclassified | 645 |
| 438 | Ga0436361_0673108 | 3300039447 | Bacteria | 1480 |
| 439 | Ga0436361_0992022 | 3300039447 | Bacteria | 1675 |
| 440 | Ga0436363_1161045 | 3300039450 | Bacteria | 520 |
| 441 | Ga0436362_0307500 | 3300039453 | Bacteria | 747 |
| 442 | Ga0436362_0390765 | 3300039453 | Bacteria | 2615 |
| 443 | Ga0436362_0631106 | 3300039453 | Bacteria | 637 |
| 444 | Ga0436362_1292192 | 3300039453 | Unclassified | 662 |
| 445 | Ga0451789_0073144 | 3300041443 | Bacteria | 518 |
| 446 | Ga0451791_0190273 | 3300041451 | Bacteria | 1198 |
| 447 | Ga0451793_0577158 | 3300041452 | Bacteria | 533 |
| 448 | Ga0451798_0271510 | 3300041458 | Bacteria | 674 |
| 449 | Ga0451806_874067 | 3300041462 | Bacteria | 630 |
| 450 | Ga0451807_0142948 | 3300041486 | Bacteria | 547 |
| 451 | Ga0451807_1860837 | 3300041486 | Bacteria | 1059 |
| 452 | Ga0451807_2662128 | 3300041486 | Bacteria | 528 |
| 453 | Ga0451837_1558520 | 3300041494 | Bacteria | 999 |
| 454 | Ga0451837_1691330 | 3300041494 | Bacteria | 658 |
| 455 | Ga0451843_0161838 | 3300041509 | Bacteria | 502 |
| 456 | Ga0451855_0842537 | 3300041511 | Bacteria | 508 |
| 457 | Ga0451853_0267609 | 3300041512 | Bacteria | 567 |
| 458 | Ga0450896_049242 | 3300042133 | Bacteria | 669 |
| 459 | Ga0450900_077914 | 3300042136 | Bacteria | 530 |
| 460 | Ga0439459_0173159 | 3300042438 | Bacteria | 576 |
| 461 | Ga0450901_003323 | 3300042533 | Bacteria | 1686 |
| 462 | Ga0451577_1762069 | 3300042876 | Bacteria | 544 |
| 463 | Ga0466972_0100400 | 3300044658 | Bacteria | 1370 |
| 464 | Ga0466966_0570447 | 3300044684 | Bacteria | 681 |
| 465 | Ga0466961_0198278 | 3300044693 | Bacteria | 1242 |
| 466 | Ga0466959_0180480 | 3300045049 | Bacteria | 1477 |
| 467 | Ga0466959_0399455 | 3300045049 | Bacteria | 934 |
| 468 | Ga0495627_168304 | 3300046453 | Bacteria | 609 |
| 469 | Ga0495638_0050607 | 3300046460 | Bacteria | 2594 |
| 470 | Ga0495651_0919943 | 3300046462 | Bacteria | 534 |
| 471 | Ga0495650_0200916 | 3300046471 | Bacteria | 693 |
| 472 | Ga0495580_0030065 | 3300046472 | Bacteria | 3936 |
| 473 | Ga0495610_0386777 | 3300046512 | Bacteria | 519 |
| 474 | Ga0495654_0332891 | 3300046530 | Bacteria | 614 |
| 475 | Ga0495633_0005158 | 3300046558 | Bacteria | 8091 |
| 476 | Ga0495633_0345603 | 3300046558 | Bacteria | 674 |
| 477 | Ga0495668_0101432 | 3300046616 | Bacteria | 1574 |
| 478 | Ga0495668_0109638 | 3300046616 | Bacteria | 1510 |
| 479 | Ga0495668_0137104 | 3300046616 | Bacteria | 1339 |
| 480 | Ga0495668_0413029 | 3300046616 | Bacteria | 742 |
| 481 | Ga0495625_0022857 | 3300046660 | Bacteria | 4784 |
| 482 | Ga0495671_0105539 | 3300046692 | Bacteria | 1376 |
| 483 | Ga0495672_0000570 | 3300047320 | Bacteria | 41708 |
| 484 | Ga0495673_0000905 | 3300047469 | Bacteria | 27167 |
| 485 | Ga0495686_0027673 | 3300047472 | Bacteria | 3700 |
| 486 | Ga0496102_0724079 | 3300048905 | Bacteria | 918 |
| 487 | Ga0496102_1198350 | 3300048905 | Bacteria | 679 |
| 488 | Ga0496104_0302469 | 3300048907 | Bacteria | 1512 |
| 489 | Ga0496110_0319583 | 3300048913 | Bacteria | 1414 |
| 490 | Ga0496110_1017762 | 3300048913 | Bacteria | 736 |
| 491 | Ga0496110_1037305 | 3300048913 | Bacteria | 728 |
| 492 | Ga0496113_0181823 | 3300048916 | Bacteria | 1667 |
| 493 | Ga0496113_1337411 | 3300048916 | Bacteria | 556 |
| 494 | Ga0496114_1556723 | 3300048917 | Bacteria | 549 |
| 495 | Ga0496115_0246775 | 3300048918 | Bacteria | 1471 |
| 496 | Ga0496115_0375408 | 3300048918 | Bacteria | 1157 |
| 497 | Ga0496116_0057554 | 3300048919 | Bacteria | 2541 |
| 498 | Ga0496121_0502688 | 3300048924 | Bacteria | 769 |
| 499 | Ga0496122_0006991 | 3300048925 | Bacteria | 12705 |
| 500 | Ga0496123_0000512 | 3300048926 | Bacteria | 67458 |
| 501 | Ga0496123_0234352 | 3300048926 | Bacteria | 916 |
| 502 | Ga0496124_0479513 | 3300048927 | Bacteria | 840 |
| 503 | Ga0496125_0002197 | 3300048928 | Bacteria | 26053 |
| 504 | Ga0496126_0193760 | 3300048929 | Bacteria | 1720 |
| 505 | Ga0496126_0473775 | 3300048929 | Bacteria | 1004 |
| 506 | Ga0496126_0488378 | 3300048929 | Bacteria | 986 |
| 507 | Ga0496126_0686209 | 3300048929 | Bacteria | 797 |
| 508 | Ga0501306_019854 | 3300049127 | Bacteria | 930 |
| 509 | Ga0501305_034138 | 3300049161 | Bacteria | 805 |
| 510 | Ga0501307_015986 | 3300049162 | Bacteria | 932 |
| 511 | Ga0501034_0037721 | 3300049571 | Bacteria | 4895 |
| 512 | Ga0501034_0097931 | 3300049571 | Bacteria | 2929 |
| 513 | Ga0501034_0583930 | 3300049571 | Bacteria | 1024 |
| 514 | Ga0501043_0148599 | 3300049579 | Bacteria | 1834 |
| 515 | Ga0501043_0220089 | 3300049579 | Bacteria | 1469 |
| 516 | Ga0501047_0462790 | 3300049581 | Bacteria | 1097 |
| 517 | Ga0501047_1132910 | 3300049581 | Bacteria | 596 |
| 518 | Ga0501070_0715790 | 3300049586 | Bacteria | 791 |
| 519 | Ga0501073_0173020 | 3300049589 | Bacteria | 1495 |
| 520 | Ga0501073_0456133 | 3300049589 | Bacteria | 884 |
| 521 | Ga0501075_0183626 | 3300049591 | Bacteria | 1596 |
| 522 | Ga0501076_0692802 | 3300049592 | Bacteria | 841 |
| 523 | Ga0501249_000314 | 3300049679 | Bacteria | 13443 |
| 524 | Ga0501257_035690 | 3300049686 | Bacteria | 1209 |
| 525 | Ga0501035_0012306 | 3300049822 | Bacteria | 7911 |
| 526 | Ga0501035_0280469 | 3300049822 | Bacteria | 1408 |
| 527 | Ga0501044_0346039 | 3300049823 | Bacteria | 1407 |
| 528 | Ga0501044_1183000 | 3300049823 | Bacteria | 633 |
| 529 | Ga0501204_029066 | 3300049850 | Bacteria | 759 |
| 530 | Ga0501220_03002 | 3300049852 | Bacteria | 722 |
| 531 | nmdc:mga03683_147569_c1 | 3300050489 | Bacteria | 1060 |
| 532 | nmdc:mga03683_249541_c1 | 3300050489 | Bacteria | 824 |
| 533 | nmdc:mga03n38_172095_c1 | 3300050490 | Bacteria | 1104 |
| 534 | nmdc:mga03n38_71366_c1 | 3300050490 | Bacteria | 1608 |
| 535 | nmdc:mga00v17_149244_c1 | 3300050491 | Bacteria | 1501 |
| 536 | nmdc:mga00v17_86131_c1 | 3300050491 | Bacteria | 1968 |
| 537 | nmdc:mga00v17_8625_c1 | 3300050491 | Bacteria | 5489 |
| 538 | nmdc:mga0yw44_9633_c1 | 3300050492 | Bacteria | 4899 |
| 539 | nmdc:mga0k408_41152_c1 | 3300050493 | Bacteria | 2660 |
| 540 | nmdc:mga06z11_168624_c1 | 3300050494 | Bacteria | 1256 |
| 541 | nmdc:mga06z11_659071_c1 | 3300050494 | Bacteria | 637 |
| 542 | nmdc:mga04h51_127061_c1 | 3300050495 | Bacteria | 955 |
| 543 | nmdc:mga07m45_476004_c1 | 3300050496 | Bacteria | 724 |
| 544 | nmdc:mga0qj67_1187378_c1 | 3300050509 | Bacteria | 594 |
| 545 | nmdc:mga0rr50_100378_c1 | 3300050513 | Bacteria | 2273 |
| 546 | nmdc:mga08x19_290106_c1 | 3300050514 | Bacteria | 1135 |
| 547 | nmdc:mga0sz30_42011_c1 | 3300050516 | Bacteria | 1923 |
| 548 | nmdc:mga0sz30_438554_c1 | 3300050516 | Bacteria | 586 |
| 549 | Ga0500635_0000422 | 3300053080 | Bacteria | 12500 |
| 550 | Ga0500578_0489174 | 3300053086 | Bacteria | 694 |
| 551 | Ga0500643_002598 | 3300053087 | Bacteria | 9162 |
| 552 | Ga0500643_005164 | 3300053087 | Bacteria | 5695 |
| 553 | Ga0500643_011017 | 3300053087 | Bacteria | 3327 |
| 554 | Ga0500643_017450 | 3300053087 | Bacteria | 2403 |
| 555 | Ga0500643_043970 | 3300053087 | Bacteria | 1301 |
| 556 | Ga0500643_096979 | 3300053087 | Bacteria | 801 |
| 557 | Ga0500644_0000538 | 3300053088 | Bacteria | 15641 |
| 558 | Ga0500644_0005614 | 3300053088 | Bacteria | 3173 |
| 559 | Ga0500646_0089107 | 3300053090 | Bacteria | 952 |
| 560 | Ga0500647_0003244 | 3300053091 | Bacteria | 6301 |
| 561 | Ga0500651_0023820 | 3300053093 | Bacteria | 3835 |
| 562 | Ga0500651_0155363 | 3300053093 | Bacteria | 1371 |
| 563 | Ga0500641_0000911 | 3300053096 | Bacteria | 10559 |
| 564 | Ga0500641_0001879 | 3300053096 | Bacteria | 7457 |
| 565 | Ga0500556_0002706 | 3300053104 | Bacteria | 5486 |
| 566 | Ga0500562_000413 | 3300053108 | Bacteria | 10379 |
| 567 | Ga0500569_301107 | 3300053109 | Bacteria | 539 |
| 568 | Ga0500572_000338 | 3300053111 | Bacteria | 16833 |
| 569 | Ga0500608_000027 | 3300053122 | Bacteria | 66998 |
| 570 | Ga0500608_000115 | 3300053122 | Bacteria | 33075 |
| 571 | Ga0500614_135923 | 3300053123 | Bacteria | 733 |
| 572 | Ga0500618_006992 | 3300053125 | Bacteria | 3259 |
| 573 | Ga0500559_0068723 | 3300053136 | Bacteria | 1592 |
| 574 | Ga0500559_0129567 | 3300053136 | Bacteria | 1178 |
| 575 | Ga0500559_0216386 | 3300053136 | Bacteria | 904 |
| 576 | Ga0500564_000352 | 3300053138 | Bacteria | 12948 |
| 577 | Ga0500568_0215613 | 3300053139 | Bacteria | 702 |
| 578 | Ga0500574_115977 | 3300053141 | Bacteria | 793 |
| 579 | Ga0500590_065546 | 3300053148 | Bacteria | 1816 |
| 580 | Ga0500604_0043280 | 3300053151 | Bacteria | 1368 |
| 581 | Ga0500616_0006408 | 3300053153 | Bacteria | 7714 |
| 582 | Ga0500616_0063347 | 3300053153 | Bacteria | 1907 |
| 583 | Ga0500622_0077075 | 3300053156 | Bacteria | 1675 |
| 584 | Ga0500624_000064 | 3300053157 | Bacteria | 65293 |
| 585 | Ga0500636_0000932 | 3300053177 | Bacteria | 15727 |
| 586 | Ga0500636_0015974 | 3300053177 | Bacteria | 4425 |
| 587 | Ga0500611_205814 | 3300053727 | Unclassified | 558 |
| 588 | Ga0500645_002360 | 3300053730 | Bacteria | 8508 |
| 589 | Ga0500645_009677 | 3300053730 | Bacteria | 3228 |
| 590 | Ga0500645_075558 | 3300053730 | Bacteria | 964 |
| 591 | Ga0501084_0550938 | 3300054114 | Bacteria | 974 |
| 592 | Ga0501084_0963631 | 3300054114 | Bacteria | 717 |
| 593 | Ga0500661_011784 | 3300055283 | Bacteria | 1581 |
| 594 | Ga0587070_085131 | 3300059491 | Bacteria | 701 |
| 595 | Ga0587067_136638 | 3300059640 | Bacteria | 603 |
| 596 | Ga0587114_074328 | 3300059655 | Bacteria | 621 |
| 597 | Ga0501082_0000974 | 3300060353 | Bacteria | 25286 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006051 | Ga0075364_10579879 | Ga0075364_105798792 | 72 |
| 2 | 3300010375 | Ga0105239_10868399 | Ga0105239_108683992 | 72 |
| 3 | 3300013105 | Ga0157369_11086359 | Ga0157369_110863591 | 72 |
| 4 | 3300039450 | Ga0436363_1161045 | Ga0436363_1161045_78_377 | 72 |
| 5 | iso_pu_bacteria | 2595698237 | 2596374536 | 72 |
| 6 | iso_pu_bacteria | 2889306138 | 2889310510 | 72 |
| 7 | iso_pu_bacteria | 2902330777 | 2902335727 | 72 |
| 8 | iso_pu_bacteria | 2902405164 | 2902405821 | 72 |
| 9 | iso_pu_bacteria | 2928125067 | 2928125168 | 72 |
| 10 | 3300003316 | rootH1_10153469 | rootH1_101534692 | 73 |
| 11 | 3300005329 | Ga0070683_100414316 | Ga0070683_1004143161 | 73 |
| 12 | 3300005367 | Ga0070667_100333278 | Ga0070667_1003332782 | 73 |
| 13 | 3300005441 | Ga0070700_101013400 | Ga0070700_1010134002 | 73 |
| 14 | 3300009551 | Ga0105238_11381458 | Ga0105238_113814582 | 73 |
| 15 | 3300010375 | Ga0105239_12218423 | Ga0105239_122184231 | 73 |
| 16 | 3300013306 | Ga0163162_11108893 | Ga0163162_111088932 | 73 |
| 17 | 3300014325 | Ga0163163_12489537 | Ga0163163_124895371 | 73 |
| 18 | 3300014326 | Ga0157380_10148851 | Ga0157380_101488513 | 73 |
| 19 | 3300017792 | Ga0163161_10878350 | Ga0163161_108783502 | 73 |
| 20 | 3300025901 | Ga0207688_10037428 | Ga0207688_100374284 | 73 |
| 21 | 3300025927 | Ga0207687_11190614 | Ga0207687_111906141 | 73 |
| 22 | 3300025986 | Ga0207658_10281603 | Ga0207658_102816033 | 73 |
| 23 | 3300026075 | Ga0207708_11747807 | Ga0207708_117478071 | 73 |
| 24 | 3300041462 | Ga0451806_874067 | Ga0451806_874067_291_566 | 73 |
| 25 | 3300042876 | Ga0451577_1762069 | Ga0451577_1762069_229_459 | 73 |
| 26 | iso_pu_bacteria | 641522639 | 641644468 | 73 |
| 27 | iso_pu_bacteria | 643348564 | 643601008 | 73 |
| 28 | 3300003215 | JGI25153J46596_10086969 | JGI25153J46596_100869691 | 74 |
| 29 | 3300003320 | rootH2_10010501 | rootH2_100105012 | 74 |
| 30 | 3300003320 | rootH2_10020043 | rootH2_100200434 | 74 |
| 31 | 3300003323 | rootH1_10022222 | rootH1_100222226 | 74 |
| 32 | 3300003323 | rootH1_10027576 | rootH1_100275762 | 74 |
| 33 | 3300003323 | rootH1_10136079 | rootH1_101360792 | 74 |
| 34 | 3300003323 | rootH1_10156035 | rootH1_101560352 | 74 |
| 35 | 3300003323 | rootH1_10181512 | rootH1_101815122 | 74 |
| 36 | 3300003775 | Ga0055524_1015750 | Ga0055524_10157502 | 74 |
| 37 | 3300003791 | Ga0055530_10000571 | Ga0055530_1000057118 | 74 |
| 38 | 3300003794 | Ga0055531_10008699 | Ga0055531_100086997 | 74 |
| 39 | 3300003794 | Ga0055531_10042677 | Ga0055531_100426772 | 74 |
| 40 | 3300004625 | Ga0055543_1052995 | Ga0055543_10529952 | 74 |
| 41 | 3300005262 | Ga0065165_1003949 | Ga0065165_10039494 | 74 |
| 42 | 3300005330 | Ga0070690_100683287 | Ga0070690_1006832872 | 74 |
| 43 | 3300005331 | Ga0070670_101420061 | Ga0070670_1014200611 | 74 |
| 44 | 3300005334 | Ga0068869_100048118 | Ga0068869_1000481182 | 74 |
| 45 | 3300005335 | Ga0070666_10249321 | Ga0070666_102493211 | 74 |
| 46 | 3300005335 | Ga0070666_10331925 | Ga0070666_103319252 | 74 |
| 47 | 3300005335 | Ga0070666_10925604 | Ga0070666_109256042 | 74 |
| 48 | 3300005335 | Ga0070666_11243970 | Ga0070666_112439701 | 74 |
| 49 | 3300005336 | Ga0070680_100448767 | Ga0070680_1004487672 | 74 |
| 50 | 3300005339 | Ga0070660_100256266 | Ga0070660_1002562662 | 74 |
| 51 | 3300005343 | Ga0070687_100894717 | Ga0070687_1008947171 | 74 |
| 52 | 3300005344 | Ga0070661_101879898 | Ga0070661_1018798981 | 74 |
| 53 | 3300005347 | Ga0070668_100001069 | Ga0070668_10000106921 | 74 |
| 54 | 3300005347 | Ga0070668_100002342 | Ga0070668_10000234213 | 74 |
| 55 | 3300005347 | Ga0070668_100083220 | Ga0070668_1000832202 | 74 |
| 56 | 3300005353 | Ga0070669_100010474 | Ga0070669_1000104746 | 74 |
| 57 | 3300005355 | Ga0070671_100005043 | Ga0070671_1000050436 | 74 |
| 58 | 3300005355 | Ga0070671_100433934 | Ga0070671_1004339342 | 74 |
| 59 | 3300005356 | Ga0070674_101674281 | Ga0070674_1016742811 | 74 |
| 60 | 3300005364 | Ga0070673_100252580 | Ga0070673_1002525802 | 74 |
| 61 | 3300005367 | Ga0070667_100015181 | Ga0070667_1000151814 | 74 |
| 62 | 3300005367 | Ga0070667_100152833 | Ga0070667_1001528332 | 74 |
| 63 | 3300005367 | Ga0070667_101348318 | Ga0070667_1013483181 | 74 |
| 64 | 3300005367 | Ga0070667_102215475 | Ga0070667_1022154751 | 74 |
| 65 | 3300005435 | Ga0070714_100769827 | Ga0070714_1007698272 | 74 |
| 66 | 3300005437 | Ga0070710_11271791 | Ga0070710_112717911 | 74 |
| 67 | 3300005456 | Ga0070678_100341893 | Ga0070678_1003418932 | 74 |
| 68 | 3300005456 | Ga0070678_100517604 | Ga0070678_1005176042 | 74 |
| 69 | 3300005457 | Ga0070662_100115657 | Ga0070662_1001156571 | 74 |
| 70 | 3300005458 | Ga0070681_10047452 | Ga0070681_100474522 | 74 |
| 71 | 3300005459 | Ga0068867_100570176 | Ga0068867_1005701761 | 74 |
| 72 | 3300005459 | Ga0068867_101903846 | Ga0068867_1019038461 | 74 |
| 73 | 3300005539 | Ga0068853_100062467 | Ga0068853_1000624673 | 74 |
| 74 | 3300005539 | Ga0068853_101909071 | Ga0068853_1019090711 | 74 |
| 75 | 3300005548 | Ga0070665_100849607 | Ga0070665_1008496071 | 74 |
| 76 | 3300005563 | Ga0068855_100086104 | Ga0068855_1000861042 | 74 |
| 77 | 3300005563 | Ga0068855_101787214 | Ga0068855_1017872142 | 74 |
| 78 | 3300005564 | Ga0070664_100643618 | Ga0070664_1006436182 | 74 |
| 79 | 3300005578 | Ga0068854_100062173 | Ga0068854_1000621734 | 74 |
| 80 | 3300005614 | Ga0068856_100756330 | Ga0068856_1007563302 | 74 |
| 81 | 3300005616 | Ga0068852_100237716 | Ga0068852_1002377162 | 74 |
| 82 | 3300005617 | Ga0068859_100000747 | Ga0068859_10000074718 | 74 |
| 83 | 3300005617 | Ga0068859_100152130 | Ga0068859_1001521301 | 74 |
| 84 | 3300005618 | Ga0068864_100121216 | Ga0068864_1001212162 | 74 |
| 85 | 3300005719 | Ga0068861_100070157 | Ga0068861_1000701572 | 74 |
| 86 | 3300005719 | Ga0068861_100148174 | Ga0068861_1001481742 | 74 |
| 87 | 3300005841 | Ga0068863_100006424 | Ga0068863_10000642415 | 74 |
| 88 | 3300005841 | Ga0068863_100040925 | Ga0068863_1000409254 | 74 |
| 89 | 3300005842 | Ga0068858_100001493 | Ga0068858_10000149318 | 74 |
| 90 | 3300005842 | Ga0068858_100220377 | Ga0068858_1002203772 | 74 |
| 91 | 3300005842 | Ga0068858_101448640 | Ga0068858_1014486401 | 74 |
| 92 | 3300005843 | Ga0068860_100000327 | Ga0068860_10000032713 | 74 |
| 93 | 3300005843 | Ga0068860_100010879 | Ga0068860_1000108793 | 74 |
| 94 | 3300005843 | Ga0068860_100011682 | Ga0068860_1000116823 | 74 |
| 95 | 3300005844 | Ga0068862_100045557 | Ga0068862_1000455573 | 74 |
| 96 | 3300005844 | Ga0068862_100078594 | Ga0068862_1000785943 | 74 |
| 97 | 3300005844 | Ga0068862_100098778 | Ga0068862_1000987782 | 74 |
| 98 | 3300005844 | Ga0068862_100182050 | Ga0068862_1001820504 | 74 |
| 99 | 3300005937 | Ga0081455_10272502 | Ga0081455_102725023 | 74 |
| 100 | 3300006038 | Ga0075365_10001302 | Ga0075365_100013029 | 74 |
| 101 | 3300006038 | Ga0075365_10237254 | Ga0075365_102372542 | 74 |
| 102 | 3300006042 | Ga0075368_10176781 | Ga0075368_101767812 | 74 |
| 103 | 3300006048 | Ga0075363_100043635 | Ga0075363_1000436352 | 74 |
| 104 | 3300006048 | Ga0075363_100104157 | Ga0075363_1001041572 | 74 |
| 105 | 3300006048 | Ga0075363_100213751 | Ga0075363_1002137512 | 74 |
| 106 | 3300006051 | Ga0075364_10060971 | Ga0075364_100609712 | 74 |
| 107 | 3300006051 | Ga0075364_10064139 | Ga0075364_100641394 | 74 |
| 108 | 3300006051 | Ga0075364_10219204 | Ga0075364_102192041 | 74 |
| 109 | 3300006177 | Ga0075362_10083515 | Ga0075362_100835152 | 74 |
| 110 | 3300006177 | Ga0075362_10224686 | Ga0075362_102246862 | 74 |
| 111 | 3300006177 | Ga0075362_10412972 | Ga0075362_104129721 | 74 |
| 112 | 3300006178 | Ga0075367_10197226 | Ga0075367_101972262 | 74 |
| 113 | 3300006178 | Ga0075367_10307993 | Ga0075367_103079932 | 74 |
| 114 | 3300006186 | Ga0075369_10263727 | Ga0075369_102637271 | 74 |
| 115 | 3300006195 | Ga0075366_10022642 | Ga0075366_100226424 | 74 |
| 116 | 3300006195 | Ga0075366_10885451 | Ga0075366_108854512 | 74 |
| 117 | 3300006353 | Ga0075370_10158892 | Ga0075370_101588922 | 74 |
| 118 | 3300006353 | Ga0075370_10203624 | Ga0075370_102036242 | 74 |
| 119 | 3300006931 | Ga0097620_100000747 | Ga0097620_10000074723 | 74 |
| 120 | 3300006931 | Ga0097620_100152118 | Ga0097620_1001521181 | 74 |
| 121 | 3300009093 | Ga0105240_10049464 | Ga0105240_100494646 | 74 |
| 122 | 3300009093 | Ga0105240_10492145 | Ga0105240_104921452 | 74 |
| 123 | 3300009093 | Ga0105240_11664757 | Ga0105240_116647572 | 74 |
| 124 | 3300009098 | Ga0105245_10762026 | Ga0105245_107620262 | 74 |
| 125 | 3300009098 | Ga0105245_10924969 | Ga0105245_109249692 | 74 |
| 126 | 3300009101 | Ga0105247_10018423 | Ga0105247_100184234 | 74 |
| 127 | 3300009101 | Ga0105247_10682395 | Ga0105247_106823952 | 74 |
| 128 | 3300009101 | Ga0105247_11177633 | Ga0105247_111776331 | 74 |
| 129 | 3300009147 | Ga0114129_13418963 | Ga0114129_134189631 | 74 |
| 130 | 3300009174 | Ga0105241_10246070 | Ga0105241_102460702 | 74 |
| 131 | 3300009177 | Ga0105248_10016266 | Ga0105248_1001626610 | 74 |
| 132 | 3300009177 | Ga0105248_10326116 | Ga0105248_103261162 | 74 |
| 133 | 3300009177 | Ga0105248_12535967 | Ga0105248_125359671 | 74 |
| 134 | 3300009545 | Ga0105237_11458609 | Ga0105237_114586092 | 74 |
| 135 | 3300009551 | Ga0105238_10709853 | Ga0105238_107098532 | 74 |
| 136 | 3300012497 | Ga0157319_1007429 | Ga0157319_10074292 | 74 |
| 137 | 3300013100 | Ga0157373_10013213 | Ga0157373_100132134 | 74 |
| 138 | 3300013100 | Ga0157373_10031568 | Ga0157373_100315681 | 74 |
| 139 | 3300013102 | Ga0157371_10006560 | Ga0157371_100065605 | 74 |
| 140 | 3300013102 | Ga0157371_10438399 | Ga0157371_104383991 | 74 |
| 141 | 3300013104 | Ga0157370_10014798 | Ga0157370_100147989 | 74 |
| 142 | 3300013104 | Ga0157370_10070380 | Ga0157370_100703805 | 74 |
| 143 | 3300013104 | Ga0157370_10108920 | Ga0157370_101089202 | 74 |
| 144 | 3300013104 | Ga0157370_11602071 | Ga0157370_116020712 | 74 |
| 145 | 3300013105 | Ga0157369_10075280 | Ga0157369_100752802 | 74 |
| 146 | 3300013105 | Ga0157369_10180493 | Ga0157369_101804932 | 74 |
| 147 | 3300013306 | Ga0163162_10041689 | Ga0163162_100416892 | 74 |
| 148 | 3300013308 | Ga0157375_13294465 | Ga0157375_132944651 | 74 |
| 149 | 3300014325 | Ga0163163_10003065 | Ga0163163_100030653 | 74 |
| 150 | 3300014326 | Ga0157380_10554161 | Ga0157380_105541612 | 74 |
| 151 | 3300014326 | Ga0157380_11403009 | Ga0157380_114030092 | 74 |
| 152 | 3300014326 | Ga0157380_11893286 | Ga0157380_118932862 | 74 |
| 153 | 3300014326 | Ga0157380_12289991 | Ga0157380_122899912 | 74 |
| 154 | 3300014745 | Ga0157377_10986890 | Ga0157377_109868901 | 74 |
| 155 | 3300014968 | Ga0157379_10002854 | Ga0157379_100028548 | 74 |
| 156 | 3300014968 | Ga0157379_10268730 | Ga0157379_102687301 | 74 |
| 157 | 3300015684 | Ga0183365_10001 | Ga0183365_100011376 | 74 |
| 158 | 3300017792 | Ga0163161_10245295 | Ga0163161_102452952 | 74 |
| 159 | 3300017792 | Ga0163161_10283381 | Ga0163161_102833812 | 74 |
| 160 | 3300017792 | Ga0163161_11218984 | Ga0163161_112189842 | 74 |
| 161 | 3300020069 | Ga0197907_10101668 | Ga0197907_101016681 | 74 |
| 162 | 3300021384 | Ga0213876_10304202 | Ga0213876_103042021 | 74 |
| 163 | 3300021388 | Ga0213875_10166063 | Ga0213875_101660632 | 74 |
| 164 | 3300025231 | Ga0207427_101305 | Ga0207427_1013054 | 74 |
| 165 | 3300025250 | Ga0209026_1005069 | Ga0209026_10050693 | 74 |
| 166 | 3300025254 | Ga0209148_1029566 | Ga0209148_10295662 | 74 |
| 167 | 3300025254 | Ga0209148_1031523 | Ga0209148_10315232 | 74 |
| 168 | 3300025254 | Ga0209148_1049496 | Ga0209148_10494961 | 74 |
| 169 | 3300025261 | Ga0209233_1003261 | Ga0209233_10032612 | 74 |
| 170 | 3300025292 | Ga0209676_1000046 | Ga0209676_100004623 | 74 |
| 171 | 3300025292 | Ga0209676_1004867 | Ga0209676_10048677 | 74 |
| 172 | 3300025295 | Ga0209564_1000031 | Ga0209564_1000031453 | 74 |
| 173 | 3300025297 | Ga0209758_1002155 | Ga0209758_10021557 | 74 |
| 174 | 3300025298 | Ga0209050_1001136 | Ga0209050_100113614 | 74 |
| 175 | 3300025298 | Ga0209050_1005527 | Ga0209050_10055274 | 74 |
| 176 | 3300025299 | Ga0209256_1001496 | Ga0209256_100149618 | 74 |
| 177 | 3300025299 | Ga0209256_1035465 | Ga0209256_10354652 | 74 |
| 178 | 3300025304 | Ga0209257_1000409 | Ga0209257_100040985 | 74 |
| 179 | 3300025304 | Ga0209257_1001224 | Ga0209257_100122414 | 74 |
| 180 | 3300025304 | Ga0209257_1002160 | Ga0209257_100216016 | 74 |
| 181 | 3300025893 | Ga0207682_10285371 | Ga0207682_102853712 | 74 |
| 182 | 3300025900 | Ga0207710_10100034 | Ga0207710_101000342 | 74 |
| 183 | 3300025903 | Ga0207680_10089091 | Ga0207680_100890913 | 74 |
| 184 | 3300025903 | Ga0207680_10471894 | Ga0207680_104718942 | 74 |
| 185 | 3300025903 | Ga0207680_10550636 | Ga0207680_105506361 | 74 |
| 186 | 3300025909 | Ga0207705_10679667 | Ga0207705_106796672 | 74 |
| 187 | 3300025911 | Ga0207654_10183940 | Ga0207654_101839402 | 74 |
| 188 | 3300025912 | Ga0207707_10021959 | Ga0207707_100219594 | 74 |
| 189 | 3300025913 | Ga0207695_10012854 | Ga0207695_100128549 | 74 |
| 190 | 3300025913 | Ga0207695_10388088 | Ga0207695_103880882 | 74 |
| 191 | 3300025917 | Ga0207660_10018742 | Ga0207660_100187422 | 74 |
| 192 | 3300025923 | Ga0207681_10027072 | Ga0207681_100270726 | 74 |
| 193 | 3300025924 | Ga0207694_10021272 | Ga0207694_100212723 | 74 |
| 194 | 3300025925 | Ga0207650_10072640 | Ga0207650_100726402 | 74 |
| 195 | 3300025929 | Ga0207664_11984201 | Ga0207664_119842011 | 74 |
| 196 | 3300025931 | Ga0207644_10006651 | Ga0207644_100066512 | 74 |
| 197 | 3300025931 | Ga0207644_10105263 | Ga0207644_101052632 | 74 |
| 198 | 3300025932 | Ga0207690_11488251 | Ga0207690_114882511 | 74 |
| 199 | 3300025937 | Ga0207669_11498392 | Ga0207669_114983921 | 74 |
| 200 | 3300025940 | Ga0207691_10830856 | Ga0207691_108308561 | 74 |
| 201 | 3300025941 | Ga0207711_10007833 | Ga0207711_100078336 | 74 |
| 202 | 3300025944 | Ga0207661_11375989 | Ga0207661_113759891 | 74 |
| 203 | 3300025945 | Ga0207679_10082560 | Ga0207679_100825602 | 74 |
| 204 | 3300025949 | Ga0207667_10156302 | Ga0207667_101563022 | 74 |
| 205 | 3300025960 | Ga0207651_10689479 | Ga0207651_106894792 | 74 |
| 206 | 3300025972 | Ga0207668_10000001 | Ga0207668_1000000195 | 74 |
| 207 | 3300025972 | Ga0207668_10000788 | Ga0207668_100007883 | 74 |
| 208 | 3300025972 | Ga0207668_10009607 | Ga0207668_100096074 | 74 |
| 209 | 3300025972 | Ga0207668_10050913 | Ga0207668_100509132 | 74 |
| 210 | 3300025972 | Ga0207668_10059647 | Ga0207668_100596472 | 74 |
| 211 | 3300025981 | Ga0207640_10048386 | Ga0207640_100483862 | 74 |
| 212 | 3300025981 | Ga0207640_10178730 | Ga0207640_101787301 | 74 |
| 213 | 3300025986 | Ga0207658_10033729 | Ga0207658_100337292 | 74 |
| 214 | 3300025986 | Ga0207658_10428118 | Ga0207658_104281182 | 74 |
| 215 | 3300025986 | Ga0207658_10480879 | Ga0207658_104808792 | 74 |
| 216 | 3300025986 | Ga0207658_11241639 | Ga0207658_112416392 | 74 |
| 217 | 3300026035 | Ga0207703_10000853 | Ga0207703_100008536 | 74 |
| 218 | 3300026035 | Ga0207703_10398734 | Ga0207703_103987342 | 74 |
| 219 | 3300026041 | Ga0207639_10028193 | Ga0207639_100281933 | 74 |
| 220 | 3300026078 | Ga0207702_10382189 | Ga0207702_103821893 | 74 |
| 221 | 3300026088 | Ga0207641_10009231 | Ga0207641_100092316 | 74 |
| 222 | 3300026088 | Ga0207641_10547196 | Ga0207641_105471961 | 74 |
| 223 | 3300026088 | Ga0207641_12231524 | Ga0207641_122315242 | 74 |
| 224 | 3300026095 | Ga0207676_11316255 | Ga0207676_113162551 | 74 |
| 225 | 3300026116 | Ga0207674_11494785 | Ga0207674_114947852 | 74 |
| 226 | 3300026118 | Ga0207675_100123248 | Ga0207675_1001232482 | 74 |
| 227 | 3300026118 | Ga0207675_100150277 | Ga0207675_1001502774 | 74 |
| 228 | 3300026118 | Ga0207675_100560868 | Ga0207675_1005608682 | 74 |
| 229 | 3300026121 | Ga0207683_10559549 | Ga0207683_105595492 | 74 |
| 230 | 3300026142 | Ga0207698_10238154 | Ga0207698_102381542 | 74 |
| 231 | 3300027866 | Ga0209813_10107888 | Ga0209813_101078881 | 74 |
| 232 | 3300027876 | Ga0209974_10082854 | Ga0209974_100828542 | 74 |
| 233 | 3300028379 | Ga0268266_10000289 | Ga0268266_1000028990 | 74 |
| 234 | 3300028379 | Ga0268266_10515013 | Ga0268266_105150132 | 74 |
| 235 | 3300028380 | Ga0268265_10009694 | Ga0268265_100096947 | 74 |
| 236 | 3300028380 | Ga0268265_10032194 | Ga0268265_100321944 | 74 |
| 237 | 3300028380 | Ga0268265_10034718 | Ga0268265_100347185 | 74 |
| 238 | 3300028380 | Ga0268265_10038125 | Ga0268265_100381253 | 74 |
| 239 | 3300028380 | Ga0268265_10047612 | Ga0268265_100476123 | 74 |
| 240 | 3300028380 | Ga0268265_10129127 | Ga0268265_101291272 | 74 |
| 241 | 3300028381 | Ga0268264_10000002 | Ga0268264_1000000267 | 74 |
| 242 | 3300028381 | Ga0268264_10004796 | Ga0268264_1000479614 | 74 |
| 243 | 3300028381 | Ga0268264_10091280 | Ga0268264_100912804 | 74 |
| 244 | 3300028381 | Ga0268264_10964839 | Ga0268264_109648391 | 74 |
| 245 | 3300028786 | Ga0307517_10457111 | Ga0307517_104571111 | 74 |
| 246 | 3300028786 | Ga0307517_10502388 | Ga0307517_105023882 | 74 |
| 247 | 3300028794 | Ga0307515_10813774 | Ga0307515_108137741 | 74 |
| 248 | 3300028800 | Ga0265338_10485315 | Ga0265338_104853152 | 74 |
| 249 | 3300028800 | Ga0265338_10773414 | Ga0265338_107734142 | 74 |
| 250 | 3300029957 | Ga0265324_10031472 | Ga0265324_100314722 | 74 |
| 251 | 3300031239 | Ga0265328_10236457 | Ga0265328_102364572 | 74 |
| 252 | 3300031250 | Ga0265331_10183531 | Ga0265331_101835312 | 74 |
| 253 | 3300031251 | Ga0265327_10001376 | Ga0265327_1000137625 | 74 |
| 254 | 3300031251 | Ga0265327_10004207 | Ga0265327_1000420711 | 74 |
| 255 | 3300031456 | Ga0307513_10000127 | Ga0307513_1000012753 | 74 |
| 256 | 3300031456 | Ga0307513_10158741 | Ga0307513_101587412 | 74 |
| 257 | 3300031711 | Ga0265314_10083450 | Ga0265314_100834502 | 74 |
| 258 | 3300031730 | Ga0307516_10000035 | Ga0307516_10000035116 | 74 |
| 259 | 3300031731 | Ga0307405_10336935 | Ga0307405_103369352 | 74 |
| 260 | 3300031731 | Ga0307405_10893790 | Ga0307405_108937901 | 74 |
| 261 | 3300031824 | Ga0307413_10285044 | Ga0307413_102850442 | 74 |
| 262 | 3300031824 | Ga0307413_10318329 | Ga0307413_103183292 | 74 |
| 263 | 3300031824 | Ga0307413_10811507 | Ga0307413_108115071 | 74 |
| 264 | 3300031824 | Ga0307413_10847992 | Ga0307413_108479921 | 74 |
| 265 | 3300031824 | Ga0307413_11481006 | Ga0307413_114810062 | 74 |
| 266 | 3300031824 | Ga0307413_11806698 | Ga0307413_118066981 | 74 |
| 267 | 3300031852 | Ga0307410_11081204 | Ga0307410_110812042 | 74 |
| 268 | 3300031901 | Ga0307406_10008219 | Ga0307406_100082195 | 74 |
| 269 | 3300031901 | Ga0307406_10044106 | Ga0307406_100441066 | 74 |
| 270 | 3300031901 | Ga0307406_10938816 | Ga0307406_109388161 | 74 |
| 271 | 3300031911 | Ga0307412_10169917 | Ga0307412_101699172 | 74 |
| 272 | 3300031911 | Ga0307412_10420421 | Ga0307412_104204212 | 74 |
| 273 | 3300031995 | Ga0307409_101869999 | Ga0307409_1018699991 | 74 |
| 274 | 3300032002 | Ga0307416_100957699 | Ga0307416_1009576992 | 74 |
| 275 | 3300032004 | Ga0307414_10049981 | Ga0307414_100499811 | 74 |
| 276 | 3300032004 | Ga0307414_10089771 | Ga0307414_100897712 | 74 |
| 277 | 3300032004 | Ga0307414_10092398 | Ga0307414_100923982 | 74 |
| 278 | 3300032004 | Ga0307414_10202473 | Ga0307414_102024732 | 74 |
| 279 | 3300032004 | Ga0307414_10218078 | Ga0307414_102180782 | 74 |
| 280 | 3300032004 | Ga0307414_10315927 | Ga0307414_103159271 | 74 |
| 281 | 3300032004 | Ga0307414_10404496 | Ga0307414_104044962 | 74 |
| 282 | 3300032004 | Ga0307414_10452242 | Ga0307414_104522421 | 74 |
| 283 | 3300032004 | Ga0307414_10700980 | Ga0307414_107009802 | 74 |
| 284 | 3300032004 | Ga0307414_11776761 | Ga0307414_117767611 | 74 |
| 285 | 3300032004 | Ga0307414_11942081 | Ga0307414_119420811 | 74 |
| 286 | 3300032005 | Ga0307411_10555384 | Ga0307411_105553842 | 74 |
| 287 | 3300032005 | Ga0307411_11523166 | Ga0307411_115231661 | 74 |
| 288 | 3300032005 | Ga0307411_12344798 | Ga0307411_123447981 | 74 |
| 289 | 3300034818 | Ga0373950_0035310 | Ga0373950_0035310_62_286 | 74 |
| 290 | 3300035691 | Ga0373931_0513793 | Ga0373931_0513793_124_348 | 74 |
| 291 | 3300035695 | Ga0373927_0872616 | Ga0373927_0872616_306_530 | 74 |
| 292 | 3300037312 | Ga0395899_0078988 | Ga0395899_0078988_981_1205 | 74 |
| 293 | 3300037312 | Ga0395899_0168195 | Ga0395899_0168195_1301_1525 | 74 |
| 294 | 3300037312 | Ga0395899_0233273 | Ga0395899_0233273_510_734 | 74 |
| 295 | 3300037312 | Ga0395899_0739223 | Ga0395899_0739223_59_283 | 74 |
| 296 | 3300037466 | Ga0395898_0126973 | Ga0395898_0126973_972_1196 | 74 |
| 297 | 3300037471 | Ga0395905_0000074 | Ga0395905_0000074_93024_93248 | 74 |
| 298 | 3300037471 | Ga0395905_0038011 | Ga0395905_0038011_1274_1498 | 74 |
| 299 | 3300037471 | Ga0395905_0261644 | Ga0395905_0261644_1097_1321 | 74 |
| 300 | 3300037471 | Ga0395905_1268934 | Ga0395905_1268934_25_249 | 74 |
| 301 | 3300037853 | Ga0436364_0494145 | Ga0436364_0494145_535_759 | 74 |
| 302 | 3300038443 | Ga0395901_0415239 | Ga0395901_0415239_100_324 | 74 |
| 303 | 3300038443 | Ga0395901_1589395 | Ga0395901_1589395_291_515 | 74 |
| 304 | 3300038443 | Ga0395901_1777805 | Ga0395901_1777805_112_336 | 74 |
| 305 | 3300038443 | Ga0395901_1805916 | Ga0395901_1805916_244_468 | 74 |
| 306 | 3300039437 | Ga0436365_1302431 | Ga0436365_1302431_525_749 | 74 |
| 307 | 3300039437 | Ga0436365_1869211 | Ga0436365_1869211_1190_1414 | 74 |
| 308 | 3300039453 | Ga0436362_0307500 | Ga0436362_0307500_133_357 | 74 |
| 309 | 3300041443 | Ga0451789_0073144 | Ga0451789_0073144_178_402 | 74 |
| 310 | 3300041451 | Ga0451791_0190273 | Ga0451791_0190273_321_545 | 74 |
| 311 | 3300041452 | Ga0451793_0577158 | Ga0451793_0577158_71_346 | 74 |
| 312 | 3300041458 | Ga0451798_0271510 | Ga0451798_0271510_23_247 | 74 |
| 313 | 3300041486 | Ga0451807_0142948 | Ga0451807_0142948_286_510 | 74 |
| 314 | 3300041486 | Ga0451807_1860837 | Ga0451807_1860837_319_543 | 74 |
| 315 | 3300041486 | Ga0451807_2662128 | Ga0451807_2662128_258_482 | 74 |
| 316 | 3300041494 | Ga0451837_1558520 | Ga0451837_1558520_332_556 | 74 |
| 317 | 3300041494 | Ga0451837_1691330 | Ga0451837_1691330_104_328 | 74 |
| 318 | 3300041509 | Ga0451843_0161838 | Ga0451843_0161838_237_461 | 74 |
| 319 | 3300041511 | Ga0451855_0842537 | Ga0451855_0842537_117_341 | 74 |
| 320 | 3300042133 | Ga0450896_049242 | Ga0450896_049242_274_498 | 74 |
| 321 | 3300042136 | Ga0450900_077914 | Ga0450900_077914_37_261 | 74 |
| 322 | 3300042533 | Ga0450901_003323 | Ga0450901_003323_635_901 | 74 |
| 323 | 3300044658 | Ga0466972_0100400 | Ga0466972_0100400_470_694 | 74 |
| 324 | 3300044684 | Ga0466966_0570447 | Ga0466966_0570447_330_554 | 74 |
| 325 | 3300044693 | Ga0466961_0198278 | Ga0466961_0198278_975_1199 | 74 |
| 326 | 3300045049 | Ga0466959_0180480 | Ga0466959_0180480_481_705 | 74 |
| 327 | 3300045049 | Ga0466959_0399455 | Ga0466959_0399455_237_461 | 74 |
| 328 | 3300046471 | Ga0495650_0200916 | Ga0495650_0200916_91_315 | 74 |
| 329 | 3300046512 | Ga0495610_0386777 | Ga0495610_0386777_79_303 | 74 |
| 330 | 3300046530 | Ga0495654_0332891 | Ga0495654_0332891_171_395 | 74 |
| 331 | 3300046558 | Ga0495633_0005158 | Ga0495633_0005158_4301_4525 | 74 |
| 332 | 3300046558 | Ga0495633_0345603 | Ga0495633_0345603_71_295 | 74 |
| 333 | 3300046616 | Ga0495668_0101432 | Ga0495668_0101432_1104_1328 | 74 |
| 334 | 3300046616 | Ga0495668_0109638 | Ga0495668_0109638_890_1114 | 74 |
| 335 | 3300046616 | Ga0495668_0137104 | Ga0495668_0137104_959_1183 | 74 |
| 336 | 3300046660 | Ga0495625_0022857 | Ga0495625_0022857_2521_2745 | 74 |
| 337 | 3300047472 | Ga0495686_0027673 | Ga0495686_0027673_2351_2575 | 74 |
| 338 | 3300048905 | Ga0496102_0724079 | Ga0496102_0724079_95_319 | 74 |
| 339 | 3300048913 | Ga0496110_1017762 | Ga0496110_1017762_477_701 | 74 |
| 340 | 3300048913 | Ga0496110_1037305 | Ga0496110_1037305_113_337 | 74 |
| 341 | 3300048916 | Ga0496113_1337411 | Ga0496113_1337411_231_455 | 74 |
| 342 | 3300048917 | Ga0496114_1556723 | Ga0496114_1556723_10_234 | 74 |
| 343 | 3300048918 | Ga0496115_0246775 | Ga0496115_0246775_324_548 | 74 |
| 344 | 3300048918 | Ga0496115_0375408 | Ga0496115_0375408_776_1000 | 74 |
| 345 | 3300048919 | Ga0496116_0057554 | Ga0496116_0057554_2165_2389 | 74 |
| 346 | 3300048924 | Ga0496121_0502688 | Ga0496121_0502688_66_290 | 74 |
| 347 | 3300048925 | Ga0496122_0006991 | Ga0496122_0006991_3014_3238 | 74 |
| 348 | 3300048926 | Ga0496123_0000512 | Ga0496123_0000512_22209_22433 | 74 |
| 349 | 3300048926 | Ga0496123_0234352 | Ga0496123_0234352_561_785 | 74 |
| 350 | 3300048927 | Ga0496124_0479513 | Ga0496124_0479513_415_639 | 74 |
| 351 | 3300048928 | Ga0496125_0002197 | Ga0496125_0002197_17135_17359 | 74 |
| 352 | 3300048929 | Ga0496126_0473775 | Ga0496126_0473775_754_978 | 74 |
| 353 | 3300048929 | Ga0496126_0488378 | Ga0496126_0488378_43_267 | 74 |
| 354 | 3300048929 | Ga0496126_0686209 | Ga0496126_0686209_384_608 | 74 |
| 355 | 3300049571 | Ga0501034_0037721 | Ga0501034_0037721_4423_4653 | 74 |
| 356 | 3300049571 | Ga0501034_0097931 | Ga0501034_0097931_73_297 | 74 |
| 357 | 3300049571 | Ga0501034_0583930 | Ga0501034_0583930_30_254 | 74 |
| 358 | 3300049579 | Ga0501043_0148599 | Ga0501043_0148599_330_554 | 74 |
| 359 | 3300049579 | Ga0501043_0220089 | Ga0501043_0220089_1098_1322 | 74 |
| 360 | 3300049581 | Ga0501047_0462790 | Ga0501047_0462790_163_387 | 74 |
| 361 | 3300049581 | Ga0501047_1132910 | Ga0501047_1132910_205_429 | 74 |
| 362 | 3300049586 | Ga0501070_0715790 | Ga0501070_0715790_246_470 | 74 |
| 363 | 3300049589 | Ga0501073_0173020 | Ga0501073_0173020_72_296 | 74 |
| 364 | 3300049686 | Ga0501257_035690 | Ga0501257_035690_690_914 | 74 |
| 365 | 3300049822 | Ga0501035_0012306 | Ga0501035_0012306_7136_7360 | 74 |
| 366 | 3300049822 | Ga0501035_0280469 | Ga0501035_0280469_782_1006 | 74 |
| 367 | 3300049823 | Ga0501044_0346039 | Ga0501044_0346039_224_448 | 74 |
| 368 | 3300049823 | Ga0501044_1183000 | Ga0501044_1183000_385_609 | 74 |
| 369 | 3300050489 | nmdc:mga03683_147569_c1 | nmdc:mga03683_147569_c1_714_938 | 74 |
| 370 | 3300050489 | nmdc:mga03683_249541_c1 | nmdc:mga03683_249541_c1_333_557 | 74 |
| 371 | 3300050490 | nmdc:mga03n38_172095_c1 | nmdc:mga03n38_172095_c1_518_742 | 74 |
| 372 | 3300050490 | nmdc:mga03n38_71366_c1 | nmdc:mga03n38_71366_c1_393_617 | 74 |
| 373 | 3300050491 | nmdc:mga00v17_149244_c1 | nmdc:mga00v17_149244_c1_767_991 | 74 |
| 374 | 3300050491 | nmdc:mga00v17_86131_c1 | nmdc:mga00v17_86131_c1_610_834 | 74 |
| 375 | 3300050491 | nmdc:mga00v17_8625_c1 | nmdc:mga00v17_8625_c1_3750_3974 | 74 |
| 376 | 3300050492 | nmdc:mga0yw44_9633_c1 | nmdc:mga0yw44_9633_c1_2004_2228 | 74 |
| 377 | 3300050493 | nmdc:mga0k408_41152_c1 | nmdc:mga0k408_41152_c1_982_1206 | 74 |
| 378 | 3300050494 | nmdc:mga06z11_168624_c1 | nmdc:mga06z11_168624_c1_693_917 | 74 |
| 379 | 3300050494 | nmdc:mga06z11_659071_c1 | nmdc:mga06z11_659071_c1_268_492 | 74 |
| 380 | 3300050495 | nmdc:mga04h51_127061_c1 | nmdc:mga04h51_127061_c1_355_579 | 74 |
| 381 | 3300050496 | nmdc:mga07m45_476004_c1 | nmdc:mga07m45_476004_c1_207_431 | 74 |
| 382 | 3300050509 | nmdc:mga0qj67_1187378_c1 | nmdc:mga0qj67_1187378_c1_100_324 | 74 |
| 383 | 3300050516 | nmdc:mga0sz30_438554_c1 | nmdc:mga0sz30_438554_c1_144_368 | 74 |
| 384 | 3300053080 | Ga0500635_0000422 | Ga0500635_0000422_11179_11403 | 74 |
| 385 | 3300053086 | Ga0500578_0489174 | Ga0500578_0489174_258_482 | 74 |
| 386 | 3300053087 | Ga0500643_002598 | Ga0500643_002598_4695_4919 | 74 |
| 387 | 3300053087 | Ga0500643_005164 | Ga0500643_005164_1284_1508 | 74 |
| 388 | 3300053087 | Ga0500643_011017 | Ga0500643_011017_419_643 | 74 |
| 389 | 3300053087 | Ga0500643_017450 | Ga0500643_017450_876_1154 | 74 |
| 390 | 3300053088 | Ga0500644_0005614 | Ga0500644_0005614_601_825 | 74 |
| 391 | 3300053091 | Ga0500647_0003244 | Ga0500647_0003244_3030_3254 | 74 |
| 392 | 3300053093 | Ga0500651_0023820 | Ga0500651_0023820_3533_3757 | 74 |
| 393 | 3300053093 | Ga0500651_0155363 | Ga0500651_0155363_262_486 | 74 |
| 394 | 3300053096 | Ga0500641_0000911 | Ga0500641_0000911_4683_4907 | 74 |
| 395 | 3300053104 | Ga0500556_0002706 | Ga0500556_0002706_3172_3396 | 74 |
| 396 | 3300053108 | Ga0500562_000413 | Ga0500562_000413_4286_4510 | 74 |
| 397 | 3300053109 | Ga0500569_301107 | Ga0500569_301107_103_327 | 74 |
| 398 | 3300053111 | Ga0500572_000338 | Ga0500572_000338_7117_7341 | 74 |
| 399 | 3300053122 | Ga0500608_000027 | Ga0500608_000027_12871_13095 | 74 |
| 400 | 3300053122 | Ga0500608_000115 | Ga0500608_000115_4401_4631 | 74 |
| 401 | 3300053123 | Ga0500614_135923 | Ga0500614_135923_156_380 | 74 |
| 402 | 3300053136 | Ga0500559_0068723 | Ga0500559_0068723_349_573 | 74 |
| 403 | 3300053136 | Ga0500559_0129567 | Ga0500559_0129567_397_621 | 74 |
| 404 | 3300053136 | Ga0500559_0216386 | Ga0500559_0216386_100_324 | 74 |
| 405 | 3300053139 | Ga0500568_0215613 | Ga0500568_0215613_445_669 | 74 |
| 406 | 3300053148 | Ga0500590_065546 | Ga0500590_065546_967_1191 | 74 |
| 407 | 3300053151 | Ga0500604_0043280 | Ga0500604_0043280_753_977 | 74 |
| 408 | 3300053153 | Ga0500616_0006408 | Ga0500616_0006408_4816_5040 | 74 |
| 409 | 3300053153 | Ga0500616_0063347 | Ga0500616_0063347_653_877 | 74 |
| 410 | 3300053156 | Ga0500622_0077075 | Ga0500622_0077075_727_951 | 74 |
| 411 | 3300053727 | Ga0500611_205814 | Ga0500611_205814_284_517 | 74 |
| 412 | 3300053730 | Ga0500645_002360 | Ga0500645_002360_4716_4940 | 74 |
| 413 | 3300053730 | Ga0500645_009677 | Ga0500645_009677_1345_1569 | 74 |
| 414 | 3300053730 | Ga0500645_075558 | Ga0500645_075558_388_612 | 74 |
| 415 | 3300054114 | Ga0501084_0550938 | Ga0501084_0550938_689_913 | 74 |
| 416 | 3300060353 | Ga0501082_0000974 | Ga0501082_0000974_22964_23188 | 74 |
| 417 | 3300005518 | Ga0070699_100085623 | Ga0070699_1000856231 | 75 |
| 418 | 3300005841 | Ga0068863_100743855 | Ga0068863_1007438552 | 75 |
| 419 | 3300006186 | Ga0075369_10004445 | Ga0075369_100044453 | 75 |
| 420 | 3300009148 | Ga0105243_11953741 | Ga0105243_119537411 | 75 |
| 421 | 3300013100 | Ga0157373_11206471 | Ga0157373_112064711 | 75 |
| 422 | 3300014745 | Ga0157377_11547987 | Ga0157377_115479871 | 75 |
| 423 | 3300021358 | Ga0213873_10279390 | Ga0213873_102793901 | 75 |
| 424 | 3300021361 | Ga0213872_10134824 | Ga0213872_101348242 | 75 |
| 425 | 3300021441 | Ga0213871_10094641 | Ga0213871_100946412 | 75 |
| 426 | 3300022467 | Ga0224712_10143637 | Ga0224712_101436371 | 75 |
| 427 | 3300037471 | Ga0395905_1325201 | Ga0395905_1325201_233_460 | 75 |
| 428 | 3300037853 | Ga0436364_0024094 | Ga0436364_0024094_132_359 | 75 |
| 429 | 3300037853 | Ga0436364_0105293 | Ga0436364_0105293_1572_1799 | 75 |
| 430 | 3300039437 | Ga0436365_1205169 | Ga0436365_1205169_486_713 | 75 |
| 431 | 3300039438 | Ga0436360_0352378 | Ga0436360_0352378_228_455 | 75 |
| 432 | 3300039438 | Ga0436360_0444055 | Ga0436360_0444055_153_380 | 75 |
| 433 | 3300039438 | Ga0436360_1069376 | Ga0436360_1069376_23_250 | 75 |
| 434 | 3300039447 | Ga0436361_0673108 | Ga0436361_0673108_1015_1242 | 75 |
| 435 | 3300039447 | Ga0436361_0992022 | Ga0436361_0992022_150_377 | 75 |
| 436 | 3300039453 | Ga0436362_0631106 | Ga0436362_0631106_206_433 | 75 |
| 437 | 3300039453 | Ga0436362_1292192 | Ga0436362_1292192_220_447 | 75 |
| 438 | 3300041512 | Ga0451853_0267609 | Ga0451853_0267609_55_282 | 75 |
| 439 | 3300046453 | Ga0495627_168304 | Ga0495627_168304_38_265 | 75 |
| 440 | 3300046460 | Ga0495638_0050607 | Ga0495638_0050607_1153_1380 | 75 |
| 441 | 3300046462 | Ga0495651_0919943 | Ga0495651_0919943_186_413 | 75 |
| 442 | 3300046616 | Ga0495668_0413029 | Ga0495668_0413029_390_617 | 75 |
| 443 | 3300046692 | Ga0495671_0105539 | Ga0495671_0105539_92_319 | 75 |
| 444 | 3300047469 | Ga0495673_0000905 | Ga0495673_0000905_2129_2356 | 75 |
| 445 | 3300048905 | Ga0496102_1198350 | Ga0496102_1198350_400_627 | 75 |
| 446 | 3300048907 | Ga0496104_0302469 | Ga0496104_0302469_1198_1425 | 75 |
| 447 | 3300049591 | Ga0501075_0183626 | Ga0501075_0183626_1055_1282 | 75 |
| 448 | 3300049592 | Ga0501076_0692802 | Ga0501076_0692802_338_565 | 75 |
| 449 | 3300050516 | nmdc:mga0sz30_42011_c1 | nmdc:mga0sz30_42011_c1_1297_1524 | 75 |
| 450 | 3300053087 | Ga0500643_043970 | Ga0500643_043970_77_304 | 75 |
| 451 | 3300053087 | Ga0500643_096979 | Ga0500643_096979_185_412 | 75 |
| 452 | 3300053088 | Ga0500644_0000538 | Ga0500644_0000538_6866_7093 | 75 |
| 453 | 3300053096 | Ga0500641_0001879 | Ga0500641_0001879_6401_6628 | 75 |
| 454 | 3300053125 | Ga0500618_006992 | Ga0500618_006992_937_1164 | 75 |
| 455 | 3300053138 | Ga0500564_000352 | Ga0500564_000352_5915_6142 | 75 |
| 456 | 3300053141 | Ga0500574_115977 | Ga0500574_115977_382_609 | 75 |
| 457 | 3300053157 | Ga0500624_000064 | Ga0500624_000064_29732_29959 | 75 |
| 458 | 3300053177 | Ga0500636_0000932 | Ga0500636_0000932_1698_1925 | 75 |
| 459 | 3300054114 | Ga0501084_0963631 | Ga0501084_0963631_73_300 | 75 |
| 460 | 3300055283 | Ga0500661_011784 | Ga0500661_011784_68_295 | 75 |
| 461 | 3300059640 | Ga0587067_136638 | Ga0587067_136638_145_372 | 75 |
| 462 | 3300059655 | Ga0587114_074328 | Ga0587114_074328_250_477 | 75 |
| 463 | 3300001979 | JGI24740J21852_10107549 | JGI24740J21852_101075491 | 76 |
| 464 | 3300003322 | rootL2_10135826 | rootL2_101358261 | 76 |
| 465 | 3300003781 | Ga0055536_1005094 | Ga0055536_10050942 | 76 |
| 466 | 3300003781 | Ga0055536_1008341 | Ga0055536_10083414 | 76 |
| 467 | 3300003791 | Ga0055530_10015556 | Ga0055530_100155562 | 76 |
| 468 | 3300003791 | Ga0055530_10020754 | Ga0055530_100207544 | 76 |
| 469 | 3300003792 | Ga0055540_1069762 | Ga0055540_10697622 | 76 |
| 470 | 3300003794 | Ga0055531_10001076 | Ga0055531_100010762 | 76 |
| 471 | 3300003794 | Ga0055531_10058243 | Ga0055531_100582432 | 76 |
| 472 | 3300005367 | Ga0070667_100806493 | Ga0070667_1008064933 | 76 |
| 473 | 3300005435 | Ga0070714_100384684 | Ga0070714_1003846842 | 76 |
| 474 | 3300005435 | Ga0070714_100546568 | Ga0070714_1005465682 | 76 |
| 475 | 3300005435 | Ga0070714_100813971 | Ga0070714_1008139712 | 76 |
| 476 | 3300005436 | Ga0070713_100259893 | Ga0070713_1002598932 | 76 |
| 477 | 3300005437 | Ga0070710_10178863 | Ga0070710_101788632 | 76 |
| 478 | 3300005439 | Ga0070711_100443768 | Ga0070711_1004437682 | 76 |
| 479 | 3300005445 | Ga0070708_100091639 | Ga0070708_1000916393 | 76 |
| 480 | 3300005467 | Ga0070706_100018301 | Ga0070706_1000183012 | 76 |
| 481 | 3300005468 | Ga0070707_100006146 | Ga0070707_1000061464 | 76 |
| 482 | 3300005471 | Ga0070698_100022207 | Ga0070698_1000222073 | 76 |
| 483 | 3300005518 | Ga0070699_100022426 | Ga0070699_1000224263 | 76 |
| 484 | 3300005536 | Ga0070697_100118352 | Ga0070697_1001183522 | 76 |
| 485 | 3300005539 | Ga0068853_100022277 | Ga0068853_1000222772 | 76 |
| 486 | 3300005546 | Ga0070696_101138998 | Ga0070696_1011389981 | 76 |
| 487 | 3300005547 | Ga0070693_101145899 | Ga0070693_1011458992 | 76 |
| 488 | 3300005547 | Ga0070693_101348769 | Ga0070693_1013487691 | 76 |
| 489 | 3300005549 | Ga0070704_101747046 | Ga0070704_1017470461 | 76 |
| 490 | 3300005563 | Ga0068855_101472109 | Ga0068855_1014721092 | 76 |
| 491 | 3300005564 | Ga0070664_100394900 | Ga0070664_1003949002 | 76 |
| 492 | 3300005577 | Ga0068857_100018018 | Ga0068857_1000180183 | 76 |
| 493 | 3300005577 | Ga0068857_100081543 | Ga0068857_1000815434 | 76 |
| 494 | 3300005614 | Ga0068856_100159164 | Ga0068856_1001591644 | 76 |
| 495 | 3300005614 | Ga0068856_100164433 | Ga0068856_1001644333 | 76 |
| 496 | 3300005616 | Ga0068852_100194651 | Ga0068852_1001946512 | 76 |
| 497 | 3300005617 | Ga0068859_100570884 | Ga0068859_1005708843 | 76 |
| 498 | 3300005718 | Ga0068866_10542664 | Ga0068866_105426642 | 76 |
| 499 | 3300005719 | Ga0068861_101527760 | Ga0068861_1015277601 | 76 |
| 500 | 3300005834 | Ga0068851_10065211 | Ga0068851_100652111 | 76 |
| 501 | 3300005843 | Ga0068860_100079176 | Ga0068860_1000791763 | 76 |
| 502 | 3300005844 | Ga0068862_100146853 | Ga0068862_1001468534 | 76 |
| 503 | 3300005844 | Ga0068862_101340721 | Ga0068862_1013407212 | 76 |
| 504 | 3300005937 | Ga0081455_10999887 | Ga0081455_109998872 | 76 |
| 505 | 3300006028 | Ga0070717_10401334 | Ga0070717_104013342 | 76 |
| 506 | 3300006028 | Ga0070717_10468739 | Ga0070717_104687391 | 76 |
| 507 | 3300006028 | Ga0070717_11473513 | Ga0070717_114735132 | 76 |
| 508 | 3300006173 | Ga0070716_100156838 | Ga0070716_1001568381 | 76 |
| 509 | 3300006175 | Ga0070712_100937602 | Ga0070712_1009376022 | 76 |
| 510 | 3300006846 | Ga0075430_100640983 | Ga0075430_1006409832 | 76 |
| 511 | 3300006871 | Ga0075434_100700968 | Ga0075434_1007009681 | 76 |
| 512 | 3300006914 | Ga0075436_100076118 | Ga0075436_1000761182 | 76 |
| 513 | 3300006931 | Ga0097620_100570908 | Ga0097620_1005709083 | 76 |
| 514 | 3300007076 | Ga0075435_100071610 | Ga0075435_1000716105 | 76 |
| 515 | 3300007788 | Ga0099795_10004776 | Ga0099795_100047765 | 76 |
| 516 | 3300007788 | Ga0099795_10013504 | Ga0099795_100135041 | 76 |
| 517 | 3300009093 | Ga0105240_11031718 | Ga0105240_110317182 | 76 |
| 518 | 3300009174 | Ga0105241_10260766 | Ga0105241_102607662 | 76 |
| 519 | 3300009174 | Ga0105241_11172373 | Ga0105241_111723732 | 76 |
| 520 | 3300009176 | Ga0105242_10699611 | Ga0105242_106996112 | 76 |
| 521 | 3300009551 | Ga0105238_11250396 | Ga0105238_112503962 | 76 |
| 522 | 3300009551 | Ga0105238_11735673 | Ga0105238_117356731 | 76 |
| 523 | 3300009553 | Ga0105249_12489638 | Ga0105249_124896382 | 76 |
| 524 | 3300010159 | Ga0099796_10004450 | Ga0099796_100044505 | 76 |
| 525 | 3300010159 | Ga0099796_10028192 | Ga0099796_100281922 | 76 |
| 526 | 3300014497 | Ga0182008_10055060 | Ga0182008_100550602 | 76 |
| 527 | 3300025292 | Ga0209676_1000163 | Ga0209676_100016387 | 76 |
| 528 | 3300025292 | Ga0209676_1000188 | Ga0209676_100018872 | 76 |
| 529 | 3300025298 | Ga0209050_1001123 | Ga0209050_10011237 | 76 |
| 530 | 3300025298 | Ga0209050_1001523 | Ga0209050_100152322 | 76 |
| 531 | 3300025303 | Ga0209051_1003588 | Ga0209051_10035887 | 76 |
| 532 | 3300025304 | Ga0209257_1000370 | Ga0209257_100037018 | 76 |
| 533 | 3300025304 | Ga0209257_1007513 | Ga0209257_10075133 | 76 |
| 534 | 3300025898 | Ga0207692_10229843 | Ga0207692_102298432 | 76 |
| 535 | 3300025898 | Ga0207692_11176754 | Ga0207692_111767542 | 76 |
| 536 | 3300025906 | Ga0207699_10164444 | Ga0207699_101644442 | 76 |
| 537 | 3300025906 | Ga0207699_10713343 | Ga0207699_107133431 | 76 |
| 538 | 3300025910 | Ga0207684_10510356 | Ga0207684_105103562 | 76 |
| 539 | 3300025915 | Ga0207693_10039298 | Ga0207693_100392984 | 76 |
| 540 | 3300025915 | Ga0207693_10294563 | Ga0207693_102945631 | 76 |
| 541 | 3300025922 | Ga0207646_10007709 | Ga0207646_100077097 | 76 |
| 542 | 3300025928 | Ga0207700_10045252 | Ga0207700_100452522 | 76 |
| 543 | 3300025928 | Ga0207700_10254205 | Ga0207700_102542052 | 76 |
| 544 | 3300025928 | Ga0207700_10384772 | Ga0207700_103847722 | 76 |
| 545 | 3300025934 | Ga0207686_10491576 | Ga0207686_104915762 | 76 |
| 546 | 3300025935 | Ga0207709_10402871 | Ga0207709_104028711 | 76 |
| 547 | 3300025939 | Ga0207665_10036574 | Ga0207665_100365742 | 76 |
| 548 | 3300025942 | Ga0207689_11280218 | Ga0207689_112802181 | 76 |
| 549 | 3300025986 | Ga0207658_10685955 | Ga0207658_106859552 | 76 |
| 550 | 3300026035 | Ga0207703_10685681 | Ga0207703_106856812 | 76 |
| 551 | 3300026078 | Ga0207702_10014179 | Ga0207702_100141794 | 76 |
| 552 | 3300026078 | Ga0207702_11670649 | Ga0207702_116706491 | 76 |
| 553 | 3300026116 | Ga0207674_10014006 | Ga0207674_100140065 | 76 |
| 554 | 3300026118 | Ga0207675_102072416 | Ga0207675_1020724161 | 76 |
| 555 | 3300027512 | Ga0209179_1014467 | Ga0209179_10144672 | 76 |
| 556 | 3300028380 | Ga0268265_10672417 | Ga0268265_106724171 | 76 |
| 557 | 3300028380 | Ga0268265_11285093 | Ga0268265_112850932 | 76 |
| 558 | 3300028381 | Ga0268264_10266544 | Ga0268264_102665442 | 76 |
| 559 | 3300028381 | Ga0268264_11161231 | Ga0268264_111612312 | 76 |
| 560 | 3300030878 | Ga0265770_1075487 | Ga0265770_10754872 | 76 |
| 561 | 3300031344 | Ga0265316_11299408 | Ga0265316_112994081 | 76 |
| 562 | 3300031548 | Ga0307408_100457312 | Ga0307408_1004573122 | 76 |
| 563 | 3300031911 | Ga0307412_10103883 | Ga0307412_101038833 | 76 |
| 564 | 3300032004 | Ga0307414_11221157 | Ga0307414_112211572 | 76 |
| 565 | 3300032126 | Ga0307415_101521253 | Ga0307415_1015212532 | 76 |
| 566 | 3300035084 | Ga0373928_0192667 | Ga0373928_0192667_303_533 | 76 |
| 567 | 3300035085 | Ga0373929_0151606 | Ga0373929_0151606_83_313 | 76 |
| 568 | 3300035112 | Ga0373932_0016559 | Ga0373932_0016559_1354_1587 | 76 |
| 569 | 3300035115 | Ga0373941_0019225 | Ga0373941_0019225_509_742 | 76 |
| 570 | 3300035121 | Ga0373960_0028255 | Ga0373960_0028255_912_1142 | 76 |
| 571 | 3300035170 | Ga0373943_0044266 | Ga0373943_0044266_1563_1796 | 76 |
| 572 | 3300035171 | Ga0373946_0275986 | Ga0373946_0275986_466_699 | 76 |
| 573 | 3300035241 | Ga0373961_0188346 | Ga0373961_0188346_28_261 | 76 |
| 574 | 3300035242 | Ga0373962_0013376 | Ga0373962_0013376_989_1219 | 76 |
| 575 | 3300035691 | Ga0373931_0003958 | Ga0373931_0003958_2074_2304 | 76 |
| 576 | 3300035691 | Ga0373931_0046009 | Ga0373931_0046009_1834_2067 | 76 |
| 577 | 3300035692 | Ga0373935_0428854 | Ga0373935_0428854_271_504 | 76 |
| 578 | 3300035695 | Ga0373927_0633406 | Ga0373927_0633406_313_546 | 76 |
| 579 | 3300035725 | Ga0373947_0073967 | Ga0373947_0073967_554_787 | 76 |
| 580 | 3300037068 | Ga0373925_0890870 | Ga0373925_0890870_188_421 | 76 |
| 581 | 3300037068 | Ga0373925_1288224 | Ga0373925_1288224_35_268 | 76 |
| 582 | 3300037418 | Ga0395900_0992964 | Ga0395900_0992964_499_729 | 76 |
| 583 | 3300039437 | Ga0436365_1302237 | Ga0436365_1302237_330_563 | 76 |
| 584 | 3300039438 | Ga0436360_0397582 | Ga0436360_0397582_91_321 | 76 |
| 585 | 3300039438 | Ga0436360_0610713 | Ga0436360_0610713_76_309 | 76 |
| 586 | 3300039453 | Ga0436362_0390765 | Ga0436362_0390765_2285_2515 | 76 |
| 587 | 3300042438 | Ga0439459_0173159 | Ga0439459_0173159_62_292 | 76 |
| 588 | 3300046472 | Ga0495580_0030065 | Ga0495580_0030065_1667_1900 | 76 |
| 589 | 3300047320 | Ga0495672_0000570 | Ga0495672_0000570_2020_2250 | 76 |
| 590 | 3300048913 | Ga0496110_0319583 | Ga0496110_0319583_174_407 | 76 |
| 591 | 3300048916 | Ga0496113_0181823 | Ga0496113_0181823_20_253 | 76 |
| 592 | 3300048929 | Ga0496126_0193760 | Ga0496126_0193760_417_662 | 76 |
| 593 | 3300049127 | Ga0501306_019854 | Ga0501306_019854_333_563 | 76 |
| 594 | 3300049161 | Ga0501305_034138 | Ga0501305_034138_409_639 | 76 |
| 595 | 3300049162 | Ga0501307_015986 | Ga0501307_015986_333_563 | 76 |
| 596 | 3300049589 | Ga0501073_0456133 | Ga0501073_0456133_397_630 | 76 |
| 597 | 3300049679 | Ga0501249_000314 | Ga0501249_000314_8280_8510 | 76 |
| 598 | 3300049850 | Ga0501204_029066 | Ga0501204_029066_212_442 | 76 |
| 599 | 3300049852 | Ga0501220_03002 | Ga0501220_03002_296_526 | 76 |
| 600 | 3300050513 | nmdc:mga0rr50_100378_c1 | nmdc:mga0rr50_100378_c1_490_723 | 76 |
| 601 | 3300050514 | nmdc:mga08x19_290106_c1 | nmdc:mga08x19_290106_c1_753_986 | 76 |
| 602 | 3300053090 | Ga0500646_0089107 | Ga0500646_0089107_356_586 | 76 |
| 603 | 3300053177 | Ga0500636_0015974 | Ga0500636_0015974_3580_3810 | 76 |
| 604 | 3300059491 | Ga0587070_085131 | Ga0587070_085131_224_457 | 76 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar