F468418

General Info

Members Datasets Scaffolds Average Seq Length
604 342 597 75

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_017450|Ga0500643_017450_876_1154
Length 92
Sequence LSRAFAICARAAYPLDPTMKQDTHPDYHFITVVMTDGTSYRTRSTYGKEGDTLNLDIDPRTHPAWTGGGHTMLDRGGRVSRFNNKFAGFVRK

Samples

Sample ID Description Type Environment
1 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
2 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
3 2902330777 Methylobacterium sp. 2A Isolate Unclassified
4 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
5 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
117 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
124 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
189 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
209 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
210 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
211 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
212 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
217 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
234 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
235 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
236 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
237 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
238 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
239 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
240 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
241 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
242 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
243 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
244 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
245 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
246 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
247 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
250 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
251 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
259 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
260 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
263 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
266 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
291 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
295 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
296 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
297 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
300 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
301 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
302 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
303 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
307 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
308 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
309 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
310 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
311 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
312 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
313 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
314 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
315 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
316 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
317 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
318 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
319 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
320 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
321 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
322 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
323 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
324 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
325 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
326 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
327 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
328 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
331 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
332 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
333 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
334 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
335 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
336 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
337 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 641522639 Methylobacterium sp. 4-46 Isolate Nodule
342 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 1.49
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.37
Nodule 0.33
Rhizoplane 3.15
Rhizosphere 69.37
Stem 0
Stem Tuber 0
Unclassified 7.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10107549 3300001979 Bacteria 705
2 JGI25153J46596_10086969 3300003215 Bacteria 764
3 rootH1_10153469 3300003316 Bacteria 1140
4 rootH2_10010501 3300003320 Bacteria 2910
5 rootH2_10020043 3300003320 Bacteria 3019
6 rootL2_10135826 3300003322 Bacteria 1833
7 rootH1_10022222 3300003323 Bacteria 10266
8 rootH1_10027576 3300003323 Bacteria 1160
9 rootH1_10136079 3300003323 Bacteria 2694
10 rootH1_10156035 3300003323 Bacteria 1341
11 rootH1_10181512 3300003323 Bacteria 1978
12 Ga0055524_1015750 3300003775 Bacteria 2744
13 Ga0055536_1005094 3300003781 Bacteria 6521
14 Ga0055536_1008341 3300003781 Bacteria 4471
15 Ga0055530_10000571 3300003791 Bacteria 31903
16 Ga0055530_10015556 3300003791 Bacteria 2475
17 Ga0055530_10020754 3300003791 Bacteria 1954
18 Ga0055540_1069762 3300003792 Bacteria 688
19 Ga0055531_10001076 3300003794 Bacteria 21445
20 Ga0055531_10008699 3300003794 Bacteria 5304
21 Ga0055531_10042677 3300003794 Bacteria 1293
22 Ga0055531_10058243 3300003794 Bacteria 962
23 Ga0055543_1052995 3300004625 Bacteria 662
24 Ga0065165_1003949 3300005262 Bacteria 9746
25 Ga0070683_100414316 3300005329 Bacteria 1285
26 Ga0070690_100683287 3300005330 Bacteria 787
27 Ga0070670_101420061 3300005331 Bacteria 636
28 Ga0068869_100048118 3300005334 Bacteria 3082
29 Ga0070666_10249321 3300005335 Bacteria 1257
30 Ga0070666_10331925 3300005335 Bacteria 1086
31 Ga0070666_10925604 3300005335 Bacteria 645
32 Ga0070666_11243970 3300005335 Bacteria 555
33 Ga0070680_100448767 3300005336 Bacteria 1101
34 Ga0070660_100256266 3300005339 Bacteria 1428
35 Ga0070687_100894717 3300005343 Bacteria 636
36 Ga0070661_101879898 3300005344 Bacteria 509
37 Ga0070668_100001069 3300005347 Bacteria 19272
38 Ga0070668_100002342 3300005347 Bacteria 13925
39 Ga0070668_100083220 3300005347 Bacteria 2512
40 Ga0070669_100010474 3300005353 Bacteria 6585
41 Ga0070671_100005043 3300005355 Bacteria 10529
42 Ga0070671_100433934 3300005355 Bacteria 1126
43 Ga0070674_101674281 3300005356 Bacteria 575
44 Ga0070673_100252580 3300005364 Bacteria 1537
45 Ga0070667_100015181 3300005367 Bacteria 6362
46 Ga0070667_100152833 3300005367 Bacteria 2028
47 Ga0070667_100333278 3300005367 Bacteria 1371
48 Ga0070667_100806493 3300005367 Bacteria 872
49 Ga0070667_101348318 3300005367 Bacteria 669
50 Ga0070667_102215475 3300005367 Bacteria 518
51 Ga0070714_100384684 3300005435 Bacteria 1323
52 Ga0070714_100546568 3300005435 Bacteria 1108
53 Ga0070714_100769827 3300005435 Bacteria 931
54 Ga0070714_100813971 3300005435 Bacteria 905
55 Ga0070713_100259893 3300005436 Bacteria 1586
56 Ga0070710_10178863 3300005437 Bacteria 1326
57 Ga0070710_11271791 3300005437 Bacteria 546
58 Ga0070711_100443768 3300005439 Bacteria 1061
59 Ga0070700_101013400 3300005441 Bacteria 683
60 Ga0070708_100091639 3300005445 Bacteria 2768
61 Ga0070678_100341893 3300005456 Bacteria 1284
62 Ga0070678_100517604 3300005456 Bacteria 1055
63 Ga0070662_100115657 3300005457 Bacteria 2049
64 Ga0070681_10047452 3300005458 Bacteria 4293
65 Ga0068867_100570176 3300005459 Bacteria 983
66 Ga0068867_101903846 3300005459 Bacteria 561
67 Ga0070706_100018301 3300005467 Bacteria 6465
68 Ga0070707_100006146 3300005468 Bacteria 11191
69 Ga0070698_100022207 3300005471 Bacteria 6643
70 Ga0070699_100022426 3300005518 Bacteria 5440
71 Ga0070699_100085623 3300005518 Bacteria 2750
72 Ga0070697_100118352 3300005536 Bacteria 2213
73 Ga0068853_100022277 3300005539 Bacteria 5290
74 Ga0068853_100062467 3300005539 Bacteria 3224
75 Ga0068853_101909071 3300005539 Bacteria 576
76 Ga0070696_101138998 3300005546 Bacteria 657
77 Ga0070693_101145899 3300005547 Bacteria 595
78 Ga0070693_101348769 3300005547 Bacteria 553
79 Ga0070665_100849607 3300005548 Bacteria 926
80 Ga0070704_101747046 3300005549 Bacteria 575
81 Ga0068855_100086104 3300005563 Bacteria 3634
82 Ga0068855_101472109 3300005563 Bacteria 700
83 Ga0068855_101787214 3300005563 Bacteria 625
84 Ga0070664_100394900 3300005564 Bacteria 1264
85 Ga0070664_100643618 3300005564 Bacteria 985
86 Ga0068857_100018018 3300005577 Bacteria 6194
87 Ga0068857_100081543 3300005577 Bacteria 2889
88 Ga0068854_100062173 3300005578 Bacteria 2706
89 Ga0068856_100159164 3300005614 Bacteria 2268
90 Ga0068856_100164433 3300005614 Bacteria 2230
91 Ga0068856_100756330 3300005614 Bacteria 992
92 Ga0068852_100194651 3300005616 Bacteria 1915
93 Ga0068852_100237716 3300005616 Bacteria 1739
94 Ga0068859_100000747 3300005617 Bacteria 32789
95 Ga0068859_100152130 3300005617 Bacteria 2389
96 Ga0068859_100570884 3300005617 Bacteria 1225
97 Ga0068864_100121216 3300005618 Bacteria 2338
98 Ga0068866_10542664 3300005718 Bacteria 776
99 Ga0068861_100070157 3300005719 Bacteria 2713
100 Ga0068861_100148174 3300005719 Bacteria 1923
101 Ga0068861_101527760 3300005719 Bacteria 656
102 Ga0068851_10065211 3300005834 Bacteria 1873
103 Ga0068863_100006424 3300005841 Bacteria 11527
104 Ga0068863_100040925 3300005841 Bacteria 4405
105 Ga0068863_100743855 3300005841 Bacteria 976
106 Ga0068858_100001493 3300005842 Bacteria 24115
107 Ga0068858_100220377 3300005842 Bacteria 1796
108 Ga0068858_101448640 3300005842 Bacteria 677
109 Ga0068860_100000327 3300005843 Bacteria 64590
110 Ga0068860_100010879 3300005843 Bacteria 8972
111 Ga0068860_100011682 3300005843 Bacteria 8657
112 Ga0068860_100079176 3300005843 Bacteria 3124
113 Ga0068862_100045557 3300005844 Bacteria 3742
114 Ga0068862_100078594 3300005844 Bacteria 2859
115 Ga0068862_100098778 3300005844 Bacteria 2551
116 Ga0068862_100146853 3300005844 Bacteria 2096
117 Ga0068862_100182050 3300005844 Bacteria 1886
118 Ga0068862_101340721 3300005844 Bacteria 718
119 Ga0081455_10272502 3300005937 Bacteria 1227
120 Ga0081455_10999887 3300005937 Bacteria 518
121 Ga0070717_10401334 3300006028 Bacteria 1232
122 Ga0070717_10468739 3300006028 Bacteria 1136
123 Ga0070717_11473513 3300006028 Bacteria 618
124 Ga0075365_10001302 3300006038 Bacteria 11130
125 Ga0075365_10237254 3300006038 Bacteria 1281
126 Ga0075368_10176781 3300006042 Bacteria 899
127 Ga0075363_100043635 3300006048 Bacteria 2373
128 Ga0075363_100104157 3300006048 Bacteria 1572
129 Ga0075363_100213751 3300006048 Bacteria 1104
130 Ga0075364_10060971 3300006051 Bacteria 2473
131 Ga0075364_10064139 3300006051 Bacteria 2411
132 Ga0075364_10219204 3300006051 Bacteria 1291
133 Ga0075364_10579879 3300006051 Bacteria 766
134 Ga0070716_100156838 3300006173 Bacteria 1471
135 Ga0070712_100937602 3300006175 Bacteria 747
136 Ga0075362_10083515 3300006177 Bacteria 1475
137 Ga0075362_10224686 3300006177 Bacteria 918
138 Ga0075362_10412972 3300006177 Bacteria 682
139 Ga0075367_10197226 3300006178 Bacteria 1257
140 Ga0075367_10307993 3300006178 Bacteria 997
141 Ga0075369_10004445 3300006186 Bacteria 5179
142 Ga0075369_10263727 3300006186 Bacteria 801
143 Ga0075366_10022642 3300006195 Bacteria 3657
144 Ga0075366_10885451 3300006195 Bacteria 556
145 Ga0075370_10158892 3300006353 Bacteria 1326
146 Ga0075370_10203624 3300006353 Bacteria 1168
147 Ga0075430_100640983 3300006846 Bacteria 876
148 Ga0075434_100700968 3300006871 Bacteria 1030
149 Ga0075436_100076118 3300006914 Bacteria 2324
150 Ga0097620_100000747 3300006931 Bacteria 32789
151 Ga0097620_100152118 3300006931 Bacteria 2389
152 Ga0097620_100570908 3300006931 Bacteria 1225
153 Ga0075435_100071610 3300007076 Bacteria 2830
154 Ga0099795_10004776 3300007788 Bacteria 3532
155 Ga0099795_10013504 3300007788 Bacteria 2509
156 Ga0105240_10049464 3300009093 Bacteria 5305
157 Ga0105240_10492145 3300009093 Bacteria 1365
158 Ga0105240_11031718 3300009093 Bacteria 878
159 Ga0105240_11664757 3300009093 Bacteria 667
160 Ga0105245_10762026 3300009098 Bacteria 1004
161 Ga0105245_10924969 3300009098 Bacteria 914
162 Ga0105247_10018423 3300009101 Bacteria 4188
163 Ga0105247_10682395 3300009101 Bacteria 771
164 Ga0105247_11177633 3300009101 Bacteria 609
165 Ga0114129_13418963 3300009147 Bacteria 510
166 Ga0105243_11953741 3300009148 Bacteria 620
167 Ga0105241_10246070 3300009174 Bacteria 1514
168 Ga0105241_10260766 3300009174 Bacteria 1473
169 Ga0105241_11172373 3300009174 Bacteria 726
170 Ga0105242_10699611 3300009176 Bacteria 991
171 Ga0105248_10016266 3300009177 Bacteria 8188
172 Ga0105248_10326116 3300009177 Bacteria 1729
173 Ga0105248_12535967 3300009177 Bacteria 584
174 Ga0105237_11458609 3300009545 Bacteria 691
175 Ga0105238_10709853 3300009551 Bacteria 1018
176 Ga0105238_11250396 3300009551 Bacteria 768
177 Ga0105238_11381458 3300009551 Bacteria 731
178 Ga0105238_11735673 3300009551 Bacteria 656
179 Ga0105249_12489638 3300009553 Bacteria 590
180 Ga0099796_10004450 3300010159 Bacteria 3390
181 Ga0099796_10028192 3300010159 Bacteria 1800
182 Ga0105239_10868399 3300010375 Bacteria 1035
183 Ga0105239_12218423 3300010375 Bacteria 639
184 Ga0157319_1007429 3300012497 Bacteria 813
185 Ga0157373_10013213 3300013100 Bacteria 6061
186 Ga0157373_10031568 3300013100 Bacteria 3812
187 Ga0157373_11206471 3300013100 Bacteria 570
188 Ga0157371_10006560 3300013102 Bacteria 9568
189 Ga0157371_10438399 3300013102 Bacteria 959
190 Ga0157370_10014798 3300013104 Bacteria 7962
191 Ga0157370_10070380 3300013104 Bacteria 3302
192 Ga0157370_10108920 3300013104 Bacteria 2590
193 Ga0157370_11602071 3300013104 Bacteria 585
194 Ga0157369_10075280 3300013105 Bacteria 3620
195 Ga0157369_10180493 3300013105 Bacteria 2221
196 Ga0157369_11086359 3300013105 Bacteria 818
197 Ga0163162_10041689 3300013306 Bacteria 4593
198 Ga0163162_11108893 3300013306 Bacteria 897
199 Ga0157375_13294465 3300013308 Bacteria 538
200 Ga0163163_10003065 3300014325 Bacteria 14146
201 Ga0163163_12489537 3300014325 Bacteria 576
202 Ga0157380_10148851 3300014326 Bacteria 2021
203 Ga0157380_10554161 3300014326 Bacteria 1128
204 Ga0157380_11403009 3300014326 Bacteria 749
205 Ga0157380_11893286 3300014326 Bacteria 657
206 Ga0157380_12289991 3300014326 Bacteria 605
207 Ga0182008_10055060 3300014497 Bacteria 1968
208 Ga0157377_10986890 3300014745 Bacteria 637
209 Ga0157377_11547987 3300014745 Bacteria 529
210 Ga0157379_10002854 3300014968 Bacteria 14564
211 Ga0157379_10268730 3300014968 Bacteria 1550
212 Ga0183365_10001 3300015684 Bacteria 2090444
213 Ga0163161_10245295 3300017792 Bacteria 1394
214 Ga0163161_10283381 3300017792 Bacteria 1300
215 Ga0163161_10878350 3300017792 Bacteria 758
216 Ga0163161_11218984 3300017792 Bacteria 651
217 Ga0197907_10101668 3300020069 Bacteria 568
218 Ga0213873_10279390 3300021358 Bacteria 535
219 Ga0213872_10134824 3300021361 Bacteria 1086
220 Ga0213876_10304202 3300021384 Bacteria 848
221 Ga0213875_10166063 3300021388 Bacteria 1036
222 Ga0213871_10094641 3300021441 Unclassified 869
223 Ga0224712_10143637 3300022467 Bacteria 1052
224 Ga0207427_101305 3300025231 Bacteria 9393
225 Ga0209026_1005069 3300025250 Bacteria 3661
226 Ga0209148_1029566 3300025254 Bacteria 826
227 Ga0209148_1031523 3300025254 Bacteria 786
228 Ga0209148_1049496 3300025254 Bacteria 547
229 Ga0209233_1003261 3300025261 Bacteria 5754
230 Ga0209676_1000046 3300025292 Bacteria 409173
231 Ga0209676_1000163 3300025292 Bacteria 157845
232 Ga0209676_1000188 3300025292 Bacteria 141232
233 Ga0209676_1004867 3300025292 Bacteria 7269
234 Ga0209564_1000031 3300025295 Bacteria 494703
235 Ga0209758_1002155 3300025297 Bacteria 20717
236 Ga0209050_1001123 3300025298 Bacteria 32326
237 Ga0209050_1001136 3300025298 Bacteria 32037
238 Ga0209050_1001523 3300025298 Bacteria 24437
239 Ga0209050_1005527 3300025298 Bacteria 7897
240 Ga0209256_1001496 3300025299 Bacteria 23700
241 Ga0209256_1035465 3300025299 Bacteria 1318
242 Ga0209051_1003588 3300025303 Bacteria 10093
243 Ga0209257_1000370 3300025304 Bacteria 90934
244 Ga0209257_1000409 3300025304 Bacteria 83301
245 Ga0209257_1001224 3300025304 Bacteria 32015
246 Ga0209257_1002160 3300025304 Bacteria 20420
247 Ga0209257_1007513 3300025304 Bacteria 6555
248 Ga0207682_10285371 3300025893 Bacteria 772
249 Ga0207692_10229843 3300025898 Bacteria 1103
250 Ga0207692_11176754 3300025898 Bacteria 509
251 Ga0207710_10100034 3300025900 Bacteria 1366
252 Ga0207688_10037428 3300025901 Bacteria 2691
253 Ga0207680_10089091 3300025903 Bacteria 1958
254 Ga0207680_10471894 3300025903 Bacteria 892
255 Ga0207680_10550636 3300025903 Bacteria 824
256 Ga0207699_10164444 3300025906 Bacteria 1480
257 Ga0207699_10713343 3300025906 Bacteria 734
258 Ga0207705_10679667 3300025909 Bacteria 800
259 Ga0207684_10510356 3300025910 Bacteria 1030
260 Ga0207654_10183940 3300025911 Bacteria 1365
261 Ga0207707_10021959 3300025912 Bacteria 5578
262 Ga0207695_10012854 3300025913 Bacteria 10022
263 Ga0207695_10388088 3300025913 Bacteria 1281
264 Ga0207693_10039298 3300025915 Bacteria 3726
265 Ga0207693_10294563 3300025915 Bacteria 1271
266 Ga0207660_10018742 3300025917 Bacteria 4619
267 Ga0207646_10007709 3300025922 Bacteria 10895
268 Ga0207681_10027072 3300025923 Bacteria 3704
269 Ga0207694_10021272 3300025924 Bacteria 4915
270 Ga0207650_10072640 3300025925 Bacteria 2589
271 Ga0207687_11190614 3300025927 Bacteria 655
272 Ga0207700_10045252 3300025928 Bacteria 3246
273 Ga0207700_10254205 3300025928 Bacteria 1502
274 Ga0207700_10384772 3300025928 Bacteria 1227
275 Ga0207664_11984201 3300025929 Bacteria 505
276 Ga0207644_10006651 3300025931 Bacteria 7534
277 Ga0207644_10105263 3300025931 Bacteria 2125
278 Ga0207690_11488251 3300025932 Bacteria 566
279 Ga0207686_10491576 3300025934 Bacteria 951
280 Ga0207709_10402871 3300025935 Bacteria 1046
281 Ga0207669_11498392 3300025937 Bacteria 575
282 Ga0207665_10036574 3300025939 Bacteria 3266
283 Ga0207691_10830856 3300025940 Bacteria 775
284 Ga0207711_10007833 3300025941 Bacteria 8930
285 Ga0207689_11280218 3300025942 Bacteria 616
286 Ga0207661_11375989 3300025944 Bacteria 648
287 Ga0207679_10082560 3300025945 Bacteria 2461
288 Ga0207667_10156302 3300025949 Bacteria 2346
289 Ga0207651_10689479 3300025960 Bacteria 899
290 Ga0207668_10000001 3300025972 Bacteria 266091
291 Ga0207668_10000788 3300025972 Bacteria 19416
292 Ga0207668_10009607 3300025972 Bacteria 5806
293 Ga0207668_10050913 3300025972 Bacteria 2857
294 Ga0207668_10059647 3300025972 Bacteria 2674
295 Ga0207640_10048386 3300025981 Bacteria 2748
296 Ga0207640_10178730 3300025981 Bacteria 1589
297 Ga0207658_10033729 3300025986 Bacteria 3653
298 Ga0207658_10281603 3300025986 Bacteria 1425
299 Ga0207658_10428118 3300025986 Bacteria 1168
300 Ga0207658_10480879 3300025986 Bacteria 1103
301 Ga0207658_10685955 3300025986 Bacteria 925
302 Ga0207658_11241639 3300025986 Bacteria 681
303 Ga0207703_10000853 3300026035 Bacteria 29885
304 Ga0207703_10398734 3300026035 Bacteria 1276
305 Ga0207703_10685681 3300026035 Bacteria 974
306 Ga0207639_10028193 3300026041 Bacteria 4098
307 Ga0207708_11747807 3300026075 Bacteria 546
308 Ga0207702_10014179 3300026078 Bacteria 6621
309 Ga0207702_10382189 3300026078 Bacteria 1354
310 Ga0207702_11670649 3300026078 Bacteria 630
311 Ga0207641_10009231 3300026088 Bacteria 8134
312 Ga0207641_10547196 3300026088 Bacteria 1128
313 Ga0207641_12231524 3300026088 Bacteria 547
314 Ga0207676_11316255 3300026095 Bacteria 717
315 Ga0207674_10014006 3300026116 Bacteria 8864
316 Ga0207674_11494785 3300026116 Bacteria 645
317 Ga0207675_100123248 3300026118 Bacteria 2454
318 Ga0207675_100150277 3300026118 Bacteria 2216
319 Ga0207675_100560868 3300026118 Bacteria 1142
320 Ga0207675_102072416 3300026118 Bacteria 586
321 Ga0207683_10559549 3300026121 Bacteria 1057
322 Ga0207698_10238154 3300026142 Bacteria 1656
323 Ga0209179_1014467 3300027512 Bacteria 1449
324 Ga0209813_10107888 3300027866 Bacteria 955
325 Ga0209974_10082854 3300027876 Bacteria 1106
326 Ga0268266_10000289 3300028379 Bacteria 82515
327 Ga0268266_10515013 3300028379 Bacteria 1143
328 Ga0268265_10009694 3300028380 Bacteria 6500
329 Ga0268265_10032194 3300028380 Bacteria 3796
330 Ga0268265_10034718 3300028380 Bacteria 3678
331 Ga0268265_10038125 3300028380 Bacteria 3533
332 Ga0268265_10047612 3300028380 Bacteria 3214
333 Ga0268265_10129127 3300028380 Bacteria 2097
334 Ga0268265_10672417 3300028380 Bacteria 997
335 Ga0268265_11285093 3300028380 Bacteria 731
336 Ga0268264_10000002 3300028381 Bacteria 1153045
337 Ga0268264_10004796 3300028381 Bacteria 11473
338 Ga0268264_10091280 3300028381 Bacteria 2627
339 Ga0268264_10266544 3300028381 Bacteria 1598
340 Ga0268264_10964839 3300028381 Bacteria 858
341 Ga0268264_11161231 3300028381 Bacteria 781
342 Ga0307517_10457111 3300028786 Bacteria 660
343 Ga0307517_10502388 3300028786 Bacteria 617
344 Ga0307515_10813774 3300028794 Bacteria 558
345 Ga0265338_10485315 3300028800 Bacteria 871
346 Ga0265338_10773414 3300028800 Bacteria 659
347 Ga0265324_10031472 3300029957 Bacteria 1858
348 Ga0265770_1075487 3300030878 Bacteria 651
349 Ga0265328_10236457 3300031239 Bacteria 698
350 Ga0265331_10183531 3300031250 Bacteria 945
351 Ga0265327_10001376 3300031251 Bacteria 31183
352 Ga0265327_10004207 3300031251 Bacteria 12935
353 Ga0265316_11299408 3300031344 Bacteria 502
354 Ga0307513_10000127 3300031456 Bacteria 107100
355 Ga0307513_10158741 3300031456 Bacteria 2157
356 Ga0307408_100457312 3300031548 Bacteria 1109
357 Ga0265314_10083450 3300031711 Bacteria 2100
358 Ga0307516_10000035 3300031730 Bacteria 152658
359 Ga0307405_10336935 3300031731 Bacteria 1158
360 Ga0307405_10893790 3300031731 Bacteria 751
361 Ga0307413_10285044 3300031824 Bacteria 1244
362 Ga0307413_10318329 3300031824 Bacteria 1187
363 Ga0307413_10811507 3300031824 Bacteria 787
364 Ga0307413_10847992 3300031824 Bacteria 772
365 Ga0307413_11481006 3300031824 Bacteria 599
366 Ga0307413_11806698 3300031824 Bacteria 547
367 Ga0307410_11081204 3300031852 Bacteria 695
368 Ga0307406_10008219 3300031901 Bacteria 5816
369 Ga0307406_10044106 3300031901 Bacteria 2794
370 Ga0307406_10938816 3300031901 Bacteria 739
371 Ga0307412_10103883 3300031911 Bacteria 2015
372 Ga0307412_10169917 3300031911 Bacteria 1629
373 Ga0307412_10420421 3300031911 Bacteria 1093
374 Ga0307409_101869999 3300031995 Bacteria 630
375 Ga0307416_100957699 3300032002 Bacteria 958
376 Ga0307414_10049981 3300032004 Bacteria 2894
377 Ga0307414_10089771 3300032004 Bacteria 2278
378 Ga0307414_10092398 3300032004 Bacteria 2252
379 Ga0307414_10202473 3300032004 Bacteria 1616
380 Ga0307414_10218078 3300032004 Bacteria 1564
381 Ga0307414_10315927 3300032004 Bacteria 1327
382 Ga0307414_10404496 3300032004 Bacteria 1186
383 Ga0307414_10452242 3300032004 Bacteria 1126
384 Ga0307414_10700980 3300032004 Bacteria 916
385 Ga0307414_11221157 3300032004 Bacteria 696
386 Ga0307414_11776761 3300032004 Bacteria 575
387 Ga0307414_11942081 3300032004 Bacteria 549
388 Ga0307411_10555384 3300032005 Bacteria 980
389 Ga0307411_11523166 3300032005 Bacteria 615
390 Ga0307411_12344798 3300032005 Bacteria 502
391 Ga0307415_101521253 3300032126 Bacteria 641
392 Ga0373950_0035310 3300034818 Bacteria 940
393 Ga0373928_0192667 3300035084 Bacteria 584
394 Ga0373929_0151606 3300035085 Bacteria 622
395 Ga0373932_0016559 3300035112 Bacteria 1883
396 Ga0373941_0019225 3300035115 Bacteria 1899
397 Ga0373960_0028255 3300035121 Bacteria 1546
398 Ga0373943_0044266 3300035170 Bacteria 2166
399 Ga0373946_0275986 3300035171 Bacteria 826
400 Ga0373961_0188346 3300035241 Bacteria 722
401 Ga0373962_0013376 3300035242 Bacteria 2078
402 Ga0373931_0003958 3300035691 Bacteria 6707
403 Ga0373931_0046009 3300035691 Bacteria 2306
404 Ga0373931_0513793 3300035691 Bacteria 774
405 Ga0373935_0428854 3300035692 Bacteria 953
406 Ga0373927_0633406 3300035695 Bacteria 707
407 Ga0373927_0872616 3300035695 Bacteria 594
408 Ga0373947_0073967 3300035725 Bacteria 2095
409 Ga0373925_0890870 3300037068 Bacteria 733
410 Ga0373925_1288224 3300037068 Bacteria 600
411 Ga0395899_0078988 3300037312 Bacteria 2397
412 Ga0395899_0168195 3300037312 Bacteria 1545
413 Ga0395899_0233273 3300037312 Bacteria 1270
414 Ga0395899_0739223 3300037312 Bacteria 613
415 Ga0395900_0992964 3300037418 Bacteria 760
416 Ga0395898_0126973 3300037466 Bacteria 2443
417 Ga0395905_0000074 3300037471 Bacteria 167312
418 Ga0395905_0038011 3300037471 Bacteria 4516
419 Ga0395905_0261644 3300037471 Bacteria 1615
420 Ga0395905_1268934 3300037471 Bacteria 640
421 Ga0395905_1325201 3300037471 Bacteria 624
422 Ga0436364_0024094 3300037853 Bacteria 578
423 Ga0436364_0105293 3300037853 Bacteria 2010
424 Ga0436364_0494145 3300037853 Bacteria 2475
425 Ga0395901_0415239 3300038443 Bacteria 1381
426 Ga0395901_1589395 3300038443 Bacteria 607
427 Ga0395901_1777805 3300038443 Bacteria 566
428 Ga0395901_1805916 3300038443 Bacteria 560
429 Ga0436365_1205169 3300039437 Bacteria 1109
430 Ga0436365_1302237 3300039437 Bacteria 1024
431 Ga0436365_1302431 3300039437 Bacteria 1261
432 Ga0436365_1869211 3300039437 Bacteria 2482
433 Ga0436360_0352378 3300039438 Unclassified 1156
434 Ga0436360_0397582 3300039438 Bacteria 571
435 Ga0436360_0444055 3300039438 Unclassified 530
436 Ga0436360_0610713 3300039438 Bacteria 513
437 Ga0436360_1069376 3300039438 Unclassified 645
438 Ga0436361_0673108 3300039447 Bacteria 1480
439 Ga0436361_0992022 3300039447 Bacteria 1675
440 Ga0436363_1161045 3300039450 Bacteria 520
441 Ga0436362_0307500 3300039453 Bacteria 747
442 Ga0436362_0390765 3300039453 Bacteria 2615
443 Ga0436362_0631106 3300039453 Bacteria 637
444 Ga0436362_1292192 3300039453 Unclassified 662
445 Ga0451789_0073144 3300041443 Bacteria 518
446 Ga0451791_0190273 3300041451 Bacteria 1198
447 Ga0451793_0577158 3300041452 Bacteria 533
448 Ga0451798_0271510 3300041458 Bacteria 674
449 Ga0451806_874067 3300041462 Bacteria 630
450 Ga0451807_0142948 3300041486 Bacteria 547
451 Ga0451807_1860837 3300041486 Bacteria 1059
452 Ga0451807_2662128 3300041486 Bacteria 528
453 Ga0451837_1558520 3300041494 Bacteria 999
454 Ga0451837_1691330 3300041494 Bacteria 658
455 Ga0451843_0161838 3300041509 Bacteria 502
456 Ga0451855_0842537 3300041511 Bacteria 508
457 Ga0451853_0267609 3300041512 Bacteria 567
458 Ga0450896_049242 3300042133 Bacteria 669
459 Ga0450900_077914 3300042136 Bacteria 530
460 Ga0439459_0173159 3300042438 Bacteria 576
461 Ga0450901_003323 3300042533 Bacteria 1686
462 Ga0451577_1762069 3300042876 Bacteria 544
463 Ga0466972_0100400 3300044658 Bacteria 1370
464 Ga0466966_0570447 3300044684 Bacteria 681
465 Ga0466961_0198278 3300044693 Bacteria 1242
466 Ga0466959_0180480 3300045049 Bacteria 1477
467 Ga0466959_0399455 3300045049 Bacteria 934
468 Ga0495627_168304 3300046453 Bacteria 609
469 Ga0495638_0050607 3300046460 Bacteria 2594
470 Ga0495651_0919943 3300046462 Bacteria 534
471 Ga0495650_0200916 3300046471 Bacteria 693
472 Ga0495580_0030065 3300046472 Bacteria 3936
473 Ga0495610_0386777 3300046512 Bacteria 519
474 Ga0495654_0332891 3300046530 Bacteria 614
475 Ga0495633_0005158 3300046558 Bacteria 8091
476 Ga0495633_0345603 3300046558 Bacteria 674
477 Ga0495668_0101432 3300046616 Bacteria 1574
478 Ga0495668_0109638 3300046616 Bacteria 1510
479 Ga0495668_0137104 3300046616 Bacteria 1339
480 Ga0495668_0413029 3300046616 Bacteria 742
481 Ga0495625_0022857 3300046660 Bacteria 4784
482 Ga0495671_0105539 3300046692 Bacteria 1376
483 Ga0495672_0000570 3300047320 Bacteria 41708
484 Ga0495673_0000905 3300047469 Bacteria 27167
485 Ga0495686_0027673 3300047472 Bacteria 3700
486 Ga0496102_0724079 3300048905 Bacteria 918
487 Ga0496102_1198350 3300048905 Bacteria 679
488 Ga0496104_0302469 3300048907 Bacteria 1512
489 Ga0496110_0319583 3300048913 Bacteria 1414
490 Ga0496110_1017762 3300048913 Bacteria 736
491 Ga0496110_1037305 3300048913 Bacteria 728
492 Ga0496113_0181823 3300048916 Bacteria 1667
493 Ga0496113_1337411 3300048916 Bacteria 556
494 Ga0496114_1556723 3300048917 Bacteria 549
495 Ga0496115_0246775 3300048918 Bacteria 1471
496 Ga0496115_0375408 3300048918 Bacteria 1157
497 Ga0496116_0057554 3300048919 Bacteria 2541
498 Ga0496121_0502688 3300048924 Bacteria 769
499 Ga0496122_0006991 3300048925 Bacteria 12705
500 Ga0496123_0000512 3300048926 Bacteria 67458
501 Ga0496123_0234352 3300048926 Bacteria 916
502 Ga0496124_0479513 3300048927 Bacteria 840
503 Ga0496125_0002197 3300048928 Bacteria 26053
504 Ga0496126_0193760 3300048929 Bacteria 1720
505 Ga0496126_0473775 3300048929 Bacteria 1004
506 Ga0496126_0488378 3300048929 Bacteria 986
507 Ga0496126_0686209 3300048929 Bacteria 797
508 Ga0501306_019854 3300049127 Bacteria 930
509 Ga0501305_034138 3300049161 Bacteria 805
510 Ga0501307_015986 3300049162 Bacteria 932
511 Ga0501034_0037721 3300049571 Bacteria 4895
512 Ga0501034_0097931 3300049571 Bacteria 2929
513 Ga0501034_0583930 3300049571 Bacteria 1024
514 Ga0501043_0148599 3300049579 Bacteria 1834
515 Ga0501043_0220089 3300049579 Bacteria 1469
516 Ga0501047_0462790 3300049581 Bacteria 1097
517 Ga0501047_1132910 3300049581 Bacteria 596
518 Ga0501070_0715790 3300049586 Bacteria 791
519 Ga0501073_0173020 3300049589 Bacteria 1495
520 Ga0501073_0456133 3300049589 Bacteria 884
521 Ga0501075_0183626 3300049591 Bacteria 1596
522 Ga0501076_0692802 3300049592 Bacteria 841
523 Ga0501249_000314 3300049679 Bacteria 13443
524 Ga0501257_035690 3300049686 Bacteria 1209
525 Ga0501035_0012306 3300049822 Bacteria 7911
526 Ga0501035_0280469 3300049822 Bacteria 1408
527 Ga0501044_0346039 3300049823 Bacteria 1407
528 Ga0501044_1183000 3300049823 Bacteria 633
529 Ga0501204_029066 3300049850 Bacteria 759
530 Ga0501220_03002 3300049852 Bacteria 722
531 nmdc:mga03683_147569_c1 3300050489 Bacteria 1060
532 nmdc:mga03683_249541_c1 3300050489 Bacteria 824
533 nmdc:mga03n38_172095_c1 3300050490 Bacteria 1104
534 nmdc:mga03n38_71366_c1 3300050490 Bacteria 1608
535 nmdc:mga00v17_149244_c1 3300050491 Bacteria 1501
536 nmdc:mga00v17_86131_c1 3300050491 Bacteria 1968
537 nmdc:mga00v17_8625_c1 3300050491 Bacteria 5489
538 nmdc:mga0yw44_9633_c1 3300050492 Bacteria 4899
539 nmdc:mga0k408_41152_c1 3300050493 Bacteria 2660
540 nmdc:mga06z11_168624_c1 3300050494 Bacteria 1256
541 nmdc:mga06z11_659071_c1 3300050494 Bacteria 637
542 nmdc:mga04h51_127061_c1 3300050495 Bacteria 955
543 nmdc:mga07m45_476004_c1 3300050496 Bacteria 724
544 nmdc:mga0qj67_1187378_c1 3300050509 Bacteria 594
545 nmdc:mga0rr50_100378_c1 3300050513 Bacteria 2273
546 nmdc:mga08x19_290106_c1 3300050514 Bacteria 1135
547 nmdc:mga0sz30_42011_c1 3300050516 Bacteria 1923
548 nmdc:mga0sz30_438554_c1 3300050516 Bacteria 586
549 Ga0500635_0000422 3300053080 Bacteria 12500
550 Ga0500578_0489174 3300053086 Bacteria 694
551 Ga0500643_002598 3300053087 Bacteria 9162
552 Ga0500643_005164 3300053087 Bacteria 5695
553 Ga0500643_011017 3300053087 Bacteria 3327
554 Ga0500643_017450 3300053087 Bacteria 2403
555 Ga0500643_043970 3300053087 Bacteria 1301
556 Ga0500643_096979 3300053087 Bacteria 801
557 Ga0500644_0000538 3300053088 Bacteria 15641
558 Ga0500644_0005614 3300053088 Bacteria 3173
559 Ga0500646_0089107 3300053090 Bacteria 952
560 Ga0500647_0003244 3300053091 Bacteria 6301
561 Ga0500651_0023820 3300053093 Bacteria 3835
562 Ga0500651_0155363 3300053093 Bacteria 1371
563 Ga0500641_0000911 3300053096 Bacteria 10559
564 Ga0500641_0001879 3300053096 Bacteria 7457
565 Ga0500556_0002706 3300053104 Bacteria 5486
566 Ga0500562_000413 3300053108 Bacteria 10379
567 Ga0500569_301107 3300053109 Bacteria 539
568 Ga0500572_000338 3300053111 Bacteria 16833
569 Ga0500608_000027 3300053122 Bacteria 66998
570 Ga0500608_000115 3300053122 Bacteria 33075
571 Ga0500614_135923 3300053123 Bacteria 733
572 Ga0500618_006992 3300053125 Bacteria 3259
573 Ga0500559_0068723 3300053136 Bacteria 1592
574 Ga0500559_0129567 3300053136 Bacteria 1178
575 Ga0500559_0216386 3300053136 Bacteria 904
576 Ga0500564_000352 3300053138 Bacteria 12948
577 Ga0500568_0215613 3300053139 Bacteria 702
578 Ga0500574_115977 3300053141 Bacteria 793
579 Ga0500590_065546 3300053148 Bacteria 1816
580 Ga0500604_0043280 3300053151 Bacteria 1368
581 Ga0500616_0006408 3300053153 Bacteria 7714
582 Ga0500616_0063347 3300053153 Bacteria 1907
583 Ga0500622_0077075 3300053156 Bacteria 1675
584 Ga0500624_000064 3300053157 Bacteria 65293
585 Ga0500636_0000932 3300053177 Bacteria 15727
586 Ga0500636_0015974 3300053177 Bacteria 4425
587 Ga0500611_205814 3300053727 Unclassified 558
588 Ga0500645_002360 3300053730 Bacteria 8508
589 Ga0500645_009677 3300053730 Bacteria 3228
590 Ga0500645_075558 3300053730 Bacteria 964
591 Ga0501084_0550938 3300054114 Bacteria 974
592 Ga0501084_0963631 3300054114 Bacteria 717
593 Ga0500661_011784 3300055283 Bacteria 1581
594 Ga0587070_085131 3300059491 Bacteria 701
595 Ga0587067_136638 3300059640 Bacteria 603
596 Ga0587114_074328 3300059655 Bacteria 621
597 Ga0501082_0000974 3300060353 Bacteria 25286

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006051 Ga0075364_10579879 Ga0075364_105798792 72
2 3300010375 Ga0105239_10868399 Ga0105239_108683992 72
3 3300013105 Ga0157369_11086359 Ga0157369_110863591 72
4 3300039450 Ga0436363_1161045 Ga0436363_1161045_78_377 72
5 iso_pu_bacteria 2595698237 2596374536 72
6 iso_pu_bacteria 2889306138 2889310510 72
7 iso_pu_bacteria 2902330777 2902335727 72
8 iso_pu_bacteria 2902405164 2902405821 72
9 iso_pu_bacteria 2928125067 2928125168 72
10 3300003316 rootH1_10153469 rootH1_101534692 73
11 3300005329 Ga0070683_100414316 Ga0070683_1004143161 73
12 3300005367 Ga0070667_100333278 Ga0070667_1003332782 73
13 3300005441 Ga0070700_101013400 Ga0070700_1010134002 73
14 3300009551 Ga0105238_11381458 Ga0105238_113814582 73
15 3300010375 Ga0105239_12218423 Ga0105239_122184231 73
16 3300013306 Ga0163162_11108893 Ga0163162_111088932 73
17 3300014325 Ga0163163_12489537 Ga0163163_124895371 73
18 3300014326 Ga0157380_10148851 Ga0157380_101488513 73
19 3300017792 Ga0163161_10878350 Ga0163161_108783502 73
20 3300025901 Ga0207688_10037428 Ga0207688_100374284 73
21 3300025927 Ga0207687_11190614 Ga0207687_111906141 73
22 3300025986 Ga0207658_10281603 Ga0207658_102816033 73
23 3300026075 Ga0207708_11747807 Ga0207708_117478071 73
24 3300041462 Ga0451806_874067 Ga0451806_874067_291_566 73
25 3300042876 Ga0451577_1762069 Ga0451577_1762069_229_459 73
26 iso_pu_bacteria 641522639 641644468 73
27 iso_pu_bacteria 643348564 643601008 73
28 3300003215 JGI25153J46596_10086969 JGI25153J46596_100869691 74
29 3300003320 rootH2_10010501 rootH2_100105012 74
30 3300003320 rootH2_10020043 rootH2_100200434 74
31 3300003323 rootH1_10022222 rootH1_100222226 74
32 3300003323 rootH1_10027576 rootH1_100275762 74
33 3300003323 rootH1_10136079 rootH1_101360792 74
34 3300003323 rootH1_10156035 rootH1_101560352 74
35 3300003323 rootH1_10181512 rootH1_101815122 74
36 3300003775 Ga0055524_1015750 Ga0055524_10157502 74
37 3300003791 Ga0055530_10000571 Ga0055530_1000057118 74
38 3300003794 Ga0055531_10008699 Ga0055531_100086997 74
39 3300003794 Ga0055531_10042677 Ga0055531_100426772 74
40 3300004625 Ga0055543_1052995 Ga0055543_10529952 74
41 3300005262 Ga0065165_1003949 Ga0065165_10039494 74
42 3300005330 Ga0070690_100683287 Ga0070690_1006832872 74
43 3300005331 Ga0070670_101420061 Ga0070670_1014200611 74
44 3300005334 Ga0068869_100048118 Ga0068869_1000481182 74
45 3300005335 Ga0070666_10249321 Ga0070666_102493211 74
46 3300005335 Ga0070666_10331925 Ga0070666_103319252 74
47 3300005335 Ga0070666_10925604 Ga0070666_109256042 74
48 3300005335 Ga0070666_11243970 Ga0070666_112439701 74
49 3300005336 Ga0070680_100448767 Ga0070680_1004487672 74
50 3300005339 Ga0070660_100256266 Ga0070660_1002562662 74
51 3300005343 Ga0070687_100894717 Ga0070687_1008947171 74
52 3300005344 Ga0070661_101879898 Ga0070661_1018798981 74
53 3300005347 Ga0070668_100001069 Ga0070668_10000106921 74
54 3300005347 Ga0070668_100002342 Ga0070668_10000234213 74
55 3300005347 Ga0070668_100083220 Ga0070668_1000832202 74
56 3300005353 Ga0070669_100010474 Ga0070669_1000104746 74
57 3300005355 Ga0070671_100005043 Ga0070671_1000050436 74
58 3300005355 Ga0070671_100433934 Ga0070671_1004339342 74
59 3300005356 Ga0070674_101674281 Ga0070674_1016742811 74
60 3300005364 Ga0070673_100252580 Ga0070673_1002525802 74
61 3300005367 Ga0070667_100015181 Ga0070667_1000151814 74
62 3300005367 Ga0070667_100152833 Ga0070667_1001528332 74
63 3300005367 Ga0070667_101348318 Ga0070667_1013483181 74
64 3300005367 Ga0070667_102215475 Ga0070667_1022154751 74
65 3300005435 Ga0070714_100769827 Ga0070714_1007698272 74
66 3300005437 Ga0070710_11271791 Ga0070710_112717911 74
67 3300005456 Ga0070678_100341893 Ga0070678_1003418932 74
68 3300005456 Ga0070678_100517604 Ga0070678_1005176042 74
69 3300005457 Ga0070662_100115657 Ga0070662_1001156571 74
70 3300005458 Ga0070681_10047452 Ga0070681_100474522 74
71 3300005459 Ga0068867_100570176 Ga0068867_1005701761 74
72 3300005459 Ga0068867_101903846 Ga0068867_1019038461 74
73 3300005539 Ga0068853_100062467 Ga0068853_1000624673 74
74 3300005539 Ga0068853_101909071 Ga0068853_1019090711 74
75 3300005548 Ga0070665_100849607 Ga0070665_1008496071 74
76 3300005563 Ga0068855_100086104 Ga0068855_1000861042 74
77 3300005563 Ga0068855_101787214 Ga0068855_1017872142 74
78 3300005564 Ga0070664_100643618 Ga0070664_1006436182 74
79 3300005578 Ga0068854_100062173 Ga0068854_1000621734 74
80 3300005614 Ga0068856_100756330 Ga0068856_1007563302 74
81 3300005616 Ga0068852_100237716 Ga0068852_1002377162 74
82 3300005617 Ga0068859_100000747 Ga0068859_10000074718 74
83 3300005617 Ga0068859_100152130 Ga0068859_1001521301 74
84 3300005618 Ga0068864_100121216 Ga0068864_1001212162 74
85 3300005719 Ga0068861_100070157 Ga0068861_1000701572 74
86 3300005719 Ga0068861_100148174 Ga0068861_1001481742 74
87 3300005841 Ga0068863_100006424 Ga0068863_10000642415 74
88 3300005841 Ga0068863_100040925 Ga0068863_1000409254 74
89 3300005842 Ga0068858_100001493 Ga0068858_10000149318 74
90 3300005842 Ga0068858_100220377 Ga0068858_1002203772 74
91 3300005842 Ga0068858_101448640 Ga0068858_1014486401 74
92 3300005843 Ga0068860_100000327 Ga0068860_10000032713 74
93 3300005843 Ga0068860_100010879 Ga0068860_1000108793 74
94 3300005843 Ga0068860_100011682 Ga0068860_1000116823 74
95 3300005844 Ga0068862_100045557 Ga0068862_1000455573 74
96 3300005844 Ga0068862_100078594 Ga0068862_1000785943 74
97 3300005844 Ga0068862_100098778 Ga0068862_1000987782 74
98 3300005844 Ga0068862_100182050 Ga0068862_1001820504 74
99 3300005937 Ga0081455_10272502 Ga0081455_102725023 74
100 3300006038 Ga0075365_10001302 Ga0075365_100013029 74
101 3300006038 Ga0075365_10237254 Ga0075365_102372542 74
102 3300006042 Ga0075368_10176781 Ga0075368_101767812 74
103 3300006048 Ga0075363_100043635 Ga0075363_1000436352 74
104 3300006048 Ga0075363_100104157 Ga0075363_1001041572 74
105 3300006048 Ga0075363_100213751 Ga0075363_1002137512 74
106 3300006051 Ga0075364_10060971 Ga0075364_100609712 74
107 3300006051 Ga0075364_10064139 Ga0075364_100641394 74
108 3300006051 Ga0075364_10219204 Ga0075364_102192041 74
109 3300006177 Ga0075362_10083515 Ga0075362_100835152 74
110 3300006177 Ga0075362_10224686 Ga0075362_102246862 74
111 3300006177 Ga0075362_10412972 Ga0075362_104129721 74
112 3300006178 Ga0075367_10197226 Ga0075367_101972262 74
113 3300006178 Ga0075367_10307993 Ga0075367_103079932 74
114 3300006186 Ga0075369_10263727 Ga0075369_102637271 74
115 3300006195 Ga0075366_10022642 Ga0075366_100226424 74
116 3300006195 Ga0075366_10885451 Ga0075366_108854512 74
117 3300006353 Ga0075370_10158892 Ga0075370_101588922 74
118 3300006353 Ga0075370_10203624 Ga0075370_102036242 74
119 3300006931 Ga0097620_100000747 Ga0097620_10000074723 74
120 3300006931 Ga0097620_100152118 Ga0097620_1001521181 74
121 3300009093 Ga0105240_10049464 Ga0105240_100494646 74
122 3300009093 Ga0105240_10492145 Ga0105240_104921452 74
123 3300009093 Ga0105240_11664757 Ga0105240_116647572 74
124 3300009098 Ga0105245_10762026 Ga0105245_107620262 74
125 3300009098 Ga0105245_10924969 Ga0105245_109249692 74
126 3300009101 Ga0105247_10018423 Ga0105247_100184234 74
127 3300009101 Ga0105247_10682395 Ga0105247_106823952 74
128 3300009101 Ga0105247_11177633 Ga0105247_111776331 74
129 3300009147 Ga0114129_13418963 Ga0114129_134189631 74
130 3300009174 Ga0105241_10246070 Ga0105241_102460702 74
131 3300009177 Ga0105248_10016266 Ga0105248_1001626610 74
132 3300009177 Ga0105248_10326116 Ga0105248_103261162 74
133 3300009177 Ga0105248_12535967 Ga0105248_125359671 74
134 3300009545 Ga0105237_11458609 Ga0105237_114586092 74
135 3300009551 Ga0105238_10709853 Ga0105238_107098532 74
136 3300012497 Ga0157319_1007429 Ga0157319_10074292 74
137 3300013100 Ga0157373_10013213 Ga0157373_100132134 74
138 3300013100 Ga0157373_10031568 Ga0157373_100315681 74
139 3300013102 Ga0157371_10006560 Ga0157371_100065605 74
140 3300013102 Ga0157371_10438399 Ga0157371_104383991 74
141 3300013104 Ga0157370_10014798 Ga0157370_100147989 74
142 3300013104 Ga0157370_10070380 Ga0157370_100703805 74
143 3300013104 Ga0157370_10108920 Ga0157370_101089202 74
144 3300013104 Ga0157370_11602071 Ga0157370_116020712 74
145 3300013105 Ga0157369_10075280 Ga0157369_100752802 74
146 3300013105 Ga0157369_10180493 Ga0157369_101804932 74
147 3300013306 Ga0163162_10041689 Ga0163162_100416892 74
148 3300013308 Ga0157375_13294465 Ga0157375_132944651 74
149 3300014325 Ga0163163_10003065 Ga0163163_100030653 74
150 3300014326 Ga0157380_10554161 Ga0157380_105541612 74
151 3300014326 Ga0157380_11403009 Ga0157380_114030092 74
152 3300014326 Ga0157380_11893286 Ga0157380_118932862 74
153 3300014326 Ga0157380_12289991 Ga0157380_122899912 74
154 3300014745 Ga0157377_10986890 Ga0157377_109868901 74
155 3300014968 Ga0157379_10002854 Ga0157379_100028548 74
156 3300014968 Ga0157379_10268730 Ga0157379_102687301 74
157 3300015684 Ga0183365_10001 Ga0183365_100011376 74
158 3300017792 Ga0163161_10245295 Ga0163161_102452952 74
159 3300017792 Ga0163161_10283381 Ga0163161_102833812 74
160 3300017792 Ga0163161_11218984 Ga0163161_112189842 74
161 3300020069 Ga0197907_10101668 Ga0197907_101016681 74
162 3300021384 Ga0213876_10304202 Ga0213876_103042021 74
163 3300021388 Ga0213875_10166063 Ga0213875_101660632 74
164 3300025231 Ga0207427_101305 Ga0207427_1013054 74
165 3300025250 Ga0209026_1005069 Ga0209026_10050693 74
166 3300025254 Ga0209148_1029566 Ga0209148_10295662 74
167 3300025254 Ga0209148_1031523 Ga0209148_10315232 74
168 3300025254 Ga0209148_1049496 Ga0209148_10494961 74
169 3300025261 Ga0209233_1003261 Ga0209233_10032612 74
170 3300025292 Ga0209676_1000046 Ga0209676_100004623 74
171 3300025292 Ga0209676_1004867 Ga0209676_10048677 74
172 3300025295 Ga0209564_1000031 Ga0209564_1000031453 74
173 3300025297 Ga0209758_1002155 Ga0209758_10021557 74
174 3300025298 Ga0209050_1001136 Ga0209050_100113614 74
175 3300025298 Ga0209050_1005527 Ga0209050_10055274 74
176 3300025299 Ga0209256_1001496 Ga0209256_100149618 74
177 3300025299 Ga0209256_1035465 Ga0209256_10354652 74
178 3300025304 Ga0209257_1000409 Ga0209257_100040985 74
179 3300025304 Ga0209257_1001224 Ga0209257_100122414 74
180 3300025304 Ga0209257_1002160 Ga0209257_100216016 74
181 3300025893 Ga0207682_10285371 Ga0207682_102853712 74
182 3300025900 Ga0207710_10100034 Ga0207710_101000342 74
183 3300025903 Ga0207680_10089091 Ga0207680_100890913 74
184 3300025903 Ga0207680_10471894 Ga0207680_104718942 74
185 3300025903 Ga0207680_10550636 Ga0207680_105506361 74
186 3300025909 Ga0207705_10679667 Ga0207705_106796672 74
187 3300025911 Ga0207654_10183940 Ga0207654_101839402 74
188 3300025912 Ga0207707_10021959 Ga0207707_100219594 74
189 3300025913 Ga0207695_10012854 Ga0207695_100128549 74
190 3300025913 Ga0207695_10388088 Ga0207695_103880882 74
191 3300025917 Ga0207660_10018742 Ga0207660_100187422 74
192 3300025923 Ga0207681_10027072 Ga0207681_100270726 74
193 3300025924 Ga0207694_10021272 Ga0207694_100212723 74
194 3300025925 Ga0207650_10072640 Ga0207650_100726402 74
195 3300025929 Ga0207664_11984201 Ga0207664_119842011 74
196 3300025931 Ga0207644_10006651 Ga0207644_100066512 74
197 3300025931 Ga0207644_10105263 Ga0207644_101052632 74
198 3300025932 Ga0207690_11488251 Ga0207690_114882511 74
199 3300025937 Ga0207669_11498392 Ga0207669_114983921 74
200 3300025940 Ga0207691_10830856 Ga0207691_108308561 74
201 3300025941 Ga0207711_10007833 Ga0207711_100078336 74
202 3300025944 Ga0207661_11375989 Ga0207661_113759891 74
203 3300025945 Ga0207679_10082560 Ga0207679_100825602 74
204 3300025949 Ga0207667_10156302 Ga0207667_101563022 74
205 3300025960 Ga0207651_10689479 Ga0207651_106894792 74
206 3300025972 Ga0207668_10000001 Ga0207668_1000000195 74
207 3300025972 Ga0207668_10000788 Ga0207668_100007883 74
208 3300025972 Ga0207668_10009607 Ga0207668_100096074 74
209 3300025972 Ga0207668_10050913 Ga0207668_100509132 74
210 3300025972 Ga0207668_10059647 Ga0207668_100596472 74
211 3300025981 Ga0207640_10048386 Ga0207640_100483862 74
212 3300025981 Ga0207640_10178730 Ga0207640_101787301 74
213 3300025986 Ga0207658_10033729 Ga0207658_100337292 74
214 3300025986 Ga0207658_10428118 Ga0207658_104281182 74
215 3300025986 Ga0207658_10480879 Ga0207658_104808792 74
216 3300025986 Ga0207658_11241639 Ga0207658_112416392 74
217 3300026035 Ga0207703_10000853 Ga0207703_100008536 74
218 3300026035 Ga0207703_10398734 Ga0207703_103987342 74
219 3300026041 Ga0207639_10028193 Ga0207639_100281933 74
220 3300026078 Ga0207702_10382189 Ga0207702_103821893 74
221 3300026088 Ga0207641_10009231 Ga0207641_100092316 74
222 3300026088 Ga0207641_10547196 Ga0207641_105471961 74
223 3300026088 Ga0207641_12231524 Ga0207641_122315242 74
224 3300026095 Ga0207676_11316255 Ga0207676_113162551 74
225 3300026116 Ga0207674_11494785 Ga0207674_114947852 74
226 3300026118 Ga0207675_100123248 Ga0207675_1001232482 74
227 3300026118 Ga0207675_100150277 Ga0207675_1001502774 74
228 3300026118 Ga0207675_100560868 Ga0207675_1005608682 74
229 3300026121 Ga0207683_10559549 Ga0207683_105595492 74
230 3300026142 Ga0207698_10238154 Ga0207698_102381542 74
231 3300027866 Ga0209813_10107888 Ga0209813_101078881 74
232 3300027876 Ga0209974_10082854 Ga0209974_100828542 74
233 3300028379 Ga0268266_10000289 Ga0268266_1000028990 74
234 3300028379 Ga0268266_10515013 Ga0268266_105150132 74
235 3300028380 Ga0268265_10009694 Ga0268265_100096947 74
236 3300028380 Ga0268265_10032194 Ga0268265_100321944 74
237 3300028380 Ga0268265_10034718 Ga0268265_100347185 74
238 3300028380 Ga0268265_10038125 Ga0268265_100381253 74
239 3300028380 Ga0268265_10047612 Ga0268265_100476123 74
240 3300028380 Ga0268265_10129127 Ga0268265_101291272 74
241 3300028381 Ga0268264_10000002 Ga0268264_1000000267 74
242 3300028381 Ga0268264_10004796 Ga0268264_1000479614 74
243 3300028381 Ga0268264_10091280 Ga0268264_100912804 74
244 3300028381 Ga0268264_10964839 Ga0268264_109648391 74
245 3300028786 Ga0307517_10457111 Ga0307517_104571111 74
246 3300028786 Ga0307517_10502388 Ga0307517_105023882 74
247 3300028794 Ga0307515_10813774 Ga0307515_108137741 74
248 3300028800 Ga0265338_10485315 Ga0265338_104853152 74
249 3300028800 Ga0265338_10773414 Ga0265338_107734142 74
250 3300029957 Ga0265324_10031472 Ga0265324_100314722 74
251 3300031239 Ga0265328_10236457 Ga0265328_102364572 74
252 3300031250 Ga0265331_10183531 Ga0265331_101835312 74
253 3300031251 Ga0265327_10001376 Ga0265327_1000137625 74
254 3300031251 Ga0265327_10004207 Ga0265327_1000420711 74
255 3300031456 Ga0307513_10000127 Ga0307513_1000012753 74
256 3300031456 Ga0307513_10158741 Ga0307513_101587412 74
257 3300031711 Ga0265314_10083450 Ga0265314_100834502 74
258 3300031730 Ga0307516_10000035 Ga0307516_10000035116 74
259 3300031731 Ga0307405_10336935 Ga0307405_103369352 74
260 3300031731 Ga0307405_10893790 Ga0307405_108937901 74
261 3300031824 Ga0307413_10285044 Ga0307413_102850442 74
262 3300031824 Ga0307413_10318329 Ga0307413_103183292 74
263 3300031824 Ga0307413_10811507 Ga0307413_108115071 74
264 3300031824 Ga0307413_10847992 Ga0307413_108479921 74
265 3300031824 Ga0307413_11481006 Ga0307413_114810062 74
266 3300031824 Ga0307413_11806698 Ga0307413_118066981 74
267 3300031852 Ga0307410_11081204 Ga0307410_110812042 74
268 3300031901 Ga0307406_10008219 Ga0307406_100082195 74
269 3300031901 Ga0307406_10044106 Ga0307406_100441066 74
270 3300031901 Ga0307406_10938816 Ga0307406_109388161 74
271 3300031911 Ga0307412_10169917 Ga0307412_101699172 74
272 3300031911 Ga0307412_10420421 Ga0307412_104204212 74
273 3300031995 Ga0307409_101869999 Ga0307409_1018699991 74
274 3300032002 Ga0307416_100957699 Ga0307416_1009576992 74
275 3300032004 Ga0307414_10049981 Ga0307414_100499811 74
276 3300032004 Ga0307414_10089771 Ga0307414_100897712 74
277 3300032004 Ga0307414_10092398 Ga0307414_100923982 74
278 3300032004 Ga0307414_10202473 Ga0307414_102024732 74
279 3300032004 Ga0307414_10218078 Ga0307414_102180782 74
280 3300032004 Ga0307414_10315927 Ga0307414_103159271 74
281 3300032004 Ga0307414_10404496 Ga0307414_104044962 74
282 3300032004 Ga0307414_10452242 Ga0307414_104522421 74
283 3300032004 Ga0307414_10700980 Ga0307414_107009802 74
284 3300032004 Ga0307414_11776761 Ga0307414_117767611 74
285 3300032004 Ga0307414_11942081 Ga0307414_119420811 74
286 3300032005 Ga0307411_10555384 Ga0307411_105553842 74
287 3300032005 Ga0307411_11523166 Ga0307411_115231661 74
288 3300032005 Ga0307411_12344798 Ga0307411_123447981 74
289 3300034818 Ga0373950_0035310 Ga0373950_0035310_62_286 74
290 3300035691 Ga0373931_0513793 Ga0373931_0513793_124_348 74
291 3300035695 Ga0373927_0872616 Ga0373927_0872616_306_530 74
292 3300037312 Ga0395899_0078988 Ga0395899_0078988_981_1205 74
293 3300037312 Ga0395899_0168195 Ga0395899_0168195_1301_1525 74
294 3300037312 Ga0395899_0233273 Ga0395899_0233273_510_734 74
295 3300037312 Ga0395899_0739223 Ga0395899_0739223_59_283 74
296 3300037466 Ga0395898_0126973 Ga0395898_0126973_972_1196 74
297 3300037471 Ga0395905_0000074 Ga0395905_0000074_93024_93248 74
298 3300037471 Ga0395905_0038011 Ga0395905_0038011_1274_1498 74
299 3300037471 Ga0395905_0261644 Ga0395905_0261644_1097_1321 74
300 3300037471 Ga0395905_1268934 Ga0395905_1268934_25_249 74
301 3300037853 Ga0436364_0494145 Ga0436364_0494145_535_759 74
302 3300038443 Ga0395901_0415239 Ga0395901_0415239_100_324 74
303 3300038443 Ga0395901_1589395 Ga0395901_1589395_291_515 74
304 3300038443 Ga0395901_1777805 Ga0395901_1777805_112_336 74
305 3300038443 Ga0395901_1805916 Ga0395901_1805916_244_468 74
306 3300039437 Ga0436365_1302431 Ga0436365_1302431_525_749 74
307 3300039437 Ga0436365_1869211 Ga0436365_1869211_1190_1414 74
308 3300039453 Ga0436362_0307500 Ga0436362_0307500_133_357 74
309 3300041443 Ga0451789_0073144 Ga0451789_0073144_178_402 74
310 3300041451 Ga0451791_0190273 Ga0451791_0190273_321_545 74
311 3300041452 Ga0451793_0577158 Ga0451793_0577158_71_346 74
312 3300041458 Ga0451798_0271510 Ga0451798_0271510_23_247 74
313 3300041486 Ga0451807_0142948 Ga0451807_0142948_286_510 74
314 3300041486 Ga0451807_1860837 Ga0451807_1860837_319_543 74
315 3300041486 Ga0451807_2662128 Ga0451807_2662128_258_482 74
316 3300041494 Ga0451837_1558520 Ga0451837_1558520_332_556 74
317 3300041494 Ga0451837_1691330 Ga0451837_1691330_104_328 74
318 3300041509 Ga0451843_0161838 Ga0451843_0161838_237_461 74
319 3300041511 Ga0451855_0842537 Ga0451855_0842537_117_341 74
320 3300042133 Ga0450896_049242 Ga0450896_049242_274_498 74
321 3300042136 Ga0450900_077914 Ga0450900_077914_37_261 74
322 3300042533 Ga0450901_003323 Ga0450901_003323_635_901 74
323 3300044658 Ga0466972_0100400 Ga0466972_0100400_470_694 74
324 3300044684 Ga0466966_0570447 Ga0466966_0570447_330_554 74
325 3300044693 Ga0466961_0198278 Ga0466961_0198278_975_1199 74
326 3300045049 Ga0466959_0180480 Ga0466959_0180480_481_705 74
327 3300045049 Ga0466959_0399455 Ga0466959_0399455_237_461 74
328 3300046471 Ga0495650_0200916 Ga0495650_0200916_91_315 74
329 3300046512 Ga0495610_0386777 Ga0495610_0386777_79_303 74
330 3300046530 Ga0495654_0332891 Ga0495654_0332891_171_395 74
331 3300046558 Ga0495633_0005158 Ga0495633_0005158_4301_4525 74
332 3300046558 Ga0495633_0345603 Ga0495633_0345603_71_295 74
333 3300046616 Ga0495668_0101432 Ga0495668_0101432_1104_1328 74
334 3300046616 Ga0495668_0109638 Ga0495668_0109638_890_1114 74
335 3300046616 Ga0495668_0137104 Ga0495668_0137104_959_1183 74
336 3300046660 Ga0495625_0022857 Ga0495625_0022857_2521_2745 74
337 3300047472 Ga0495686_0027673 Ga0495686_0027673_2351_2575 74
338 3300048905 Ga0496102_0724079 Ga0496102_0724079_95_319 74
339 3300048913 Ga0496110_1017762 Ga0496110_1017762_477_701 74
340 3300048913 Ga0496110_1037305 Ga0496110_1037305_113_337 74
341 3300048916 Ga0496113_1337411 Ga0496113_1337411_231_455 74
342 3300048917 Ga0496114_1556723 Ga0496114_1556723_10_234 74
343 3300048918 Ga0496115_0246775 Ga0496115_0246775_324_548 74
344 3300048918 Ga0496115_0375408 Ga0496115_0375408_776_1000 74
345 3300048919 Ga0496116_0057554 Ga0496116_0057554_2165_2389 74
346 3300048924 Ga0496121_0502688 Ga0496121_0502688_66_290 74
347 3300048925 Ga0496122_0006991 Ga0496122_0006991_3014_3238 74
348 3300048926 Ga0496123_0000512 Ga0496123_0000512_22209_22433 74
349 3300048926 Ga0496123_0234352 Ga0496123_0234352_561_785 74
350 3300048927 Ga0496124_0479513 Ga0496124_0479513_415_639 74
351 3300048928 Ga0496125_0002197 Ga0496125_0002197_17135_17359 74
352 3300048929 Ga0496126_0473775 Ga0496126_0473775_754_978 74
353 3300048929 Ga0496126_0488378 Ga0496126_0488378_43_267 74
354 3300048929 Ga0496126_0686209 Ga0496126_0686209_384_608 74
355 3300049571 Ga0501034_0037721 Ga0501034_0037721_4423_4653 74
356 3300049571 Ga0501034_0097931 Ga0501034_0097931_73_297 74
357 3300049571 Ga0501034_0583930 Ga0501034_0583930_30_254 74
358 3300049579 Ga0501043_0148599 Ga0501043_0148599_330_554 74
359 3300049579 Ga0501043_0220089 Ga0501043_0220089_1098_1322 74
360 3300049581 Ga0501047_0462790 Ga0501047_0462790_163_387 74
361 3300049581 Ga0501047_1132910 Ga0501047_1132910_205_429 74
362 3300049586 Ga0501070_0715790 Ga0501070_0715790_246_470 74
363 3300049589 Ga0501073_0173020 Ga0501073_0173020_72_296 74
364 3300049686 Ga0501257_035690 Ga0501257_035690_690_914 74
365 3300049822 Ga0501035_0012306 Ga0501035_0012306_7136_7360 74
366 3300049822 Ga0501035_0280469 Ga0501035_0280469_782_1006 74
367 3300049823 Ga0501044_0346039 Ga0501044_0346039_224_448 74
368 3300049823 Ga0501044_1183000 Ga0501044_1183000_385_609 74
369 3300050489 nmdc:mga03683_147569_c1 nmdc:mga03683_147569_c1_714_938 74
370 3300050489 nmdc:mga03683_249541_c1 nmdc:mga03683_249541_c1_333_557 74
371 3300050490 nmdc:mga03n38_172095_c1 nmdc:mga03n38_172095_c1_518_742 74
372 3300050490 nmdc:mga03n38_71366_c1 nmdc:mga03n38_71366_c1_393_617 74
373 3300050491 nmdc:mga00v17_149244_c1 nmdc:mga00v17_149244_c1_767_991 74
374 3300050491 nmdc:mga00v17_86131_c1 nmdc:mga00v17_86131_c1_610_834 74
375 3300050491 nmdc:mga00v17_8625_c1 nmdc:mga00v17_8625_c1_3750_3974 74
376 3300050492 nmdc:mga0yw44_9633_c1 nmdc:mga0yw44_9633_c1_2004_2228 74
377 3300050493 nmdc:mga0k408_41152_c1 nmdc:mga0k408_41152_c1_982_1206 74
378 3300050494 nmdc:mga06z11_168624_c1 nmdc:mga06z11_168624_c1_693_917 74
379 3300050494 nmdc:mga06z11_659071_c1 nmdc:mga06z11_659071_c1_268_492 74
380 3300050495 nmdc:mga04h51_127061_c1 nmdc:mga04h51_127061_c1_355_579 74
381 3300050496 nmdc:mga07m45_476004_c1 nmdc:mga07m45_476004_c1_207_431 74
382 3300050509 nmdc:mga0qj67_1187378_c1 nmdc:mga0qj67_1187378_c1_100_324 74
383 3300050516 nmdc:mga0sz30_438554_c1 nmdc:mga0sz30_438554_c1_144_368 74
384 3300053080 Ga0500635_0000422 Ga0500635_0000422_11179_11403 74
385 3300053086 Ga0500578_0489174 Ga0500578_0489174_258_482 74
386 3300053087 Ga0500643_002598 Ga0500643_002598_4695_4919 74
387 3300053087 Ga0500643_005164 Ga0500643_005164_1284_1508 74
388 3300053087 Ga0500643_011017 Ga0500643_011017_419_643 74
389 3300053087 Ga0500643_017450 Ga0500643_017450_876_1154 74
390 3300053088 Ga0500644_0005614 Ga0500644_0005614_601_825 74
391 3300053091 Ga0500647_0003244 Ga0500647_0003244_3030_3254 74
392 3300053093 Ga0500651_0023820 Ga0500651_0023820_3533_3757 74
393 3300053093 Ga0500651_0155363 Ga0500651_0155363_262_486 74
394 3300053096 Ga0500641_0000911 Ga0500641_0000911_4683_4907 74
395 3300053104 Ga0500556_0002706 Ga0500556_0002706_3172_3396 74
396 3300053108 Ga0500562_000413 Ga0500562_000413_4286_4510 74
397 3300053109 Ga0500569_301107 Ga0500569_301107_103_327 74
398 3300053111 Ga0500572_000338 Ga0500572_000338_7117_7341 74
399 3300053122 Ga0500608_000027 Ga0500608_000027_12871_13095 74
400 3300053122 Ga0500608_000115 Ga0500608_000115_4401_4631 74
401 3300053123 Ga0500614_135923 Ga0500614_135923_156_380 74
402 3300053136 Ga0500559_0068723 Ga0500559_0068723_349_573 74
403 3300053136 Ga0500559_0129567 Ga0500559_0129567_397_621 74
404 3300053136 Ga0500559_0216386 Ga0500559_0216386_100_324 74
405 3300053139 Ga0500568_0215613 Ga0500568_0215613_445_669 74
406 3300053148 Ga0500590_065546 Ga0500590_065546_967_1191 74
407 3300053151 Ga0500604_0043280 Ga0500604_0043280_753_977 74
408 3300053153 Ga0500616_0006408 Ga0500616_0006408_4816_5040 74
409 3300053153 Ga0500616_0063347 Ga0500616_0063347_653_877 74
410 3300053156 Ga0500622_0077075 Ga0500622_0077075_727_951 74
411 3300053727 Ga0500611_205814 Ga0500611_205814_284_517 74
412 3300053730 Ga0500645_002360 Ga0500645_002360_4716_4940 74
413 3300053730 Ga0500645_009677 Ga0500645_009677_1345_1569 74
414 3300053730 Ga0500645_075558 Ga0500645_075558_388_612 74
415 3300054114 Ga0501084_0550938 Ga0501084_0550938_689_913 74
416 3300060353 Ga0501082_0000974 Ga0501082_0000974_22964_23188 74
417 3300005518 Ga0070699_100085623 Ga0070699_1000856231 75
418 3300005841 Ga0068863_100743855 Ga0068863_1007438552 75
419 3300006186 Ga0075369_10004445 Ga0075369_100044453 75
420 3300009148 Ga0105243_11953741 Ga0105243_119537411 75
421 3300013100 Ga0157373_11206471 Ga0157373_112064711 75
422 3300014745 Ga0157377_11547987 Ga0157377_115479871 75
423 3300021358 Ga0213873_10279390 Ga0213873_102793901 75
424 3300021361 Ga0213872_10134824 Ga0213872_101348242 75
425 3300021441 Ga0213871_10094641 Ga0213871_100946412 75
426 3300022467 Ga0224712_10143637 Ga0224712_101436371 75
427 3300037471 Ga0395905_1325201 Ga0395905_1325201_233_460 75
428 3300037853 Ga0436364_0024094 Ga0436364_0024094_132_359 75
429 3300037853 Ga0436364_0105293 Ga0436364_0105293_1572_1799 75
430 3300039437 Ga0436365_1205169 Ga0436365_1205169_486_713 75
431 3300039438 Ga0436360_0352378 Ga0436360_0352378_228_455 75
432 3300039438 Ga0436360_0444055 Ga0436360_0444055_153_380 75
433 3300039438 Ga0436360_1069376 Ga0436360_1069376_23_250 75
434 3300039447 Ga0436361_0673108 Ga0436361_0673108_1015_1242 75
435 3300039447 Ga0436361_0992022 Ga0436361_0992022_150_377 75
436 3300039453 Ga0436362_0631106 Ga0436362_0631106_206_433 75
437 3300039453 Ga0436362_1292192 Ga0436362_1292192_220_447 75
438 3300041512 Ga0451853_0267609 Ga0451853_0267609_55_282 75
439 3300046453 Ga0495627_168304 Ga0495627_168304_38_265 75
440 3300046460 Ga0495638_0050607 Ga0495638_0050607_1153_1380 75
441 3300046462 Ga0495651_0919943 Ga0495651_0919943_186_413 75
442 3300046616 Ga0495668_0413029 Ga0495668_0413029_390_617 75
443 3300046692 Ga0495671_0105539 Ga0495671_0105539_92_319 75
444 3300047469 Ga0495673_0000905 Ga0495673_0000905_2129_2356 75
445 3300048905 Ga0496102_1198350 Ga0496102_1198350_400_627 75
446 3300048907 Ga0496104_0302469 Ga0496104_0302469_1198_1425 75
447 3300049591 Ga0501075_0183626 Ga0501075_0183626_1055_1282 75
448 3300049592 Ga0501076_0692802 Ga0501076_0692802_338_565 75
449 3300050516 nmdc:mga0sz30_42011_c1 nmdc:mga0sz30_42011_c1_1297_1524 75
450 3300053087 Ga0500643_043970 Ga0500643_043970_77_304 75
451 3300053087 Ga0500643_096979 Ga0500643_096979_185_412 75
452 3300053088 Ga0500644_0000538 Ga0500644_0000538_6866_7093 75
453 3300053096 Ga0500641_0001879 Ga0500641_0001879_6401_6628 75
454 3300053125 Ga0500618_006992 Ga0500618_006992_937_1164 75
455 3300053138 Ga0500564_000352 Ga0500564_000352_5915_6142 75
456 3300053141 Ga0500574_115977 Ga0500574_115977_382_609 75
457 3300053157 Ga0500624_000064 Ga0500624_000064_29732_29959 75
458 3300053177 Ga0500636_0000932 Ga0500636_0000932_1698_1925 75
459 3300054114 Ga0501084_0963631 Ga0501084_0963631_73_300 75
460 3300055283 Ga0500661_011784 Ga0500661_011784_68_295 75
461 3300059640 Ga0587067_136638 Ga0587067_136638_145_372 75
462 3300059655 Ga0587114_074328 Ga0587114_074328_250_477 75
463 3300001979 JGI24740J21852_10107549 JGI24740J21852_101075491 76
464 3300003322 rootL2_10135826 rootL2_101358261 76
465 3300003781 Ga0055536_1005094 Ga0055536_10050942 76
466 3300003781 Ga0055536_1008341 Ga0055536_10083414 76
467 3300003791 Ga0055530_10015556 Ga0055530_100155562 76
468 3300003791 Ga0055530_10020754 Ga0055530_100207544 76
469 3300003792 Ga0055540_1069762 Ga0055540_10697622 76
470 3300003794 Ga0055531_10001076 Ga0055531_100010762 76
471 3300003794 Ga0055531_10058243 Ga0055531_100582432 76
472 3300005367 Ga0070667_100806493 Ga0070667_1008064933 76
473 3300005435 Ga0070714_100384684 Ga0070714_1003846842 76
474 3300005435 Ga0070714_100546568 Ga0070714_1005465682 76
475 3300005435 Ga0070714_100813971 Ga0070714_1008139712 76
476 3300005436 Ga0070713_100259893 Ga0070713_1002598932 76
477 3300005437 Ga0070710_10178863 Ga0070710_101788632 76
478 3300005439 Ga0070711_100443768 Ga0070711_1004437682 76
479 3300005445 Ga0070708_100091639 Ga0070708_1000916393 76
480 3300005467 Ga0070706_100018301 Ga0070706_1000183012 76
481 3300005468 Ga0070707_100006146 Ga0070707_1000061464 76
482 3300005471 Ga0070698_100022207 Ga0070698_1000222073 76
483 3300005518 Ga0070699_100022426 Ga0070699_1000224263 76
484 3300005536 Ga0070697_100118352 Ga0070697_1001183522 76
485 3300005539 Ga0068853_100022277 Ga0068853_1000222772 76
486 3300005546 Ga0070696_101138998 Ga0070696_1011389981 76
487 3300005547 Ga0070693_101145899 Ga0070693_1011458992 76
488 3300005547 Ga0070693_101348769 Ga0070693_1013487691 76
489 3300005549 Ga0070704_101747046 Ga0070704_1017470461 76
490 3300005563 Ga0068855_101472109 Ga0068855_1014721092 76
491 3300005564 Ga0070664_100394900 Ga0070664_1003949002 76
492 3300005577 Ga0068857_100018018 Ga0068857_1000180183 76
493 3300005577 Ga0068857_100081543 Ga0068857_1000815434 76
494 3300005614 Ga0068856_100159164 Ga0068856_1001591644 76
495 3300005614 Ga0068856_100164433 Ga0068856_1001644333 76
496 3300005616 Ga0068852_100194651 Ga0068852_1001946512 76
497 3300005617 Ga0068859_100570884 Ga0068859_1005708843 76
498 3300005718 Ga0068866_10542664 Ga0068866_105426642 76
499 3300005719 Ga0068861_101527760 Ga0068861_1015277601 76
500 3300005834 Ga0068851_10065211 Ga0068851_100652111 76
501 3300005843 Ga0068860_100079176 Ga0068860_1000791763 76
502 3300005844 Ga0068862_100146853 Ga0068862_1001468534 76
503 3300005844 Ga0068862_101340721 Ga0068862_1013407212 76
504 3300005937 Ga0081455_10999887 Ga0081455_109998872 76
505 3300006028 Ga0070717_10401334 Ga0070717_104013342 76
506 3300006028 Ga0070717_10468739 Ga0070717_104687391 76
507 3300006028 Ga0070717_11473513 Ga0070717_114735132 76
508 3300006173 Ga0070716_100156838 Ga0070716_1001568381 76
509 3300006175 Ga0070712_100937602 Ga0070712_1009376022 76
510 3300006846 Ga0075430_100640983 Ga0075430_1006409832 76
511 3300006871 Ga0075434_100700968 Ga0075434_1007009681 76
512 3300006914 Ga0075436_100076118 Ga0075436_1000761182 76
513 3300006931 Ga0097620_100570908 Ga0097620_1005709083 76
514 3300007076 Ga0075435_100071610 Ga0075435_1000716105 76
515 3300007788 Ga0099795_10004776 Ga0099795_100047765 76
516 3300007788 Ga0099795_10013504 Ga0099795_100135041 76
517 3300009093 Ga0105240_11031718 Ga0105240_110317182 76
518 3300009174 Ga0105241_10260766 Ga0105241_102607662 76
519 3300009174 Ga0105241_11172373 Ga0105241_111723732 76
520 3300009176 Ga0105242_10699611 Ga0105242_106996112 76
521 3300009551 Ga0105238_11250396 Ga0105238_112503962 76
522 3300009551 Ga0105238_11735673 Ga0105238_117356731 76
523 3300009553 Ga0105249_12489638 Ga0105249_124896382 76
524 3300010159 Ga0099796_10004450 Ga0099796_100044505 76
525 3300010159 Ga0099796_10028192 Ga0099796_100281922 76
526 3300014497 Ga0182008_10055060 Ga0182008_100550602 76
527 3300025292 Ga0209676_1000163 Ga0209676_100016387 76
528 3300025292 Ga0209676_1000188 Ga0209676_100018872 76
529 3300025298 Ga0209050_1001123 Ga0209050_10011237 76
530 3300025298 Ga0209050_1001523 Ga0209050_100152322 76
531 3300025303 Ga0209051_1003588 Ga0209051_10035887 76
532 3300025304 Ga0209257_1000370 Ga0209257_100037018 76
533 3300025304 Ga0209257_1007513 Ga0209257_10075133 76
534 3300025898 Ga0207692_10229843 Ga0207692_102298432 76
535 3300025898 Ga0207692_11176754 Ga0207692_111767542 76
536 3300025906 Ga0207699_10164444 Ga0207699_101644442 76
537 3300025906 Ga0207699_10713343 Ga0207699_107133431 76
538 3300025910 Ga0207684_10510356 Ga0207684_105103562 76
539 3300025915 Ga0207693_10039298 Ga0207693_100392984 76
540 3300025915 Ga0207693_10294563 Ga0207693_102945631 76
541 3300025922 Ga0207646_10007709 Ga0207646_100077097 76
542 3300025928 Ga0207700_10045252 Ga0207700_100452522 76
543 3300025928 Ga0207700_10254205 Ga0207700_102542052 76
544 3300025928 Ga0207700_10384772 Ga0207700_103847722 76
545 3300025934 Ga0207686_10491576 Ga0207686_104915762 76
546 3300025935 Ga0207709_10402871 Ga0207709_104028711 76
547 3300025939 Ga0207665_10036574 Ga0207665_100365742 76
548 3300025942 Ga0207689_11280218 Ga0207689_112802181 76
549 3300025986 Ga0207658_10685955 Ga0207658_106859552 76
550 3300026035 Ga0207703_10685681 Ga0207703_106856812 76
551 3300026078 Ga0207702_10014179 Ga0207702_100141794 76
552 3300026078 Ga0207702_11670649 Ga0207702_116706491 76
553 3300026116 Ga0207674_10014006 Ga0207674_100140065 76
554 3300026118 Ga0207675_102072416 Ga0207675_1020724161 76
555 3300027512 Ga0209179_1014467 Ga0209179_10144672 76
556 3300028380 Ga0268265_10672417 Ga0268265_106724171 76
557 3300028380 Ga0268265_11285093 Ga0268265_112850932 76
558 3300028381 Ga0268264_10266544 Ga0268264_102665442 76
559 3300028381 Ga0268264_11161231 Ga0268264_111612312 76
560 3300030878 Ga0265770_1075487 Ga0265770_10754872 76
561 3300031344 Ga0265316_11299408 Ga0265316_112994081 76
562 3300031548 Ga0307408_100457312 Ga0307408_1004573122 76
563 3300031911 Ga0307412_10103883 Ga0307412_101038833 76
564 3300032004 Ga0307414_11221157 Ga0307414_112211572 76
565 3300032126 Ga0307415_101521253 Ga0307415_1015212532 76
566 3300035084 Ga0373928_0192667 Ga0373928_0192667_303_533 76
567 3300035085 Ga0373929_0151606 Ga0373929_0151606_83_313 76
568 3300035112 Ga0373932_0016559 Ga0373932_0016559_1354_1587 76
569 3300035115 Ga0373941_0019225 Ga0373941_0019225_509_742 76
570 3300035121 Ga0373960_0028255 Ga0373960_0028255_912_1142 76
571 3300035170 Ga0373943_0044266 Ga0373943_0044266_1563_1796 76
572 3300035171 Ga0373946_0275986 Ga0373946_0275986_466_699 76
573 3300035241 Ga0373961_0188346 Ga0373961_0188346_28_261 76
574 3300035242 Ga0373962_0013376 Ga0373962_0013376_989_1219 76
575 3300035691 Ga0373931_0003958 Ga0373931_0003958_2074_2304 76
576 3300035691 Ga0373931_0046009 Ga0373931_0046009_1834_2067 76
577 3300035692 Ga0373935_0428854 Ga0373935_0428854_271_504 76
578 3300035695 Ga0373927_0633406 Ga0373927_0633406_313_546 76
579 3300035725 Ga0373947_0073967 Ga0373947_0073967_554_787 76
580 3300037068 Ga0373925_0890870 Ga0373925_0890870_188_421 76
581 3300037068 Ga0373925_1288224 Ga0373925_1288224_35_268 76
582 3300037418 Ga0395900_0992964 Ga0395900_0992964_499_729 76
583 3300039437 Ga0436365_1302237 Ga0436365_1302237_330_563 76
584 3300039438 Ga0436360_0397582 Ga0436360_0397582_91_321 76
585 3300039438 Ga0436360_0610713 Ga0436360_0610713_76_309 76
586 3300039453 Ga0436362_0390765 Ga0436362_0390765_2285_2515 76
587 3300042438 Ga0439459_0173159 Ga0439459_0173159_62_292 76
588 3300046472 Ga0495580_0030065 Ga0495580_0030065_1667_1900 76
589 3300047320 Ga0495672_0000570 Ga0495672_0000570_2020_2250 76
590 3300048913 Ga0496110_0319583 Ga0496110_0319583_174_407 76
591 3300048916 Ga0496113_0181823 Ga0496113_0181823_20_253 76
592 3300048929 Ga0496126_0193760 Ga0496126_0193760_417_662 76
593 3300049127 Ga0501306_019854 Ga0501306_019854_333_563 76
594 3300049161 Ga0501305_034138 Ga0501305_034138_409_639 76
595 3300049162 Ga0501307_015986 Ga0501307_015986_333_563 76
596 3300049589 Ga0501073_0456133 Ga0501073_0456133_397_630 76
597 3300049679 Ga0501249_000314 Ga0501249_000314_8280_8510 76
598 3300049850 Ga0501204_029066 Ga0501204_029066_212_442 76
599 3300049852 Ga0501220_03002 Ga0501220_03002_296_526 76
600 3300050513 nmdc:mga0rr50_100378_c1 nmdc:mga0rr50_100378_c1_490_723 76
601 3300050514 nmdc:mga08x19_290106_c1 nmdc:mga08x19_290106_c1_753_986 76
602 3300053090 Ga0500646_0089107 Ga0500646_0089107_356_586 76
603 3300053177 Ga0500636_0015974 Ga0500636_0015974_3580_3810 76
604 3300059491 Ga0587070_085131 Ga0587070_085131_224_457 76

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01197

Ribosomal_L31

Ribosomal protein L31

19

87

0.97

Feature Viewer

pLDDT pTM Quality
76.91 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map