F468398

General Info

Members Datasets Scaffolds Average Seq Length
604 272 1208 96

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0265571|Ga0373923_0265571_247_597
Length 116
Sequence MKAFNTRRSQDLQEPKTILNMAAKPLTKSQIAAEVAEKANVPKRTAVEILEHIAELAYKNAKNSFTLPGLGKLVLVNRKARIGRNPATGQEIKIPAKKVVKFRVAKACKDAVLGAK

Samples

Sample ID Description Type Environment
1 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
149 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
150 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
155 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
159 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
160 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
168 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
172 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
181 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
188 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
198 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
199 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
215 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
224 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
248 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
253 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
254 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
255 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
256 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
257 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.32
Rhizosphere 98.01
Stem 0
Stem Tuber 0
Unclassified 25.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373923_0265571 3300035111 Bacteria 806
2 Ga0065712_10405532 3300005290 Unclassified 693
3 Ga0065707_10494707 3300005295 Unclassified 762
4 Ga0065707_10750705 3300005295 Unclassified 618
5 Ga0065707_10868595 3300005295 Bacteria 576
6 Ga0070658_10671380 3300005327 Bacteria 899
7 Ga0070658_11545828 3300005327 Bacteria 575
8 Ga0070683_100590468 3300005329 Bacteria 1063
9 Ga0070683_101404596 3300005329 Bacteria 671
10 Ga0070690_100054193 3300005330 Bacteria 2567
11 Ga0070690_100345682 3300005330 Bacteria 1078
12 Ga0070690_100355668 3300005330 Bacteria 1064
13 Ga0070690_100589747 3300005330 Unclassified 842
14 Ga0070666_10086131 3300005335 Bacteria 2152
15 Ga0070666_10095544 3300005335 Bacteria 2045
16 Ga0070666_10190654 3300005335 Bacteria 1440
17 Ga0070680_100975500 3300005336 Bacteria 732
18 Ga0068868_101478271 3300005338 Bacteria 635
19 Ga0070660_100206321 3300005339 Bacteria 1595
20 Ga0070689_100324609 3300005340 Bacteria 1286
21 Ga0070689_100492620 3300005340 Unclassified 1049
22 Ga0070689_100588836 3300005340 Bacteria 962
23 Ga0070689_100875277 3300005340 Bacteria 793
24 Ga0070689_101776978 3300005340 Bacteria 562
25 Ga0070691_10155768 3300005341 Unclassified 1174
26 Ga0070687_100177420 3300005343 Bacteria 1273
27 Ga0070687_101098719 3300005343 Viruses 581
28 Ga0070692_10161603 3300005345 Bacteria 1284
29 Ga0070669_101093805 3300005353 Bacteria 686
30 Ga0070669_101954574 3300005353 Bacteria 512
31 Ga0070674_101273052 3300005356 Bacteria 655
32 Ga0070674_102180222 3300005356 Unclassified 506
33 Ga0070673_100060757 3300005364 Bacteria 2996
34 Ga0070673_100187054 3300005364 Bacteria 1776
35 Ga0070673_100226241 3300005364 Bacteria 1621
36 Ga0070673_100885859 3300005364 Unclassified 827
37 Ga0070673_101474578 3300005364 Bacteria 641
38 Ga0070688_100310103 3300005365 Bacteria 1143
39 Ga0070688_100362974 3300005365 Unclassified 1063
40 Ga0070688_101115980 3300005365 Bacteria 631
41 Ga0070667_100210394 3300005367 Bacteria 1728
42 Ga0070709_11142303 3300005434 Unclassified 624
43 Ga0070709_11154045 3300005434 Unclassified 621
44 Ga0070709_11672859 3300005434 Unclassified 519
45 Ga0070714_100034963 3300005435 Bacteria 4209
46 Ga0070713_100127397 3300005436 Unclassified 2241
47 Ga0070713_101332727 3300005436 Bacteria 696
48 Ga0070701_10138788 3300005438 Unclassified 1388
49 Ga0070705_101659460 3300005440 Bacteria 539
50 Ga0070700_100153537 3300005441 Bacteria 1577
51 Ga0070700_100893231 3300005441 Bacteria 723
52 Ga0070700_101003355 3300005441 Unclassified 686
53 Ga0070700_101796876 3300005441 Unclassified 528
54 Ga0070694_100445841 3300005444 Bacteria 1021
55 Ga0070694_100681890 3300005444 Bacteria 834
56 Ga0070694_101630646 3300005444 Bacteria 548
57 Ga0070708_100272997 3300005445 Bacteria 1590
58 Ga0070708_100371271 3300005445 Bacteria 1349
59 Ga0070708_100773110 3300005445 Bacteria 903
60 Ga0070681_10247729 3300005458 Unclassified 1695
61 Ga0070681_10268133 3300005458 Bacteria 1619
62 Ga0070681_10941371 3300005458 Unclassified 783
63 Ga0070681_11524079 3300005458 Unclassified 593
64 Ga0068867_100597664 3300005459 Bacteria 962
65 Ga0068867_102223837 3300005459 Unclassified 521
66 Ga0068867_102246627 3300005459 Bacteria 518
67 Ga0070685_10224080 3300005466 Unclassified 1233
68 Ga0070685_11076933 3300005466 Unclassified 606
69 Ga0070706_100000503 3300005467 Bacteria 45861
70 Ga0070706_100192424 3300005467 Bacteria 1906
71 Ga0070706_100321649 3300005467 Bacteria 1443
72 Ga0070706_100737623 3300005467 Bacteria 913
73 Ga0070706_101720287 3300005467 Bacteria 571
74 Ga0070707_100397655 3300005468 Bacteria 1338
75 Ga0070707_100789498 3300005468 Bacteria 913
76 Ga0070698_100525349 3300005471 Bacteria 1122
77 Ga0070699_100074200 3300005518 Bacteria 2960
78 Ga0070699_100533144 3300005518 Bacteria 1068
79 Ga0070699_101405393 3300005518 Bacteria 640
80 Ga0070679_100624935 3300005530 Bacteria 1020
81 Ga0070679_100974921 3300005530 Bacteria 792
82 Ga0070684_101506232 3300005535 Bacteria 634
83 Ga0070684_101609657 3300005535 Unclassified 613
84 Ga0070697_100034938 3300005536 Bacteria 4055
85 Ga0070697_100390709 3300005536 Unclassified 1206
86 Ga0070697_100600471 3300005536 Unclassified 967
87 Ga0070697_101437476 3300005536 Bacteria 616
88 Ga0068853_100438790 3300005539 Bacteria 1227
89 Ga0070672_100750942 3300005543 Unclassified 856
90 Ga0070686_100000784 3300005544 Bacteria 18408
91 Ga0070686_100004430 3300005544 Bacteria 7747
92 Ga0070695_100294126 3300005545 Bacteria 1198
93 Ga0070695_101029499 3300005545 Bacteria 671
94 Ga0070696_100810276 3300005546 Bacteria 771
95 Ga0070665_100500550 3300005548 Bacteria 1226
96 Ga0070704_100087337 3300005549 Bacteria 2314
97 Ga0070704_100748616 3300005549 Unclassified 870
98 Ga0070704_101032442 3300005549 Bacteria 745
99 Ga0070704_101409114 3300005549 Unclassified 639
100 Ga0068855_100039586 3300005563 Bacteria 5597
101 Ga0068855_100190561 3300005563 Unclassified 2313
102 Ga0068855_100393189 3300005563 Unclassified 1520
103 Ga0068855_100872005 3300005563 Bacteria 952
104 Ga0068855_101111418 3300005563 Bacteria 826
105 Ga0068857_100217786 3300005577 Unclassified 1743
106 Ga0068857_100459955 3300005577 Bacteria 1191
107 Ga0068854_100900210 3300005578 Bacteria 778
108 Ga0068854_101380096 3300005578 Bacteria 636
109 Ga0068856_100001653 3300005614 Bacteria 23365
110 Ga0068856_100703155 3300005614 Bacteria 1031
111 Ga0070702_100148940 3300005615 Unclassified 1500
112 Ga0070702_101338075 3300005615 Bacteria 583
113 Ga0068859_100093376 3300005617 Bacteria 3061
114 Ga0068859_100154422 3300005617 Bacteria 2372
115 Ga0068859_100241443 3300005617 Bacteria 1896
116 Ga0068859_100304825 3300005617 Unclassified 1686
117 Ga0068859_100599299 3300005617 Bacteria 1195
118 Ga0068859_100937710 3300005617 Bacteria 949
119 Ga0068859_100987793 3300005617 Bacteria 924
120 Ga0068859_101062088 3300005617 Bacteria 890
121 Ga0068859_101334635 3300005617 Unclassified 791
122 Ga0068859_102240456 3300005617 Unclassified 603
123 Ga0068864_100052269 3300005618 Bacteria 3521
124 Ga0068864_100129685 3300005618 Bacteria 2264
125 Ga0068864_100994829 3300005618 Bacteria 831
126 Ga0068864_101793892 3300005618 Unclassified 619
127 Ga0068864_102218723 3300005618 Bacteria 555
128 Ga0068861_102014218 3300005719 Bacteria 576
129 Ga0068861_102255331 3300005719 Unclassified 546
130 Ga0068851_10346835 3300005834 Unclassified 863
131 Ga0068863_100058805 3300005841 Bacteria 3638
132 Ga0068863_100468352 3300005841 Bacteria 1238
133 Ga0068863_101144221 3300005841 Bacteria 783
134 Ga0068863_101257271 3300005841 Unclassified 747
135 Ga0068858_100241293 3300005842 Bacteria 1715
136 Ga0068858_100317931 3300005842 Bacteria 1487
137 Ga0068858_101030843 3300005842 Bacteria 807
138 Ga0068858_101142840 3300005842 Unclassified 765
139 Ga0068858_101765309 3300005842 Bacteria 611
140 Ga0068860_100036541 3300005843 Bacteria 4706
141 Ga0068860_100560835 3300005843 Bacteria 1145
142 Ga0068860_100899852 3300005843 Bacteria 901
143 Ga0068862_100378016 3300005844 Unclassified 1321
144 Ga0068862_100477054 3300005844 Bacteria 1180
145 Ga0068862_101126169 3300005844 Unclassified 781
146 Ga0068862_101211663 3300005844 Unclassified 754
147 Ga0068862_101497395 3300005844 Bacteria 680
148 Ga0070715_10708285 3300006163 Unclassified 602
149 Ga0070716_100222085 3300006173 Bacteria 1270
150 Ga0068871_100531637 3300006358 Bacteria 1063
151 Ga0068871_100619877 3300006358 Bacteria 985
152 Ga0068871_100748855 3300006358 Bacteria 898
153 Ga0068871_101088285 3300006358 Unclassified 747
154 Ga0068871_101240620 3300006358 Bacteria 700
155 Ga0068871_101415092 3300006358 Bacteria 656
156 Ga0068871_102034868 3300006358 Unclassified 547
157 Ga0075428_101117504 3300006844 Bacteria 832
158 Ga0075428_101548743 3300006844 Unclassified 694
159 Ga0075428_102172860 3300006844 Unclassified 573
160 Ga0075430_100094185 3300006846 Unclassified 2504
161 Ga0075431_100169943 3300006847 Unclassified 2240
162 Ga0075431_101998147 3300006847 Unclassified 535
163 Ga0075433_10786147 3300006852 Bacteria 832
164 Ga0075433_11074548 3300006852 Unclassified 700
165 Ga0075433_11145337 3300006852 Bacteria 676
166 Ga0075434_100152257 3300006871 Bacteria 2333
167 Ga0075434_100563162 3300006871 Bacteria 1159
168 Ga0075434_101337004 3300006871 Bacteria 727
169 Ga0075429_100091147 3300006880 Bacteria 2659
170 Ga0068865_100744886 3300006881 Unclassified 841
171 Ga0075436_101406282 3300006914 Bacteria 529
172 Ga0097620_100093378 3300006931 Bacteria 3061
173 Ga0097620_100154426 3300006931 Bacteria 2372
174 Ga0097620_100241441 3300006931 Bacteria 1896
175 Ga0097620_100304826 3300006931 Unclassified 1686
176 Ga0097620_100599269 3300006931 Bacteria 1195
177 Ga0097620_100937675 3300006931 Bacteria 949
178 Ga0097620_100987763 3300006931 Bacteria 924
179 Ga0097620_101062155 3300006931 Bacteria 890
180 Ga0097620_101334612 3300006931 Unclassified 791
181 Ga0097620_102240609 3300006931 Unclassified 603
182 Ga0075435_100326220 3300007076 Bacteria 1314
183 Ga0075435_100700413 3300007076 Bacteria 880
184 Ga0099794_10770129 3300007265 Unclassified 514
185 Ga0099795_10495861 3300007788 Bacteria 569
186 Ga0105251_10477434 3300009011 Bacteria 580
187 Ga0105240_10024256 3300009093 Bacteria 8003
188 Ga0105240_10071787 3300009093 Bacteria 4281
189 Ga0105240_10145973 3300009093 Bacteria 2823
190 Ga0105240_10304413 3300009093 Bacteria 1822
191 Ga0105240_10407896 3300009093 Unclassified 1529
192 Ga0105240_10739744 3300009093 Bacteria 1070
193 Ga0111539_10012838 3300009094 Bacteria 10484
194 Ga0111539_10097424 3300009094 Bacteria 3455
195 Ga0111539_10166881 3300009094 Bacteria 2573
196 Ga0111539_10246292 3300009094 Bacteria 2081
197 Ga0111539_10309449 3300009094 Unclassified 1838
198 Ga0111539_10914980 3300009094 Bacteria 1020
199 Ga0111539_11673008 3300009094 Bacteria 738
200 Ga0105245_11289490 3300009098 Bacteria 779
201 Ga0105245_11595274 3300009098 Bacteria 704
202 Ga0105245_12600905 3300009098 Bacteria 559
203 Ga0105247_10317888 3300009101 Bacteria 1085
204 Ga0114129_10964843 3300009147 Bacteria 1076
205 Ga0114129_11021935 3300009147 Bacteria 1040
206 Ga0105241_10342115 3300009174 Bacteria 1296
207 Ga0105242_10027078 3300009176 Unclassified 4548
208 Ga0105242_10196386 3300009176 Bacteria 1789
209 Ga0105242_10269021 3300009176 Bacteria 1543
210 Ga0105242_10383555 3300009176 Bacteria 1307
211 Ga0105242_10939274 3300009176 Unclassified 868
212 Ga0105242_11417688 3300009176 Bacteria 723
213 Ga0105242_11429839 3300009176 Bacteria 720
214 Ga0105242_11543171 3300009176 Bacteria 696
215 Ga0105242_12538102 3300009176 Bacteria 561
216 Ga0105242_12598182 3300009176 Bacteria 555
217 Ga0105248_10047819 3300009177 Bacteria 4798
218 Ga0105248_10640647 3300009177 Bacteria 1199
219 Ga0105248_10980679 3300009177 Bacteria 955
220 Ga0105248_11268009 3300009177 Bacteria 833
221 Ga0105248_11526649 3300009177 Bacteria 756
222 Ga0105238_10001693 3300009551 Bacteria 22183
223 Ga0105238_10277959 3300009551 Unclassified 1655
224 Ga0105249_10176281 3300009553 Bacteria 2077
225 Ga0105249_10855489 3300009553 Unclassified 975
226 Ga0105249_11157665 3300009553 Unclassified 844
227 Ga0105249_11221691 3300009553 Bacteria 823
228 Ga0105249_13078167 3300009553 Bacteria 536
229 Ga0105239_11345524 3300010375 Bacteria 824
230 Ga0157373_10295588 3300013100 Bacteria 1149
231 Ga0157371_10904198 3300013102 Bacteria 670
232 Ga0157371_11435835 3300013102 Bacteria 537
233 Ga0157370_10287694 3300013104 Unclassified 1518
234 Ga0157370_11254320 3300013104 Bacteria 668
235 Ga0157369_10742548 3300013105 Unclassified 1010
236 Ga0157369_11713314 3300013105 Bacteria 639
237 Ga0157374_10061551 3300013296 Bacteria 3516
238 Ga0157374_10717607 3300013296 Bacteria 1013
239 Ga0157374_10778896 3300013296 Unclassified 972
240 Ga0157374_11245308 3300013296 Bacteria 766
241 Ga0157374_12359203 3300013296 Bacteria 559
242 Ga0157378_10583970 3300013297 Unclassified 1127
243 Ga0157378_10881014 3300013297 Unclassified 925
244 Ga0157378_10931452 3300013297 Bacteria 901
245 Ga0157378_11037229 3300013297 Bacteria 855
246 Ga0157378_11722231 3300013297 Bacteria 674
247 Ga0157378_12943002 3300013297 Bacteria 528
248 Ga0163162_10209601 3300013306 Bacteria 2078
249 Ga0163162_10436163 3300013306 Bacteria 1442
250 Ga0163162_10548510 3300013306 Bacteria 1284
251 Ga0163162_12036510 3300013306 Unclassified 658
252 Ga0163162_12226389 3300013306 Bacteria 629
253 Ga0163162_12814240 3300013306 Unclassified 560
254 Ga0163162_12952139 3300013306 Bacteria 547
255 Ga0157372_10753895 3300013307 Bacteria 1132
256 Ga0157372_11529514 3300013307 Bacteria 769
257 Ga0157372_11790961 3300013307 Unclassified 706
258 Ga0157375_10000041 3300013308 Bacteria 162765
259 Ga0157375_10000048 3300013308 Bacteria 140600
260 Ga0157375_10889273 3300013308 Unclassified 1035
261 Ga0157375_11224152 3300013308 Bacteria 881
262 Ga0157375_12475021 3300013308 Unclassified 620
263 Ga0157375_12629703 3300013308 Bacteria 601
264 Ga0163163_10000146 3300014325 Bacteria 73162
265 Ga0163163_10152031 3300014325 Unclassified 2358
266 Ga0163163_10200284 3300014325 Bacteria 2045
267 Ga0163163_10502131 3300014325 Bacteria 1275
268 Ga0163163_10679896 3300014325 Bacteria 1093
269 Ga0163163_12402293 3300014325 Unclassified 585
270 Ga0163163_12829374 3300014325 Bacteria 541
271 Ga0157380_10657907 3300014326 Unclassified 1046
272 Ga0157380_11604602 3300014326 Bacteria 706
273 Ga0157377_10768247 3300014745 Bacteria 707
274 Ga0157379_10264813 3300014968 Bacteria 1562
275 Ga0157379_10515910 3300014968 Unclassified 1109
276 Ga0157379_11867007 3300014968 Bacteria 591
277 Ga0157379_11875211 3300014968 Bacteria 590
278 Ga0157376_11182482 3300014969 Bacteria 792
279 Ga0157376_12710772 3300014969 Unclassified 535
280 Ga0157376_12757095 3300014969 Unclassified 531
281 Ga0163161_10978724 3300017792 Bacteria 721
282 Ga0163161_11777926 3300017792 Bacteria 547
283 Ga0207713_1248510 3300025735 Bacteria 525
284 Ga0207680_10172416 3300025903 Bacteria 1458
285 Ga0207680_10909566 3300025903 Bacteria 631
286 Ga0207685_10817202 3300025905 Unclassified 514
287 Ga0207699_10910446 3300025906 Unclassified 649
288 Ga0207699_11327685 3300025906 Unclassified 532
289 Ga0207705_10131669 3300025909 Bacteria 1862
290 Ga0207705_11066757 3300025909 Bacteria 623
291 Ga0207684_10000158 3300025910 Bacteria 115693
292 Ga0207684_10118348 3300025910 Bacteria 2270
293 Ga0207684_11575070 3300025910 Bacteria 533
294 Ga0207654_10279459 3300025911 Bacteria 1129
295 Ga0207654_10846177 3300025911 Unclassified 662
296 Ga0207707_10065372 3300025912 Bacteria 3168
297 Ga0207707_10494964 3300025912 Bacteria 1043
298 Ga0207695_10059463 3300025913 Bacteria 3962
299 Ga0207695_10061854 3300025913 Bacteria 3868
300 Ga0207695_10085212 3300025913 Bacteria 3189
301 Ga0207695_10502691 3300025913 Bacteria 1094
302 Ga0207695_10746393 3300025913 Bacteria 859
303 Ga0207695_10750951 3300025913 Unclassified 856
304 Ga0207663_10402075 3300025916 Bacteria 1048
305 Ga0207663_11487027 3300025916 Bacteria 545
306 Ga0207660_10563456 3300025917 Unclassified 927
307 Ga0207662_10496508 3300025918 Bacteria 840
308 Ga0207657_10528916 3300025919 Bacteria 922
309 Ga0207652_10405379 3300025921 Unclassified 1230
310 Ga0207652_11262125 3300025921 Bacteria 641
311 Ga0207652_11595513 3300025921 Bacteria 557
312 Ga0207646_10373148 3300025922 Bacteria 1289
313 Ga0207646_10808673 3300025922 Bacteria 834
314 Ga0207646_11767603 3300025922 Unclassified 530
315 Ga0207681_10743854 3300025923 Unclassified 817
316 Ga0207694_10121671 3300025924 Bacteria 2084
317 Ga0207694_10438380 3300025924 Unclassified 1090
318 Ga0207664_10030232 3300025929 Bacteria 4136
319 Ga0207644_11556944 3300025931 Unclassified 555
320 Ga0207686_10203080 3300025934 Unclassified 1421
321 Ga0207686_10297348 3300025934 Bacteria 1198
322 Ga0207686_10831598 3300025934 Bacteria 742
323 Ga0207686_11720557 3300025934 Bacteria 519
324 Ga0207709_11565742 3300025935 Bacteria 547
325 Ga0207670_10006119 3300025936 Bacteria 6654
326 Ga0207670_10287224 3300025936 Bacteria 1284
327 Ga0207670_10385875 3300025936 Bacteria 1117
328 Ga0207670_10826575 3300025936 Unclassified 773
329 Ga0207669_11143989 3300025937 Bacteria 658
330 Ga0207704_10987318 3300025938 Unclassified 712
331 Ga0207665_10365301 3300025939 Unclassified 1092
332 Ga0207691_10595140 3300025940 Bacteria 936
333 Ga0207711_10353136 3300025941 Bacteria 1361
334 Ga0207711_10825934 3300025941 Unclassified 863
335 Ga0207711_11460952 3300025941 Bacteria 627
336 Ga0207711_11651805 3300025941 Bacteria 584
337 Ga0207689_10596178 3300025942 Bacteria 929
338 Ga0207689_11138553 3300025942 Unclassified 657
339 Ga0207679_11116711 3300025945 Bacteria 723
340 Ga0207667_10022756 3300025949 Bacteria 6913
341 Ga0207667_10103546 3300025949 Bacteria 2936
342 Ga0207667_10149571 3300025949 Bacteria 2404
343 Ga0207667_10596713 3300025949 Bacteria 1114
344 Ga0207651_10783932 3300025960 Unclassified 844
345 Ga0207651_11017278 3300025960 Bacteria 741
346 Ga0207651_11707648 3300025960 Bacteria 567
347 Ga0207651_12158925 3300025960 Bacteria 500
348 Ga0207712_10206061 3300025961 Unclassified 1563
349 Ga0207712_11330540 3300025961 Bacteria 642
350 Ga0207668_11979312 3300025972 Bacteria 525
351 Ga0207640_11003533 3300025981 Bacteria 734
352 Ga0207703_10162476 3300026035 Bacteria 1957
353 Ga0207703_10178901 3300026035 Bacteria 1871
354 Ga0207703_11298413 3300026035 Bacteria 700
355 Ga0207703_12036498 3300026035 Unclassified 550
356 Ga0207639_10039271 3300026041 Bacteria 3526
357 Ga0207678_11364043 3300026067 Bacteria 627
358 Ga0207708_10136137 3300026075 Bacteria 1924
359 Ga0207708_10724518 3300026075 Bacteria 852
360 Ga0207702_10004807 3300026078 Bacteria 11908
361 Ga0207702_10750520 3300026078 Bacteria 963
362 Ga0207702_11019862 3300026078 Bacteria 821
363 Ga0207641_10249448 3300026088 Bacteria 1657
364 Ga0207641_10617863 3300026088 Bacteria 1062
365 Ga0207648_10918338 3300026089 Bacteria 818
366 Ga0207648_12238064 3300026089 Bacteria 507
367 Ga0207676_10131599 3300026095 Bacteria 2128
368 Ga0207676_10468787 3300026095 Bacteria 1190
369 Ga0207676_10772075 3300026095 Unclassified 936
370 Ga0207676_10883724 3300026095 Unclassified 876
371 Ga0207674_10116487 3300026116 Bacteria 2643
372 Ga0207674_10662354 3300026116 Bacteria 1008
373 Ga0207674_11013628 3300026116 Bacteria 799
374 Ga0207674_12073948 3300026116 Bacteria 533
375 Ga0207675_100700615 3300026118 Unclassified 1022
376 Ga0209588_1012993 3300027671 Bacteria 2535
377 Ga0207428_10427396 3300027907 Bacteria 968
378 Ga0207428_10432499 3300027907 Unclassified 961
379 Ga0268265_10288542 3300028380 Unclassified 1472
380 Ga0268265_10924382 3300028380 Unclassified 858
381 Ga0268264_10240695 3300028381 Bacteria 1676
382 Ga0268264_10776325 3300028381 Bacteria 956
383 Ga0265337_1009271 3300028556 Bacteria 3521
384 Ga0265319_1062695 3300028563 Bacteria 1204
385 Ga0265334_10004557 3300028573 Bacteria 6142
386 Ga0265334_10009566 3300028573 Bacteria 4101
387 Ga0265334_10280883 3300028573 Bacteria 571
388 Ga0265318_10088472 3300028577 Unclassified 1141
389 Ga0265322_10128012 3300028654 Unclassified 724
390 Ga0265338_10001031 3300028800 Bacteria 46585
391 Ga0265338_10014820 3300028800 Bacteria 8627
392 Ga0265338_10042984 3300028800 Bacteria 4199
393 Ga0265338_10053141 3300028800 Bacteria 3627
394 Ga0265338_10085971 3300028800 Bacteria 2620
395 Ga0265338_10109949 3300028800 Bacteria 2223
396 Ga0265338_10330581 3300028800 Unclassified 1101
397 Ga0265338_10411934 3300028800 Bacteria 962
398 Ga0265338_10467787 3300028800 Bacteria 891
399 Ga0265338_10622884 3300028800 Bacteria 750
400 Ga0265338_10632547 3300028800 Bacteria 743
401 Ga0265338_10801054 3300028800 Bacteria 646
402 Ga0265338_10828534 3300028800 Unclassified 633
403 Ga0265338_11141311 3300028800 Bacteria 524
404 Ga0265324_10034266 3300029957 Bacteria 1769
405 Ga0265324_10044229 3300029957 Bacteria 1536
406 Ga0265324_10058348 3300029957 Bacteria 1320
407 Ga0265324_10152846 3300029957 Bacteria 784
408 Ga0307511_10400045 3300030521 Unclassified 565
409 Ga0307511_10438678 3300030521 Bacteria 521
410 Ga0265330_10000992 3300031235 Bacteria 17310
411 Ga0265332_10029193 3300031238 Bacteria 2412
412 Ga0265332_10100221 3300031238 Unclassified 1222
413 Ga0265328_10010127 3300031239 Bacteria 3807
414 Ga0265328_10022996 3300031239 Bacteria 2366
415 Ga0265328_10056675 3300031239 Unclassified 1438
416 Ga0265328_10127332 3300031239 Bacteria 952
417 Ga0265328_10389191 3300031239 Unclassified 546
418 Ga0265320_10085187 3300031240 Bacteria 1471
419 Ga0265320_10220358 3300031240 Unclassified 845
420 Ga0265320_10276687 3300031240 Unclassified 743
421 Ga0265320_10308654 3300031240 Bacteria 699
422 Ga0265329_10000522 3300031242 Bacteria 19833
423 Ga0265329_10000629 3300031242 Bacteria 17997
424 Ga0265329_10254532 3300031242 Unclassified 586
425 Ga0265340_10263992 3300031247 Bacteria 766
426 Ga0265339_10258227 3300031249 Unclassified 841
427 Ga0265331_10179927 3300031250 Unclassified 955
428 Ga0265327_10004732 3300031251 Bacteria 11881
429 Ga0265316_10030326 3300031344 Bacteria 4434
430 Ga0265316_10090470 3300031344 Unclassified 2335
431 Ga0265316_10246690 3300031344 Bacteria 1312
432 Ga0265316_10253038 3300031344 Bacteria 1293
433 Ga0265316_10286158 3300031344 Bacteria 1204
434 Ga0265316_10719666 3300031344 Bacteria 703
435 Ga0265316_11080259 3300031344 Bacteria 557
436 Ga0265316_11234379 3300031344 Unclassified 517
437 Ga0307508_10627771 3300031616 Unclassified 678
438 Ga0316575_10088382 3300031665 Bacteria 1254
439 Ga0316579_10573323 3300031691 Bacteria 546
440 Ga0265314_10000037 3300031711 Bacteria 225790
441 Ga0265314_10000825 3300031711 Bacteria 36821
442 Ga0265314_10170957 3300031711 Bacteria 1312
443 Ga0265314_10577505 3300031711 Unclassified 582
444 Ga0265342_10013347 3300031712 Bacteria 5518
445 Ga0265342_10218836 3300031712 Unclassified 1027
446 Ga0265342_10648464 3300031712 Bacteria 530
447 Ga0316576_10320072 3300031727 Bacteria 1157
448 Ga0307516_10565185 3300031730 Bacteria 791
449 Ga0307405_10159655 3300031731 Bacteria 1595
450 Ga0307410_10431494 3300031852 Bacteria 1071
451 Ga0307406_11037710 3300031901 Bacteria 705
452 Ga0307409_100835214 3300031995 Bacteria 931
453 Ga0307416_101992327 3300032002 Bacteria 683
454 Ga0307414_12164616 3300032004 Bacteria 519
455 Ga0307411_10181273 3300032005 Bacteria 1599
456 Ga0316583_10202687 3300032133 Bacteria 689
457 Ga0373940_0072852 3300035088 Unclassified 1003
458 Ga0373944_0295397 3300035089 Bacteria 607
459 Ga0373923_0061693 3300035111 Bacteria 1594
460 Ga0373953_0101019 3300035117 Unclassified 1214
461 Ga0373954_0101667 3300035118 Bacteria 1387
462 Ga0373954_0294554 3300035118 Bacteria 800
463 Ga0373956_0146199 3300035119 Bacteria 1111
464 Ga0373955_0138406 3300035172 Bacteria 1426
465 Ga0316574_0354099 3300035398 Bacteria 928
466 Ga0373924_0031518 3300035410 Bacteria 2132
467 Ga0373931_0070939 3300035691 Bacteria 1902
468 Ga0373931_0104619 3300035691 Unclassified 1597
469 Ga0373931_0803189 3300035691 Unclassified 627
470 Ga0373927_0957944 3300035695 Unclassified 565
471 Ga0373937_0183441 3300036401 Bacteria 1965
472 Ga0316582_0900120 3300036647 Bacteria 605
473 Ga0373925_1025988 3300037068 Unclassified 679
474 Ga0373925_1194306 3300037068 Unclassified 625
475 Ga0395900_0135897 3300037418 Unclassified 2519
476 Ga0395905_0159696 3300037471 Bacteria 2119
477 Ga0395901_0593386 3300038443 Bacteria 1118
478 Ga0451793_1246557 3300041452 Bacteria 507
479 Ga0451800_0759120 3300041459 Bacteria 1583
480 Ga0451807_2536617 3300041486 Bacteria 837
481 Ga0451577_0037979 3300042876 Bacteria 4332
482 Ga0451577_0204744 3300042876 Bacteria 1781
483 Ga0451577_1105625 3300042876 Bacteria 709
484 Ga0451577_1216217 3300042876 Unclassified 672
485 Ga0453683_0013679 3300044673 Bacteria 5287
486 Ga0453683_0028834 3300044673 Bacteria 3512
487 Ga0453683_0057752 3300044673 Unclassified 2427
488 Ga0453683_0260234 3300044673 Bacteria 1107
489 Ga0453683_1188752 3300044673 Unclassified 510
490 Ga0453684_0074415 3300044712 Bacteria 4277
491 Ga0453684_0101279 3300044712 Bacteria 3524
492 Ga0453684_0194828 3300044712 Bacteria 2367
493 Ga0453684_0431576 3300044712 Bacteria 1470
494 Ga0453684_1113479 3300044712 Bacteria 833
495 Ga0453684_1858987 3300044712 Bacteria 610
496 Ga0453684_1907998 3300044712 Bacteria 601
497 Ga0466959_0987671 3300045049 Bacteria 561
498 Ga0451576_0106666 3300045051 Bacteria 2915
499 Ga0451576_0108373 3300045051 Bacteria 2890
500 Ga0451576_0109325 3300045051 Bacteria 2877
501 Ga0451576_0142623 3300045051 Bacteria 2498
502 Ga0451576_0146053 3300045051 Bacteria 2466
503 Ga0451576_0193761 3300045051 Bacteria 2123
504 Ga0451576_0282194 3300045051 Bacteria 1737
505 Ga0451576_0406210 3300045051 Bacteria 1428
506 Ga0451576_0642701 3300045051 Bacteria 1115
507 Ga0451576_1171553 3300045051 Bacteria 803
508 Ga0451576_1239274 3300045051 Bacteria 778
509 Ga0451576_1269374 3300045051 Unclassified 768
510 Ga0451576_1832464 3300045051 Bacteria 627
511 Ga0451576_2656220 3300045051 Unclassified 510
512 Ga0495592_0015043 3300046454 Bacteria 5876
513 Ga0495603_0820937 3300046455 Bacteria 530
514 Ga0495629_0588133 3300046459 Bacteria 745
515 Ga0495641_0014158 3300046461 Bacteria 4329
516 Ga0495653_0172477 3300046463 Bacteria 1492
517 Ga0495582_0163186 3300046473 Bacteria 1268
518 Ga0495639_0094418 3300046475 Bacteria 1406
519 Ga0495662_0023672 3300046476 Bacteria 2966
520 Ga0495662_0322045 3300046476 Bacteria 760
521 Ga0495664_0339075 3300046477 Unclassified 906
522 Ga0495664_0939256 3300046477 Bacteria 505
523 Ga0495596_0270457 3300046500 Bacteria 660
524 Ga0495608_0579930 3300046511 Bacteria 674
525 Ga0495618_0258179 3300046514 Bacteria 1092
526 Ga0495628_0182909 3300046516 Bacteria 1584
527 Ga0495630_0246076 3300046517 Unclassified 1366
528 Ga0495630_0249086 3300046517 Bacteria 1357
529 Ga0495630_0419455 3300046517 Bacteria 1025
530 Ga0495666_0240080 3300046526 Bacteria 827
531 Ga0495652_0209435 3300046529 Bacteria 1473
532 Ga0495586_0001216 3300046535 Bacteria 14461
533 Ga0495587_0213592 3300046536 Bacteria 1089
534 Ga0495598_0241362 3300046537 Bacteria 666
535 Ga0495621_0104222 3300046539 Bacteria 1082
536 Ga0495621_0196029 3300046539 Unclassified 811
537 Ga0495645_0048474 3300046543 Bacteria 3094
538 Ga0495645_0134676 3300046543 Bacteria 1729
539 Ga0495667_0091415 3300046559 Bacteria 1971
540 Ga0495667_0723187 3300046559 Bacteria 616
541 Ga0495634_0024799 3300046642 Bacteria 4204
542 Ga0495634_0045242 3300046642 Bacteria 2977
543 Ga0495635_0216885 3300046663 Bacteria 1295
544 Ga0495599_0138433 3300046678 Bacteria 1510
545 Ga0495599_0173673 3300046678 Bacteria 1329
546 Ga0495646_0574785 3300046680 Unclassified 574
547 Ga0495647_0006570 3300046681 Bacteria 3857
548 Ga0495647_0245573 3300046681 Unclassified 796
549 Ga0495658_0001793 3300046683 Bacteria 11053
550 Ga0495658_0103239 3300046683 Bacteria 1705
551 Ga0495613_0002117 3300046689 Bacteria 15066
552 Ga0495613_0100074 3300046689 Bacteria 2094
553 Ga0495624_0139569 3300046690 Bacteria 1485
554 Ga0495604_0784481 3300047317 Unclassified 601
555 Ga0495674_0003764 3300047319 Bacteria 14750
556 Ga0495674_0379027 3300047319 Bacteria 1145
557 Ga0495674_1240376 3300047319 Bacteria 562
558 Ga0495676_0223570 3300047321 Bacteria 1296
559 Ga0495680_0143751 3300047322 Bacteria 1744
560 Ga0495684_0169472 3300047471 Bacteria 1625
561 Ga0495602_0968160 3300048088 Unclassified 563
562 Ga0495614_0214834 3300048089 Bacteria 873
563 Ga0496108_1260636 3300048911 Bacteria 623
564 Ga0496109_1990729 3300048912 Unclassified 513
565 Ga0496112_1806006 3300048915 Unclassified 523
566 Ga0496113_1425669 3300048916 Unclassified 536
567 Ga0496115_0023021 3300048918 Bacteria 4832
568 Ga0495682_0327245 3300049460 Unclassified 540
569 Ga0501300_056504 3300049523 Bacteria 614
570 Ga0501033_0082709 3300049570 Unclassified 2354
571 Ga0501034_0267645 3300049571 Bacteria 1651
572 Ga0501034_0442079 3300049571 Unclassified 1219
573 Ga0501034_0932146 3300049571 Bacteria 755
574 Ga0501075_0432833 3300049591 Unclassified 1003
575 Ga0501209_232985 3300049656 Bacteria 573
576 Ga0501217_104168 3300049661 Bacteria 809
577 Ga0501227_103939 3300049665 Bacteria 757
578 Ga0501253_115797 3300049683 Bacteria 644
579 Ga0501259_119840 3300049688 Bacteria 624
580 Ga0501261_042208 3300049690 Bacteria 723
581 Ga0501081_0309975 3300049743 Unclassified 1159
582 Ga0501268_162511 3300049765 Bacteria 522
583 Ga0501044_0366904 3300049823 Bacteria 1357
584 nmdc:mga05p37_683847_c1 3300050507 Bacteria 1143
585 nmdc:mga09592_108835_c1 3300050508 Unclassified 2377
586 nmdc:mga09592_1192557_c1 3300050508 Unclassified 629
587 nmdc:mga0qj67_182827_c1 3300050509 Bacteria 1703
588 nmdc:mga06r32_53546_c1 3300050510 Bacteria 3866
589 nmdc:mga08y16_1368151_c1 3300050511 Bacteria 672
590 nmdc:mga08y16_1454777_c1 3300050511 Bacteria 647
591 nmdc:mga08y16_265161_c1 3300050511 Unclassified 1773
592 nmdc:mga08y16_29996_c1 3300050511 Bacteria 5726
593 nmdc:mga08y16_684052_c1 3300050511 Bacteria 1027
594 nmdc:mga0n895_156424_c1 3300050512 Bacteria 2310
595 nmdc:mga0n895_1650421_c1 3300050512 Bacteria 604
596 nmdc:mga0n895_331286_c1 3300050512 Bacteria 1542
597 nmdc:mga0rr50_301768_c1 3300050513 Bacteria 1340
598 nmdc:mga0rr50_831267_c1 3300050513 Bacteria 788
599 nmdc:mga0a205_1135821_c1 3300050515 Bacteria 629
600 nmdc:mga0a205_1181189_c1 3300050515 Unclassified 613
601 Ga0495601_0508269 3300053077 Unclassified 777
602 Ga0590075_214336 3300059424 Bacteria 510
603 Ga0587085_124127 3300059506 Bacteria 570
604 Ga0530510_0451453 3300061734 Bacteria 972
605 Ga0373923_0265571
606 Ga0065712_10405532
607 Ga0065707_10494707
608 Ga0065707_10750705
609 Ga0065707_10868595
610 Ga0070658_10671380
611 Ga0070658_11545828
612 Ga0070683_100590468
613 Ga0070683_101404596
614 Ga0070690_100054193
615 Ga0070690_100345682
616 Ga0070690_100355668
617 Ga0070690_100589747
618 Ga0070666_10086131
619 Ga0070666_10095544
620 Ga0070666_10190654
621 Ga0070680_100975500
622 Ga0068868_101478271
623 Ga0070660_100206321
624 Ga0070689_100324609
625 Ga0070689_100492620
626 Ga0070689_100588836
627 Ga0070689_100875277
628 Ga0070689_101776978
629 Ga0070691_10155768
630 Ga0070687_100177420
631 Ga0070687_101098719
632 Ga0070692_10161603
633 Ga0070669_101093805
634 Ga0070669_101954574
635 Ga0070674_101273052
636 Ga0070674_102180222
637 Ga0070673_100060757
638 Ga0070673_100187054
639 Ga0070673_100226241
640 Ga0070673_100885859
641 Ga0070673_101474578
642 Ga0070688_100310103
643 Ga0070688_100362974
644 Ga0070688_101115980
645 Ga0070667_100210394
646 Ga0070709_11142303
647 Ga0070709_11154045
648 Ga0070709_11672859
649 Ga0070714_100034963
650 Ga0070713_100127397
651 Ga0070713_101332727
652 Ga0070701_10138788
653 Ga0070705_101659460
654 Ga0070700_100153537
655 Ga0070700_100893231
656 Ga0070700_101003355
657 Ga0070700_101796876
658 Ga0070694_100445841
659 Ga0070694_100681890
660 Ga0070694_101630646
661 Ga0070708_100272997
662 Ga0070708_100371271
663 Ga0070708_100773110
664 Ga0070681_10247729
665 Ga0070681_10268133
666 Ga0070681_10941371
667 Ga0070681_11524079
668 Ga0068867_100597664
669 Ga0068867_102223837
670 Ga0068867_102246627
671 Ga0070685_10224080
672 Ga0070685_11076933
673 Ga0070706_100000503
674 Ga0070706_100192424
675 Ga0070706_100321649
676 Ga0070706_100737623
677 Ga0070706_101720287
678 Ga0070707_100397655
679 Ga0070707_100789498
680 Ga0070698_100525349
681 Ga0070699_100074200
682 Ga0070699_100533144
683 Ga0070699_101405393
684 Ga0070679_100624935
685 Ga0070679_100974921
686 Ga0070684_101506232
687 Ga0070684_101609657
688 Ga0070697_100034938
689 Ga0070697_100390709
690 Ga0070697_100600471
691 Ga0070697_101437476
692 Ga0068853_100438790
693 Ga0070672_100750942
694 Ga0070686_100000784
695 Ga0070686_100004430
696 Ga0070695_100294126
697 Ga0070695_101029499
698 Ga0070696_100810276
699 Ga0070665_100500550
700 Ga0070704_100087337
701 Ga0070704_100748616
702 Ga0070704_101032442
703 Ga0070704_101409114
704 Ga0068855_100039586
705 Ga0068855_100190561
706 Ga0068855_100393189
707 Ga0068855_100872005
708 Ga0068855_101111418
709 Ga0068857_100217786
710 Ga0068857_100459955
711 Ga0068854_100900210
712 Ga0068854_101380096
713 Ga0068856_100001653
714 Ga0068856_100703155
715 Ga0070702_100148940
716 Ga0070702_101338075
717 Ga0068859_100093376
718 Ga0068859_100154422
719 Ga0068859_100241443
720 Ga0068859_100304825
721 Ga0068859_100599299
722 Ga0068859_100937710
723 Ga0068859_100987793
724 Ga0068859_101062088
725 Ga0068859_101334635
726 Ga0068859_102240456
727 Ga0068864_100052269
728 Ga0068864_100129685
729 Ga0068864_100994829
730 Ga0068864_101793892
731 Ga0068864_102218723
732 Ga0068861_102014218
733 Ga0068861_102255331
734 Ga0068851_10346835
735 Ga0068863_100058805
736 Ga0068863_100468352
737 Ga0068863_101144221
738 Ga0068863_101257271
739 Ga0068858_100241293
740 Ga0068858_100317931
741 Ga0068858_101030843
742 Ga0068858_101142840
743 Ga0068858_101765309
744 Ga0068860_100036541
745 Ga0068860_100560835
746 Ga0068860_100899852
747 Ga0068862_100378016
748 Ga0068862_100477054
749 Ga0068862_101126169
750 Ga0068862_101211663
751 Ga0068862_101497395
752 Ga0070715_10708285
753 Ga0070716_100222085
754 Ga0068871_100531637
755 Ga0068871_100619877
756 Ga0068871_100748855
757 Ga0068871_101088285
758 Ga0068871_101240620
759 Ga0068871_101415092
760 Ga0068871_102034868
761 Ga0075428_101117504
762 Ga0075428_101548743
763 Ga0075428_102172860
764 Ga0075430_100094185
765 Ga0075431_100169943
766 Ga0075431_101998147
767 Ga0075433_10786147
768 Ga0075433_11074548
769 Ga0075433_11145337
770 Ga0075434_100152257
771 Ga0075434_100563162
772 Ga0075434_101337004
773 Ga0075429_100091147
774 Ga0068865_100744886
775 Ga0075436_101406282
776 Ga0097620_100093378
777 Ga0097620_100154426
778 Ga0097620_100241441
779 Ga0097620_100304826
780 Ga0097620_100599269
781 Ga0097620_100937675
782 Ga0097620_100987763
783 Ga0097620_101062155
784 Ga0097620_101334612
785 Ga0097620_102240609
786 Ga0075435_100326220
787 Ga0075435_100700413
788 Ga0099794_10770129
789 Ga0099795_10495861
790 Ga0105251_10477434
791 Ga0105240_10024256
792 Ga0105240_10071787
793 Ga0105240_10145973
794 Ga0105240_10304413
795 Ga0105240_10407896
796 Ga0105240_10739744
797 Ga0111539_10012838
798 Ga0111539_10097424
799 Ga0111539_10166881
800 Ga0111539_10246292
801 Ga0111539_10309449
802 Ga0111539_10914980
803 Ga0111539_11673008
804 Ga0105245_11289490
805 Ga0105245_11595274
806 Ga0105245_12600905
807 Ga0105247_10317888
808 Ga0114129_10964843
809 Ga0114129_11021935
810 Ga0105241_10342115
811 Ga0105242_10027078
812 Ga0105242_10196386
813 Ga0105242_10269021
814 Ga0105242_10383555
815 Ga0105242_10939274
816 Ga0105242_11417688
817 Ga0105242_11429839
818 Ga0105242_11543171
819 Ga0105242_12538102
820 Ga0105242_12598182
821 Ga0105248_10047819
822 Ga0105248_10640647
823 Ga0105248_10980679
824 Ga0105248_11268009
825 Ga0105248_11526649
826 Ga0105238_10001693
827 Ga0105238_10277959
828 Ga0105249_10176281
829 Ga0105249_10855489
830 Ga0105249_11157665
831 Ga0105249_11221691
832 Ga0105249_13078167
833 Ga0105239_11345524
834 Ga0157373_10295588
835 Ga0157371_10904198
836 Ga0157371_11435835
837 Ga0157370_10287694
838 Ga0157370_11254320
839 Ga0157369_10742548
840 Ga0157369_11713314
841 Ga0157374_10061551
842 Ga0157374_10717607
843 Ga0157374_10778896
844 Ga0157374_11245308
845 Ga0157374_12359203
846 Ga0157378_10583970
847 Ga0157378_10881014
848 Ga0157378_10931452
849 Ga0157378_11037229
850 Ga0157378_11722231
851 Ga0157378_12943002
852 Ga0163162_10209601
853 Ga0163162_10436163
854 Ga0163162_10548510
855 Ga0163162_12036510
856 Ga0163162_12226389
857 Ga0163162_12814240
858 Ga0163162_12952139
859 Ga0157372_10753895
860 Ga0157372_11529514
861 Ga0157372_11790961
862 Ga0157375_10000041
863 Ga0157375_10000048
864 Ga0157375_10889273
865 Ga0157375_11224152
866 Ga0157375_12475021
867 Ga0157375_12629703
868 Ga0163163_10000146
869 Ga0163163_10152031
870 Ga0163163_10200284
871 Ga0163163_10502131
872 Ga0163163_10679896
873 Ga0163163_12402293
874 Ga0163163_12829374
875 Ga0157380_10657907
876 Ga0157380_11604602
877 Ga0157377_10768247
878 Ga0157379_10264813
879 Ga0157379_10515910
880 Ga0157379_11867007
881 Ga0157379_11875211
882 Ga0157376_11182482
883 Ga0157376_12710772
884 Ga0157376_12757095
885 Ga0163161_10978724
886 Ga0163161_11777926
887 Ga0207713_1248510
888 Ga0207680_10172416
889 Ga0207680_10909566
890 Ga0207685_10817202
891 Ga0207699_10910446
892 Ga0207699_11327685
893 Ga0207705_10131669
894 Ga0207705_11066757
895 Ga0207684_10000158
896 Ga0207684_10118348
897 Ga0207684_11575070
898 Ga0207654_10279459
899 Ga0207654_10846177
900 Ga0207707_10065372
901 Ga0207707_10494964
902 Ga0207695_10059463
903 Ga0207695_10061854
904 Ga0207695_10085212
905 Ga0207695_10502691
906 Ga0207695_10746393
907 Ga0207695_10750951
908 Ga0207663_10402075
909 Ga0207663_11487027
910 Ga0207660_10563456
911 Ga0207662_10496508
912 Ga0207657_10528916
913 Ga0207652_10405379
914 Ga0207652_11262125
915 Ga0207652_11595513
916 Ga0207646_10373148
917 Ga0207646_10808673
918 Ga0207646_11767603
919 Ga0207681_10743854
920 Ga0207694_10121671
921 Ga0207694_10438380
922 Ga0207664_10030232
923 Ga0207644_11556944
924 Ga0207686_10203080
925 Ga0207686_10297348
926 Ga0207686_10831598
927 Ga0207686_11720557
928 Ga0207709_11565742
929 Ga0207670_10006119
930 Ga0207670_10287224
931 Ga0207670_10385875
932 Ga0207670_10826575
933 Ga0207669_11143989
934 Ga0207704_10987318
935 Ga0207665_10365301
936 Ga0207691_10595140
937 Ga0207711_10353136
938 Ga0207711_10825934
939 Ga0207711_11460952
940 Ga0207711_11651805
941 Ga0207689_10596178
942 Ga0207689_11138553
943 Ga0207679_11116711
944 Ga0207667_10022756
945 Ga0207667_10103546
946 Ga0207667_10149571
947 Ga0207667_10596713
948 Ga0207651_10783932
949 Ga0207651_11017278
950 Ga0207651_11707648
951 Ga0207651_12158925
952 Ga0207712_10206061
953 Ga0207712_11330540
954 Ga0207668_11979312
955 Ga0207640_11003533
956 Ga0207703_10162476
957 Ga0207703_10178901
958 Ga0207703_11298413
959 Ga0207703_12036498
960 Ga0207639_10039271
961 Ga0207678_11364043
962 Ga0207708_10136137
963 Ga0207708_10724518
964 Ga0207702_10004807
965 Ga0207702_10750520
966 Ga0207702_11019862
967 Ga0207641_10249448
968 Ga0207641_10617863
969 Ga0207648_10918338
970 Ga0207648_12238064
971 Ga0207676_10131599
972 Ga0207676_10468787
973 Ga0207676_10772075
974 Ga0207676_10883724
975 Ga0207674_10116487
976 Ga0207674_10662354
977 Ga0207674_11013628
978 Ga0207674_12073948
979 Ga0207675_100700615
980 Ga0209588_1012993
981 Ga0207428_10427396
982 Ga0207428_10432499
983 Ga0268265_10288542
984 Ga0268265_10924382
985 Ga0268264_10240695
986 Ga0268264_10776325
987 Ga0265337_1009271
988 Ga0265319_1062695
989 Ga0265334_10004557
990 Ga0265334_10009566
991 Ga0265334_10280883
992 Ga0265318_10088472
993 Ga0265322_10128012
994 Ga0265338_10001031
995 Ga0265338_10014820
996 Ga0265338_10042984
997 Ga0265338_10053141
998 Ga0265338_10085971
999 Ga0265338_10109949
1000 Ga0265338_10330581
1001 Ga0265338_10411934
1002 Ga0265338_10467787
1003 Ga0265338_10622884
1004 Ga0265338_10632547
1005 Ga0265338_10801054
1006 Ga0265338_10828534
1007 Ga0265338_11141311
1008 Ga0265324_10034266
1009 Ga0265324_10044229
1010 Ga0265324_10058348
1011 Ga0265324_10152846
1012 Ga0307511_10400045
1013 Ga0307511_10438678
1014 Ga0265330_10000992
1015 Ga0265332_10029193
1016 Ga0265332_10100221
1017 Ga0265328_10010127
1018 Ga0265328_10022996
1019 Ga0265328_10056675
1020 Ga0265328_10127332
1021 Ga0265328_10389191
1022 Ga0265320_10085187
1023 Ga0265320_10220358
1024 Ga0265320_10276687
1025 Ga0265320_10308654
1026 Ga0265329_10000522
1027 Ga0265329_10000629
1028 Ga0265329_10254532
1029 Ga0265340_10263992
1030 Ga0265339_10258227
1031 Ga0265331_10179927
1032 Ga0265327_10004732
1033 Ga0265316_10030326
1034 Ga0265316_10090470
1035 Ga0265316_10246690
1036 Ga0265316_10253038
1037 Ga0265316_10286158
1038 Ga0265316_10719666
1039 Ga0265316_11080259
1040 Ga0265316_11234379
1041 Ga0307508_10627771
1042 Ga0316575_10088382
1043 Ga0316579_10573323
1044 Ga0265314_10000037
1045 Ga0265314_10000825
1046 Ga0265314_10170957
1047 Ga0265314_10577505
1048 Ga0265342_10013347
1049 Ga0265342_10218836
1050 Ga0265342_10648464
1051 Ga0316576_10320072
1052 Ga0307516_10565185
1053 Ga0307405_10159655
1054 Ga0307410_10431494
1055 Ga0307406_11037710
1056 Ga0307409_100835214
1057 Ga0307416_101992327
1058 Ga0307414_12164616
1059 Ga0307411_10181273
1060 Ga0316583_10202687
1061 Ga0373940_0072852
1062 Ga0373944_0295397
1063 Ga0373923_0061693
1064 Ga0373953_0101019
1065 Ga0373954_0101667
1066 Ga0373954_0294554
1067 Ga0373956_0146199
1068 Ga0373955_0138406
1069 Ga0316574_0354099
1070 Ga0373924_0031518
1071 Ga0373931_0070939
1072 Ga0373931_0104619
1073 Ga0373931_0803189
1074 Ga0373927_0957944
1075 Ga0373937_0183441
1076 Ga0316582_0900120
1077 Ga0373925_1025988
1078 Ga0373925_1194306
1079 Ga0395900_0135897
1080 Ga0395905_0159696
1081 Ga0395901_0593386
1082 Ga0451793_1246557
1083 Ga0451800_0759120
1084 Ga0451807_2536617
1085 Ga0451577_0037979
1086 Ga0451577_0204744
1087 Ga0451577_1105625
1088 Ga0451577_1216217
1089 Ga0453683_0013679
1090 Ga0453683_0028834
1091 Ga0453683_0057752
1092 Ga0453683_0260234
1093 Ga0453683_1188752
1094 Ga0453684_0074415
1095 Ga0453684_0101279
1096 Ga0453684_0194828
1097 Ga0453684_0431576
1098 Ga0453684_1113479
1099 Ga0453684_1858987
1100 Ga0453684_1907998
1101 Ga0466959_0987671
1102 Ga0451576_0106666
1103 Ga0451576_0108373
1104 Ga0451576_0109325
1105 Ga0451576_0142623
1106 Ga0451576_0146053
1107 Ga0451576_0193761
1108 Ga0451576_0282194
1109 Ga0451576_0406210
1110 Ga0451576_0642701
1111 Ga0451576_1171553
1112 Ga0451576_1239274
1113 Ga0451576_1269374
1114 Ga0451576_1832464
1115 Ga0451576_2656220
1116 Ga0495592_0015043
1117 Ga0495603_0820937
1118 Ga0495629_0588133
1119 Ga0495641_0014158
1120 Ga0495653_0172477
1121 Ga0495582_0163186
1122 Ga0495639_0094418
1123 Ga0495662_0023672
1124 Ga0495662_0322045
1125 Ga0495664_0339075
1126 Ga0495664_0939256
1127 Ga0495596_0270457
1128 Ga0495608_0579930
1129 Ga0495618_0258179
1130 Ga0495628_0182909
1131 Ga0495630_0246076
1132 Ga0495630_0249086
1133 Ga0495630_0419455
1134 Ga0495666_0240080
1135 Ga0495652_0209435
1136 Ga0495586_0001216
1137 Ga0495587_0213592
1138 Ga0495598_0241362
1139 Ga0495621_0104222
1140 Ga0495621_0196029
1141 Ga0495645_0048474
1142 Ga0495645_0134676
1143 Ga0495667_0091415
1144 Ga0495667_0723187
1145 Ga0495634_0024799
1146 Ga0495634_0045242
1147 Ga0495635_0216885
1148 Ga0495599_0138433
1149 Ga0495599_0173673
1150 Ga0495646_0574785
1151 Ga0495647_0006570
1152 Ga0495647_0245573
1153 Ga0495658_0001793
1154 Ga0495658_0103239
1155 Ga0495613_0002117
1156 Ga0495613_0100074
1157 Ga0495624_0139569
1158 Ga0495604_0784481
1159 Ga0495674_0003764
1160 Ga0495674_0379027
1161 Ga0495674_1240376
1162 Ga0495676_0223570
1163 Ga0495680_0143751
1164 Ga0495684_0169472
1165 Ga0495602_0968160
1166 Ga0495614_0214834
1167 Ga0496108_1260636
1168 Ga0496109_1990729
1169 Ga0496112_1806006
1170 Ga0496113_1425669
1171 Ga0496115_0023021
1172 Ga0495682_0327245
1173 Ga0501300_056504
1174 Ga0501033_0082709
1175 Ga0501034_0267645
1176 Ga0501034_0442079
1177 Ga0501034_0932146
1178 Ga0501075_0432833
1179 Ga0501209_232985
1180 Ga0501217_104168
1181 Ga0501227_103939
1182 Ga0501253_115797
1183 Ga0501259_119840
1184 Ga0501261_042208
1185 Ga0501081_0309975
1186 Ga0501268_162511
1187 Ga0501044_0366904
1188 nmdc:mga05p37_683847_c1
1189 nmdc:mga09592_108835_c1
1190 nmdc:mga09592_1192557_c1
1191 nmdc:mga0qj67_182827_c1
1192 nmdc:mga06r32_53546_c1
1193 nmdc:mga08y16_1368151_c1
1194 nmdc:mga08y16_1454777_c1
1195 nmdc:mga08y16_265161_c1
1196 nmdc:mga08y16_29996_c1
1197 nmdc:mga08y16_684052_c1
1198 nmdc:mga0n895_156424_c1
1199 nmdc:mga0n895_1650421_c1
1200 nmdc:mga0n895_331286_c1
1201 nmdc:mga0rr50_301768_c1
1202 nmdc:mga0rr50_831267_c1
1203 nmdc:mga0a205_1135821_c1
1204 nmdc:mga0a205_1181189_c1
1205 Ga0495601_0508269
1206 Ga0590075_214336
1207 Ga0587085_124127
1208 Ga0530510_0451453

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00216

Bac_DNA_binding

Bacterial DNA-binding protein

26

113

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rhi-assembly1.cif.gz_B dna-binding protein hu from bacillus anthracis 0.876 3 91
4qju-assembly1.cif.gz_B crystal structure of dna-bound nucleoid associated protein, sav1473 0.872 5 91
6o8q-assembly1.cif.gz_D huaa 19bp sym dna ph 4.5 0.8704 4 91
5fbm-assembly1.cif.gz_A crystal structure of histone like protein (hlp) from streptococcus mutans refined to 1.9 a resolution 0.863 5 92
1b8z-assembly1.cif.gz_B hu from thermotoga maritima 0.863 5 91
ID Description Score Start End Superfamily
5fbmA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.863 5 92 4.10.520.10
5fbmA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.8441 5 92 4.10.520.10
2np2B00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.8291 4 95 4.10.520.10
6n2lA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.8291 1 92 4.10.520.10
1ihfA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.8245 4 95 4.10.520.10
ID Description Score Start End GO Terms
AF-A0A1G1ACK7-F1-model_v4 Viral histone-like protein (DNA-binding protein pA104R) (pA104R) 0.9615 1 91 GO:0003677
GO:0005829
GO:0006260
GO:0030527
AF-D8P884-F1-model_v4 Viral histone-like protein (DNA-binding protein pA104R) (pA104R) 0.9606 1 95 GO:0003677
GO:0005829
GO:0006260
GO:0030527
AF-A0A3C1WJM0-F1-model_v4 Viral histone-like protein (DNA-binding protein pA104R) (pA104R) 0.9506 2 86 GO:0003677
GO:0005829
GO:0006260
GO:0030527
AF-A0A1F3C866-F1-model_v4 Viral histone-like protein (DNA-binding protein pA104R) (pA104R) 0.9442 1 95 GO:0003677
GO:0005829
GO:0006260
GO:0030527
AF-A0A7C3X0J5-F1-model_v4 Viral histone-like protein (DNA-binding protein pA104R) (pA104R) 0.9437 3 95 GO:0003677
GO:0005829
GO:0006260
GO:0030527

Map