F468320

General Info

Members Datasets Scaffolds Average Seq Length
603 483 1206 478

Family's Representative Sequence

Representative Sequence 3300048090|Ga0495615_0000024|Ga0495615_0000024_5158_6798
Length 546
Sequence LDLYHRVVAVKKRADWQMEMKTMGEATLDGTTATRRTVLTGAATALGTMAAPALARVAERRGTGSNEIVMMNATDLSAAIHRRDLSSREVMTAHLAQIDRLNPRFNAIVSRVDGDALLRQAAAMDEDAAANRFHGPLHGFPHAVKDTAPVKGIASTQGSPILRDNIPAADSLVVSRMRKAGAIFLGKSNVPEFALGSHSYNPVFGTTHNAYAYGRAAGGSTGGGAVALALRMVPVADGSDFGGSLRNPPGWNNVFGLRPSFGRVPSVPNTDLFWQNFATSGPLGRTVSDLAMLFSVQAGGDARAPFSLGDDPAMFARPLDRDWKGGRVGWLGDLGGALPMEAGIMETCTKALKAFEAIGMTVEEATLAEPASEMWRTAVALRHWSVGADLQGFYDDPAKRALMKPEAIWEVEGGMKLTGPQLAKASEGRTRIYNAFAAAFEKFDFLVLPSAQVFPFDASEHWPTEIAGKAMNSYHRWMEVTLPATMAGLPALAVPAGFGGARKLPIGLQIIGRRHADLAVLQVGHAYEKASPWIAASLPSALQGLR

Samples

Sample ID Description Type Environment
1 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
141 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
173 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
174 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
199 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
203 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
221 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
245 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
246 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
247 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
248 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
249 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
250 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
251 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
252 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
255 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
256 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
258 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
259 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
260 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
261 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
262 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
263 2519103095 Burkholderia sp. KJ006 Isolate Nodule
264 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
265 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
266 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
267 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
268 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
269 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
270 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
271 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
272 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
273 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
274 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
275 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
276 2643221570 Acidovorax sp. Root568 Isolate Unclassified
277 2643221596 Acidovorax sp. Root70 Isolate Unclassified
278 2643221611 Acidovorax sp. Root219 Isolate Unclassified
279 2643221652 Acidovorax sp. Root402 Isolate Unclassified
280 2643221717 Acidovorax sp. Root267 Isolate Unclassified
281 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
282 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
283 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
284 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
285 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
286 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
287 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
288 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
289 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
290 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
291 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
292 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
293 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
294 2818991452 Burkholderia cepacia 561 Isolate Unclassified
295 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
296 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
297 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
298 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
299 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
300 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
301 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
302 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
303 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
304 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
305 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
306 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
307 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
308 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
309 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
310 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
311 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
312 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
313 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
314 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
315 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
316 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
317 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
318 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
319 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
320 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
321 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
322 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
323 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
324 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
325 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
326 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
327 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
328 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
329 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
330 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
331 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
332 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
333 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
334 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
335 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
336 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
337 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
338 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
339 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
340 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
341 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
342 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
343 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
344 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
345 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
346 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
347 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
348 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
349 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
350 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
351 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
352 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
353 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
354 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
355 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
356 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
357 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
358 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
359 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
360 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
361 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
362 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
363 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
364 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
365 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
366 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
367 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
368 2902330777 Methylobacterium sp. 2A Isolate Unclassified
369 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
370 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
371 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
372 2904564687 Burkholderia sp. 571 Isolate Unclassified
373 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
374 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
375 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
376 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
377 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
378 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
379 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
380 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
381 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
382 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
383 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
384 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
385 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
386 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
387 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
388 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
389 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
390 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
391 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
392 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
393 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
394 2928163908 Burkholderia sp. 567 Isolate Unclassified
395 2928170801 Burkholderia sp. 572 Isolate Unclassified
396 2928536128 Burkholderia sola 565 Isolate Unclassified
397 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
398 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
399 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
400 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
401 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
402 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
403 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
404 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
405 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
406 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
407 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
408 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
409 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
410 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
411 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
412 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
413 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
414 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
415 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
416 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
417 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
418 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
419 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
420 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
421 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
422 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
423 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
424 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
425 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
426 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
427 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
428 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
429 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
430 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
431 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
432 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
433 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
434 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
435 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
436 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
437 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
438 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
439 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
440 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
441 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
442 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
443 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
444 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
445 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
446 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
447 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
448 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
449 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
450 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
451 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
452 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
453 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
454 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
455 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
456 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
457 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
458 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
459 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
460 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
461 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
462 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
463 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
464 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
465 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
466 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
467 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
468 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
469 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
470 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
471 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
472 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
473 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
474 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
475 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
476 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
477 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
478 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
479 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
480 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
481 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
482 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
483 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.35
Metatranscriptomes 0
Isolates 37.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.61
Nodule 25.87
Rhizoplane 3.98
Rhizosphere 46.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495615_0000024 3300048090 Bacteria 49847
2 SwRhRL2b_contig_2580795 2162886007 Bacteria 31968
3 JGI24735J21928_10000068 3300002067 Bacteria 42619
4 JGI25156J39149_1006803 3300002705 Bacteria 3078
5 JGI25165J46597_1000034 3300003214 Bacteria 292458
6 Ga0055532_1000778 3300003758 Bacteria 11151
7 Ga0055527_1000358 3300003760 Bacteria 21912
8 Ga0055527_1001221 3300003760 Bacteria 5707
9 Ga0055535_1000842 3300003761 Bacteria 21912
10 Ga0055535_1002338 3300003761 Bacteria 6850
11 Ga0055542_1001458 3300003762 Bacteria 11679
12 Ga0055529_1000639 3300003763 Bacteria 25736
13 Ga0055536_1000039 3300003781 Bacteria 131503
14 Ga0055528_1001235 3300003790 Bacteria 16295
15 Ga0055530_10003479 3300003791 Bacteria 8928
16 Ga0055530_10016443 3300003791 Bacteria 2363
17 Ga0055531_10000136 3300003794 Bacteria 83698
18 Ga0065704_10070331 3300005289 Bacteria 32035
19 Ga0070658_10202610 3300005327 Bacteria 1675
20 Ga0070683_100012578 3300005329 Bacteria 7358
21 Ga0070690_100033524 3300005330 Bacteria 3216
22 Ga0070670_100035619 3300005331 Bacteria 4284
23 Ga0070670_100059201 3300005331 Bacteria 3288
24 Ga0068869_100001012 3300005334 Bacteria 16348
25 Ga0068869_100013944 3300005334 Bacteria 5360
26 Ga0070666_10004577 3300005335 Bacteria 8434
27 Ga0070666_10020753 3300005335 Bacteria 4251
28 Ga0068868_100000575 3300005338 Bacteria 24636
29 Ga0068868_100008079 3300005338 Bacteria 7526
30 Ga0068868_100061091 3300005338 Bacteria 2985
31 Ga0070660_100000171 3300005339 Bacteria 42584
32 Ga0070689_100104504 3300005340 Bacteria 2246
33 Ga0070661_100008798 3300005344 Bacteria 6987
34 Ga0070661_100054582 3300005344 Bacteria 2926
35 Ga0070668_100050970 3300005347 Bacteria 3188
36 Ga0070669_100006001 3300005353 Bacteria 8762
37 Ga0070675_100005239 3300005354 Bacteria 9895
38 Ga0070671_100132593 3300005355 Bacteria 2099
39 Ga0070673_100007729 3300005364 Bacteria 7114
40 Ga0070659_100000028 3300005366 Bacteria 140665
41 Ga0070659_100004422 3300005366 Bacteria 10038
42 Ga0070659_100074692 3300005366 Bacteria 2701
43 Ga0070667_100000975 3300005367 Bacteria 26309
44 Ga0070667_100043848 3300005367 Bacteria 3755
45 Ga0070667_100058191 3300005367 Bacteria 3267
46 Ga0070701_10014212 3300005438 Bacteria 3644
47 Ga0070700_100135936 3300005441 Bacteria 1664
48 Ga0070663_100002297 3300005455 Bacteria 10726
49 Ga0070663_100028001 3300005455 Bacteria 3832
50 Ga0070663_100124549 3300005455 Bacteria 1951
51 Ga0070662_100011608 3300005457 Bacteria 5814
52 Ga0070684_100025981 3300005535 Bacteria 4928
53 Ga0068853_100012253 3300005539 Bacteria 6973
54 Ga0068853_100043536 3300005539 Bacteria 3841
55 Ga0068853_100223471 3300005539 Bacteria 1721
56 Ga0070672_100094473 3300005543 Bacteria 2417
57 Ga0070665_100000162 3300005548 Bacteria 122048
58 Ga0070665_100104975 3300005548 Bacteria 2827
59 Ga0068855_100010912 3300005563 Bacteria 10968
60 Ga0068855_100081416 3300005563 Bacteria 3753
61 Ga0068855_100204683 3300005563 Bacteria 2221
62 Ga0070664_100046601 3300005564 Bacteria 3661
63 Ga0068854_100003737 3300005578 Bacteria 9513
64 Ga0068856_100062762 3300005614 Bacteria 3670
65 Ga0068856_100116054 3300005614 Bacteria 2677
66 Ga0068852_100006709 3300005616 Bacteria 8349
67 Ga0068852_100025581 3300005616 Bacteria 4785
68 Ga0068852_100026355 3300005616 Bacteria 4723
69 Ga0068859_100000918 3300005617 Bacteria 30168
70 Ga0068859_100013476 3300005617 Bacteria 8199
71 Ga0068864_100007688 3300005618 Bacteria 8878
72 Ga0068861_100002482 3300005719 Bacteria 12022
73 Ga0068851_10020532 3300005834 Bacteria 3199
74 Ga0068863_100007075 3300005841 Bacteria 10998
75 Ga0068858_100003339 3300005842 Bacteria 15987
76 Ga0068860_100135935 3300005843 Bacteria 2361
77 Ga0068862_100075311 3300005844 Bacteria 2919
78 Ga0075365_10000225 3300006038 Bacteria 19139
79 Ga0075365_10026681 3300006038 Bacteria 3669
80 Ga0075365_10052256 3300006038 Bacteria 2702
81 Ga0075362_10000769 3300006177 Bacteria 9560
82 Ga0075362_10009821 3300006177 Bacteria 3715
83 Ga0075367_10002438 3300006178 Bacteria 8497
84 Ga0075367_10006041 3300006178 Bacteria 6084
85 Ga0075369_10009658 3300006186 Bacteria 3753
86 Ga0075369_10025470 3300006186 Bacteria 2460
87 Ga0097621_100022941 3300006237 Bacteria 4850
88 Ga0075370_10012307 3300006353 Bacteria 4517
89 Ga0068871_100013316 3300006358 Bacteria 6102
90 Ga0097620_100000918 3300006931 Bacteria 30168
91 Ga0097620_100013476 3300006931 Bacteria 8199
92 Ga0099794_10009853 3300007265 Bacteria 4038
93 Ga0105251_10000257 3300009011 Bacteria 53526
94 Ga0105250_10011018 3300009092 Bacteria 3758
95 Ga0105240_10005221 3300009093 Bacteria 19429
96 Ga0105240_10030666 3300009093 Bacteria 6985
97 Ga0105241_10048283 3300009174 Bacteria 3239
98 Ga0105248_10006934 3300009177 Bacteria 12415
99 Ga0105248_10011984 3300009177 Bacteria 9561
100 Ga0105248_10014152 3300009177 Bacteria 8782
101 Ga0105237_10066305 3300009545 Bacteria 3605
102 Ga0105238_10048047 3300009551 Bacteria 4301
103 Ga0105238_10071394 3300009551 Bacteria 3470
104 Ga0105239_10011230 3300010375 Bacteria 9995
105 Ga0105239_10023220 3300010375 Bacteria 6834
106 Ga0105239_10166158 3300010375 Bacteria 2467
107 Ga0157373_10008521 3300013100 Bacteria 7617
108 Ga0157369_10034668 3300013105 Bacteria 5536
109 Ga0157369_10056912 3300013105 Bacteria 4219
110 Ga0157374_10047092 3300013296 Bacteria 3996
111 Ga0163162_10012231 3300013306 Bacteria 8376
112 Ga0157375_10068394 3300013308 Bacteria 3554
113 Ga0163163_10003966 3300014325 Bacteria 12635
114 Ga0163163_10009511 3300014325 Bacteria 8680
115 Ga0157377_10003948 3300014745 Bacteria 6759
116 Ga0157379_10039284 3300014968 Bacteria 4222
117 Ga0157379_10110540 3300014968 Bacteria 2468
118 Ga0157376_10003290 3300014969 Bacteria 11129
119 Ga0182005_1000439 3300015265 Bacteria 22059
120 Ga0213872_10001399 3300021361 Bacteria 15889
121 Ga0209566_100608 3300025225 Bacteria 22281
122 Ga0209672_100042 3300025228 Bacteria 272005
123 Ga0209672_100131 3300025228 Bacteria 74237
124 Ga0209147_100012 3300025229 Bacteria 681990
125 Ga0209147_100046 3300025229 Bacteria 295158
126 Ga0209147_100052 3300025229 Bacteria 272005
127 Ga0209258_100030 3300025242 Bacteria 470208
128 Ga0209258_100073 3300025242 Bacteria 272005
129 Ga0209026_1000100 3300025250 Bacteria 156131
130 Ga0209148_1000022 3300025254 Bacteria 681990
131 Ga0209148_1000524 3300025254 Bacteria 37800
132 Ga0209759_1001671 3300025256 Bacteria 11570
133 Ga0209233_1000028 3300025261 Bacteria 642062
134 Ga0209455_1000024 3300025272 Bacteria 676133
135 Ga0209455_1000505 3300025272 Bacteria 27995
136 Ga0209673_1000021 3300025273 Bacteria 422978
137 Ga0209676_1000094 3300025292 Bacteria 246535
138 Ga0209025_1015439 3300025294 Bacteria 4604
139 Ga0209025_1053687 3300025294 Bacteria 1578
140 Ga0209758_1000105 3300025297 Bacteria 221415
141 Ga0209758_1009093 3300025297 Bacteria 6265
142 Ga0209758_1014174 3300025297 Bacteria 4266
143 Ga0209050_1000205 3300025298 Bacteria 132077
144 Ga0209050_1025073 3300025298 Bacteria 2039
145 Ga0209051_1001739 3300025303 Bacteria 17361
146 Ga0209257_1000110 3300025304 Bacteria 237242
147 Ga0207656_10004800 3300025321 Bacteria 4744
148 Ga0207656_10006570 3300025321 Bacteria 4190
149 Ga0207713_1004373 3300025735 Bacteria 9181
150 Ga0207680_10020131 3300025903 Bacteria 3583
151 Ga0207647_10020004 3300025904 Bacteria 4494
152 Ga0207647_10020851 3300025904 Bacteria 4387
153 Ga0207647_10028806 3300025904 Bacteria 3603
154 Ga0207647_10046544 3300025904 Bacteria 2703
155 Ga0207705_10013177 3300025909 Bacteria 5966
156 Ga0207695_10003099 3300025913 Bacteria 23798
157 Ga0207695_10026702 3300025913 Bacteria 6442
158 Ga0207671_10065556 3300025914 Bacteria 2702
159 Ga0207660_10033624 3300025917 Bacteria 3549
160 Ga0207660_10096312 3300025917 Bacteria 2203
161 Ga0207662_10086520 3300025918 Bacteria 1921
162 Ga0207657_10000111 3300025919 Bacteria 79991
163 Ga0207649_10004556 3300025920 Bacteria 7523
164 Ga0207649_10053516 3300025920 Bacteria 2509
165 Ga0207694_10029712 3300025924 Bacteria 4171
166 Ga0207694_10129173 3300025924 Bacteria 2024
167 Ga0207650_10001979 3300025925 Bacteria 14381
168 Ga0207659_10016156 3300025926 Bacteria 4853
169 Ga0207644_10109672 3300025931 Bacteria 2085
170 Ga0207690_10000009 3300025932 Bacteria 366044
171 Ga0207690_10003621 3300025932 Bacteria 9198
172 Ga0207706_10004906 3300025933 Bacteria 12514
173 Ga0207706_10037163 3300025933 Bacteria 4324
174 Ga0207706_10163621 3300025933 Bacteria 1955
175 Ga0207709_10041258 3300025935 Bacteria 2768
176 Ga0207704_10093964 3300025938 Bacteria 1979
177 Ga0207691_10057171 3300025940 Bacteria 3551
178 Ga0207711_10013077 3300025941 Bacteria 6895
179 Ga0207711_10025423 3300025941 Bacteria 4969
180 Ga0207689_10024074 3300025942 Bacteria 5107
181 Ga0207679_10010326 3300025945 Bacteria 6007
182 Ga0207667_10034927 3300025949 Bacteria 5396
183 Ga0207667_10292288 3300025949 Bacteria 1665
184 Ga0207651_10052008 3300025960 Bacteria 2791
185 Ga0207640_10020259 3300025981 Bacteria 3947
186 Ga0207658_10002242 3300025986 Bacteria 14325
187 Ga0207658_10029501 3300025986 Bacteria 3875
188 Ga0207658_10041889 3300025986 Bacteria 3318
189 Ga0207677_10000913 3300026023 Bacteria 16539
190 Ga0207677_10021007 3300026023 Bacteria 3980
191 Ga0207677_10037205 3300026023 Bacteria 3179
192 Ga0207703_10002088 3300026035 Bacteria 17561
193 Ga0207639_10030297 3300026041 Bacteria 3968
194 Ga0207639_10051220 3300026041 Bacteria 3140
195 Ga0207678_10000347 3300026067 Bacteria 41971
196 Ga0207678_10003791 3300026067 Bacteria 13596
197 Ga0207678_10025794 3300026067 Bacteria 5130
198 Ga0207708_10131295 3300026075 Bacteria 1958
199 Ga0207702_10046029 3300026078 Bacteria 3672
200 Ga0207702_10067251 3300026078 Bacteria 3075
201 Ga0207641_10005859 3300026088 Bacteria 10430
202 Ga0207676_10002408 3300026095 Bacteria 13344
203 Ga0207676_10005004 3300026095 Bacteria 9386
204 Ga0207676_10185751 3300026095 Bacteria 1824
205 Ga0207674_10007706 3300026116 Bacteria 12530
206 Ga0207674_10032056 3300026116 Bacteria 5513
207 Ga0207674_10103884 3300026116 Bacteria 2820
208 Ga0207674_10127863 3300026116 Bacteria 2505
209 Ga0207675_100007717 3300026118 Bacteria 10156
210 Ga0207675_100009173 3300026118 Bacteria 9282
211 Ga0209371_1000881 3300027312 Bacteria 24014
212 Ga0268266_10001790 3300028379 Bacteria 24352
213 Ga0307517_10038602 3300028786 Bacteria 5278
214 Ga0307517_10056215 3300028786 Bacteria 3844
215 Ga0307517_10099452 3300028786 Bacteria 2306
216 Ga0307515_10106102 3300028794 Bacteria 3336
217 Ga0265338_10006380 3300028800 Bacteria 15054
218 Ga0265338_10015723 3300028800 Bacteria 8292
219 Ga0268256_1000741 3300030500 Bacteria 24023
220 Ga0307511_10009968 3300030521 Bacteria 9451
221 Ga0307513_10155060 3300031456 Bacteria 2191
222 Ga0307509_10019199 3300031507 Bacteria 7811
223 Ga0307408_100027310 3300031548 Bacteria 3932
224 Ga0307508_10136012 3300031616 Bacteria 2061
225 Ga0265314_10000879 3300031711 Bacteria 35809
226 Ga0265342_10008727 3300031712 Bacteria 7231
227 Ga0316576_10109348 3300031727 Bacteria 2071
228 Ga0307412_10047569 3300031911 Bacteria 2818
229 Ga0307414_10004001 3300032004 Bacteria 7956
230 Ga0307510_10002541 3300033180 Bacteria 20801
231 Ga0373955_0093223 3300035172 Bacteria 1719
232 Ga0373935_0004695 3300035692 Bacteria 8040
233 Ga0395899_0003020 3300037312 Bacteria 13436
234 Ga0395900_0025881 3300037418 Bacteria 6006
235 Ga0395900_0028249 3300037418 Bacteria 5746
236 Ga0395898_0007674 3300037466 Bacteria 11457
237 Ga0395898_0091473 3300037466 Bacteria 2927
238 Ga0395898_0278551 3300037466 Bacteria 1595
239 Ga0395905_0000125 3300037471 Bacteria 126341
240 Ga0395905_0000416 3300037471 Bacteria 59735
241 Ga0395905_0007591 3300037471 Bacteria 10771
242 Ga0395905_0009918 3300037471 Bacteria 9281
243 Ga0395905_0020560 3300037471 Bacteria 6251
244 Ga0395905_0031904 3300037471 Bacteria 4956
245 Ga0395905_0254524 3300037471 Bacteria 1640
246 Ga0395901_0018634 3300038443 Bacteria 7090
247 Ga0395901_0055980 3300038443 Bacteria 4102
248 Ga0395901_0255411 3300038443 Bacteria 1825
249 Ga0436365_0747618 3300039437 Bacteria 3039
250 Ga0436365_1447051 3300039437 Bacteria 3501
251 Ga0436361_0020532 3300039447 Bacteria 44080
252 Ga0436363_0819344 3300039450 Bacteria 1703
253 Ga0451577_0024198 3300042876 Bacteria 5526
254 Ga0466972_0048884 3300044658 Bacteria 2043
255 Ga0466961_0009040 3300044693 Bacteria 6356
256 Ga0466960_0035279 3300044901 Bacteria 2336
257 Ga0466959_0027111 3300045049 Bacteria 4250
258 Ga0451576_0018208 3300045051 Bacteria 7703
259 Ga0495590_0051331 3300046457 Bacteria 1440
260 Ga0495638_0005541 3300046460 Bacteria 9363
261 Ga0495638_0014168 3300046460 Bacteria 5398
262 Ga0495653_0001126 3300046463 Bacteria 20584
263 Ga0495650_0031359 3300046471 Bacteria 2393
264 Ga0495605_0016099 3300046474 Bacteria 4053
265 Ga0495584_0067998 3300046491 Bacteria 1790
266 Ga0495596_0001347 3300046500 Bacteria 14148
267 Ga0495607_0014802 3300046501 Bacteria 5070
268 Ga0495583_0035836 3300046506 Bacteria 2364
269 Ga0495610_0000606 3300046512 Bacteria 35491
270 Ga0495628_0017471 3300046516 Bacteria 5972
271 Ga0495630_0042411 3300046517 Bacteria 3398
272 Ga0495631_0024869 3300046518 Bacteria 2762
273 Ga0495632_0022482 3300046519 Bacteria 3379
274 Ga0495643_0015489 3300046522 Bacteria 4504
275 Ga0495644_0010584 3300046523 Bacteria 3555
276 Ga0495642_0027970 3300046528 Bacteria 2244
277 Ga0495652_0033671 3300046529 Bacteria 4470
278 Ga0495665_0000129 3300046531 Bacteria 35958
279 Ga0495597_0020095 3300046542 Bacteria 3117
280 Ga0495625_0037581 3300046660 Bacteria 3551
281 Ga0495635_0132621 3300046663 Bacteria 1698
282 Ga0495623_0000532 3300046679 Bacteria 25236
283 Ga0495646_0001049 3300046680 Bacteria 15999
284 Ga0495669_0012680 3300046684 Bacteria 3590
285 Ga0495624_0005811 3300046690 Bacteria 8834
286 Ga0495649_0001374 3300046694 Bacteria 18436
287 Ga0495649_0046475 3300046694 Bacteria 2364
288 Ga0495660_0009091 3300046810 Bacteria 5802
289 Ga0495604_0023149 3300047317 Bacteria 4957
290 Ga0495674_0003652 3300047319 Bacteria 14972
291 Ga0495683_0000389 3300047323 Bacteria 35668
292 Ga0495687_000005 3300047443 Bacteria 610401
293 Ga0495687_000863 3300047443 Bacteria 32127
294 Ga0495687_045955 3300047443 Bacteria 1888
295 Ga0495593_0000030 3300047673 Bacteria 59166
296 Ga0495593_0015507 3300047673 Bacteria 4315
297 Ga0495602_0004335 3300048088 Bacteria 14784
298 Ga0495602_0011728 3300048088 Bacteria 9053
299 Ga0495614_0045105 3300048089 Bacteria 1891
300 Ga0495626_0001397 3300048091 Bacteria 19346
301 Ga0495626_0024344 3300048091 Bacteria 2969
302 Ga0496100_0008747 3300048903 Bacteria 5658
303 Ga0496102_0089899 3300048905 Bacteria 2841
304 Ga0496105_0069162 3300048908 Bacteria 2918
305 Ga0496106_0012135 3300048909 Bacteria 6359
306 Ga0496106_0112177 3300048909 Bacteria 2124
307 Ga0496107_0001819 3300048910 Bacteria 13446
308 Ga0496107_0191982 3300048910 Bacteria 1518
309 Ga0496108_0038710 3300048911 Bacteria 3973
310 Ga0496110_0013402 3300048913 Bacteria 6776
311 Ga0496111_0000967 3300048914 Bacteria 15693
312 Ga0496111_0018750 3300048914 Bacteria 4796
313 Ga0496111_0059669 3300048914 Bacteria 2764
314 Ga0496112_0006420 3300048915 Bacteria 10320
315 Ga0496113_0005063 3300048916 Bacteria 8180
316 Ga0496114_0020520 3300048917 Bacteria 5363
317 Ga0496114_0083051 3300048917 Bacteria 2709
318 Ga0496115_0007179 3300048918 Bacteria 8183
319 Ga0496118_0012699 3300048921 Bacteria 8055
320 Ga0496119_0015972 3300048922 Bacteria 5743
321 Ga0496120_0000486 3300048923 Bacteria 62060
322 Ga0496121_0008612 3300048924 Bacteria 11944
323 Ga0496121_0069207 3300048924 Bacteria 2850
324 Ga0496122_0001620 3300048925 Bacteria 35178
325 Ga0496122_0098285 3300048925 Bacteria 1966
326 Ga0496123_0001243 3300048926 Bacteria 36926
327 Ga0496123_0043114 3300048926 Bacteria 3103
328 Ga0496124_0012886 3300048927 Bacteria 8209
329 Ga0496125_0021907 3300048928 Bacteria 5945
330 Ga0496125_0024687 3300048928 Bacteria 5520
331 Ga0496125_0031734 3300048928 Bacteria 4703
332 Ga0496126_0039283 3300048929 Bacteria 4392
333 Ga0501031_0000008 3300049568 Bacteria 156304
334 Ga0501032_0000018 3300049569 Bacteria 156275
335 Ga0501033_0000032 3300049570 Bacteria 156304
336 Ga0501034_0000103 3300049571 Bacteria 156304
337 Ga0501034_0090886 3300049571 Bacteria 3050
338 Ga0501036_0000012 3300049572 Bacteria 156304
339 Ga0501036_0183402 3300049572 Bacteria 1762
340 Ga0501037_0000018 3300049573 Bacteria 156304
341 Ga0501038_0000017 3300049574 Bacteria 156304
342 Ga0501039_0000024 3300049575 Bacteria 156304
343 Ga0501040_0002383 3300049576 Bacteria 12080
344 Ga0501043_0000594 3300049579 Bacteria 32093
345 Ga0501043_0074987 3300049579 Bacteria 2657
346 Ga0501047_0000117 3300049581 Bacteria 96579
347 Ga0501047_0014824 3300049581 Bacteria 7420
348 Ga0501080_0106458 3300049742 Bacteria 2599
349 Ga0501035_0000040 3300049822 Bacteria 156262
350 Ga0501035_0021499 3300049822 Bacteria 5931
351 Ga0501044_0000040 3300049823 Bacteria 156304
352 Ga0501044_0034853 3300049823 Bacteria 5275
353 nmdc:mga03n38_32726_c1 3300050490 Bacteria 1574
354 nmdc:mga0yw44_115_c1 3300050492 Bacteria 24900
355 nmdc:mga0yw44_54306_c1 3300050492 Bacteria 2434
356 nmdc:mga0k408_28322_c1 3300050493 Bacteria 3185
357 nmdc:mga06z11_5114_c1 3300050494 Bacteria 5229
358 nmdc:mga07m45_1947_c1 3300050496 Bacteria 9555
359 nmdc:mga0sz30_20510_c1 3300050516 Bacteria 2667
360 Ga0500643_000546 3300053087 Bacteria 26277
361 Ga0500643_003499 3300053087 Bacteria 7532
362 Ga0500643_018224 3300053087 Bacteria 2333
363 Ga0500562_002072 3300053108 Bacteria 5008
364 Ga0500607_005253 3300053121 Bacteria 8518
365 Ga0500608_000035 3300053122 Bacteria 62662
366 Ga0500608_008263 3300053122 Bacteria 4365
367 Ga0500559_0002765 3300053136 Bacteria 8897
368 Ga0500568_0005290 3300053139 Bacteria 6705
369 Ga0500577_0003351 3300053142 Bacteria 4157
370 Ga0500586_001654 3300053145 Bacteria 4794
371 Ga0500616_0000402 3300053153 Bacteria 59210
372 Ga0500620_000972 3300053155 Bacteria 5004
373 Ga0500622_0001249 3300053156 Bacteria 20782
374 Ga0500622_0003374 3300053156 Bacteria 10748
375 Ga0500636_0010859 3300053177 Bacteria 5321
376 Ga0466962_0034033 3300061719 Bacteria 2438
377 2509142364 2508501127 Bacteria 7037543
378 2511127311 2510917021 Bacteria 5705459
379 2511168313 2510917026 Bacteria 7046020
380 2513608878 2513237090 Bacteria 7096802
381 2514417354 2513237305 Bacteria 7293571
382 2519462079 2519103095 Bacteria 6629912
383 2585290956 2582581311 Bacteria 6763856
384 2585997290 2585427633 Bacteria 6413184
385 2586001899 2585427634 Bacteria 6455027
386 2596374487 2595698237 Bacteria 6712432
387 2597810962 2597489875 Bacteria 7010078
388 2599605677 2599185210 Bacteria 5624189
389 2599719972 2599185236 Bacteria 6875203
390 2599734535 2599185239 Bacteria 8686614
391 2599747903 2599185240 Bacteria 7968121
392 2599939756 2599185301 Bacteria 6161860
393 2600209946 2599185355 Bacteria 7968906
394 2643769928 2643221550 Bacteria 4619371
395 2643867642 2643221570 Bacteria 5103772
396 2643990560 2643221596 Bacteria 5006805
397 2644070503 2643221611 Bacteria 6820941
398 2644294922 2643221652 Bacteria 5140275
399 2644648908 2643221717 Bacteria 5676132
400 2676741374 2675903129 Bacteria 7964495
401 2688597074 2687453392 Bacteria 6880454
402 2694628904 2693429783 Bacteria 7019804
403 2694637183 2693429784 Bacteria 7241525
404 2723574234 2721755686 Bacteria 7343952
405 2738747054 2738541281 Bacteria 5112672
406 2739612365 2739367655 Bacteria 4051151
407 2746084725 2744054900 Bacteria 8399525
408 2746093068 2744054901 Bacteria 8397047
409 2753767721 2751185897 Bacteria 5322941
410 2817258200 2816332253 Bacteria 6764532
411 2817281386 2816332256 Bacteria 6891714
412 2817451936 2816332286 Bacteria 6853759
413 2819634339 2818991452 Bacteria 8442785
414 2841737571 2841734538 Bacteria 6784580
415 2841917229 2841911363 Bacteria 6173697
416 2841922850 2841917233 Bacteria 6173500
417 2847674822 2847670302 Bacteria 6165597
418 2854897412 2854896431 Bacteria 5869725
419 2854921454 2854916844 Bacteria 5725939
420 2856289702 2856287931 Bacteria 7223934
421 2856317293 2856314179 Bacteria 6477897
422 2856322921 2856320880 Bacteria 7263508
423 2856345930 2856342000 Bacteria 7176905
424 2856353352 2856349417 Bacteria 6230045
425 2856360984 2856356410 Bacteria 6297484
426 2857352152 2857349434 Bacteria 7926032
427 2857364434 2857357740 Bacteria 9937880
428 2857508967 2857504554 Bacteria 5369913
429 2863426843 2863421361 Bacteria 7300805
430 2869168618 2869162929 Bacteria 6399702
431 2869172078 2869169390 Bacteria 6659796
432 2869235229 2869234852 Bacteria 6654993
433 2869256170 2869249662 Bacteria 6868783
434 2869257754 2869256925 Bacteria 6981691
435 2869268563 2869264136 Bacteria 6880765
436 2869282473 2869278585 Bacteria 7077053
437 2869287625 2869285874 Bacteria 6901219
438 2870075152 2870068957 Bacteria 8925310
439 2871435573 2871429161 Bacteria 6547891
440 2871443639 2871435913 Bacteria 6880295
441 2871457798 2871451962 Bacteria 7336357
442 2871460154 2871459585 Bacteria 6866887
443 2871474488 2871474448 Bacteria 6806570
444 2871484109 2871481445 Bacteria 6700002
445 2871493395 2871488783 Bacteria 6929816
446 2871496439 2871495908 Bacteria 6935695
447 2874115510 2874109183 Bacteria 6517025
448 2874126778 2874123672 Bacteria 7238285
449 2874134410 2874131515 Bacteria 6820270
450 2874142128 2874139085 Bacteria 7021506
451 2874151256 2874146452 Bacteria 7533118
452 2874158890 2874155637 Bacteria 6724144
453 2876381330 2876377896 Bacteria 6565995
454 2876392017 2876386047 Bacteria 6698674
455 2876397821 2876392853 Bacteria 6660880
456 2876417309 2876413966 Bacteria 6831344
457 2878038331 2878035449 Bacteria 6555736
458 2878744688 2878738818 Bacteria 7136951
459 2878749136 2878745973 Bacteria 6867388
460 2878757439 2878753008 Bacteria 6922523
461 2878760667 2878760144 Bacteria 6823465
462 2878767708 2878767105 Bacteria 6898628
463 2878781695 2878781027 Bacteria 6834456
464 2878795943 2878788777 Bacteria 6567085
465 2881149703 2881147464 Bacteria 7779814
466 2881160895 2881155292 Bacteria 6461656
467 2881166584 2881161766 Bacteria 7127907
468 2881846699 2881845957 Bacteria 6611900
469 2881856193 2881853255 Bacteria 6698367
470 2881862655 2881861095 Bacteria 7128710
471 2882639509 2882632389 Bacteria 8154593
472 2882913013 2882912400 Bacteria 6801539
473 2884961734 2884960567 Bacteria 5437054
474 2885308062 2885305155 Bacteria 7348390
475 2885313026 2885312484 Bacteria 6415165
476 2885333659 2885326080 Bacteria 7134805
477 2885334593 2885334103 Bacteria 7216818
478 2885345705 2885342637 Bacteria 7011821
479 2885352423 2885350715 Bacteria 6787678
480 2888338154 2888337043 Bacteria 6629336
481 2888345491 2888343758 Bacteria 6611049
482 2888354795 2888350351 Bacteria 7372807
483 2889016414 2889010040 Bacteria 6749192
484 2889018561 2889016732 Bacteria 6700763
485 2889310454 2889306138 Bacteria 6358934
486 2894026609 2894023352 Bacteria 5167372
487 2902335059 2902330777 Bacteria 6395352
488 2902405868 2902405164 Bacteria 6784948
489 2903498600 2903492973 Bacteria 13473544
490 2903501167 2903492973 Bacteria 13473544
491 2903541233 2903540706 Bacteria 7062119
492 2904570527 2904564687 Bacteria 7609577
493 2904577704 2904571731 Bacteria 7608790
494 2904664472 2904659560 Bacteria 6685615
495 2906310174 2906308376 Bacteria 6841989
496 2906324239 2906321335 Bacteria 6579571
497 2906357145 2906354277 Bacteria 6991324
498 2906370236 2906363423 Bacteria 6856682
499 2906372155 2906370794 Bacteria 6881062
500 2906395294 2906393657 Bacteria 6790866
501 2906403416 2906401398 Bacteria 6693206
502 2906417356 2906414383 Bacteria 6580790
503 2919173586 2919171160 Bacteria 6499771
504 2920828901 2920822456 Bacteria 6897201
505 2922131827 2922130491 Bacteria 7173936
506 2922154051 2922151315 Bacteria 6902399
507 2924711124 2924710171 Bacteria 6752351
508 2924747437 2924741084 Bacteria 6661321
509 2924765214 2924762789 Bacteria 6561353
510 2924782719 2924776078 Bacteria 7492003
511 2924786735 2924784321 Bacteria 7416538
512 2928125217 2928125067 Bacteria 5937560
513 2928158942 2928157003 Bacteria 7522202
514 2928167763 2928163908 Bacteria 7561269
515 2928177435 2928170801 Bacteria 8785406
516 2928541905 2928536128 Bacteria 7657547
517 2937816998 2937813078 Bacteria 7783518
518 2937840194 2937836603 Bacteria 6811263
519 2937847341 2937843397 Bacteria 5256375
520 2937881361 2937877337 Bacteria 7246526
521 2937977453 2937972304 Bacteria 7532020
522 2937986696 2937980651 Bacteria 6517427
523 2937995089 2937994558 Bacteria 7036190
524 2958039255 2958034702 Bacteria 6989922
525 2958053115 2958041894 Bacteria 13082850
526 2958075276 2958071322 Bacteria 6815895
527 2958088082 2958084443 Bacteria 7312792
528 2958107125 2958100919 Bacteria 6800575
529 2958113741 2958108152 Bacteria 6681128
530 2958132027 2958130278 Bacteria 6897202
531 2958165646 2958165035 Bacteria 6906348
532 2958177898 2958172287 Bacteria 6716688
533 2958181841 2958179912 Bacteria 6874908
534 2961079685 2961077736 Bacteria 7079850
535 2961119471 2961114664 Bacteria 6680456
536 2961129290 2961127735 Bacteria 7196641
537 2961164105 2961163497 Bacteria 6901077
538 2961175232 2961170736 Bacteria 7072258
539 2961190440 2961183825 Bacteria 6688536
540 2965018829 2965018300 Bacteria 6883036
541 2965091726 2965089291 Bacteria 6866420
542 2965127441 2965119406 Bacteria 6956431
543 2967999766 2967996073 Bacteria 6787468
544 2968008124 2968003550 Bacteria 6929263
545 2968020580 2968016561 Bacteria 7022047
546 2968115726 2968110612 Bacteria 6814636
547 2968119085 2968117919 Bacteria 6536078
548 2968145161 2968138860 Bacteria 6605449
549 2968172508 2968171901 Bacteria 6894245
550 2970473877 2970469710 Bacteria 6969209
551 2970507820 2970503327 Bacteria 7099517
552 2970527207 2970524798 Bacteria 6840927
553 2970537292 2970532167 Bacteria 6553173
554 2970544133 2970540015 Bacteria 6977556
555 2970555520 2970554993 Bacteria 6814252
556 2970597082 2970593180 Bacteria 7073582
557 2970634079 2970627176 Bacteria 6680862
558 2977826598 2977821940 Bacteria 6906439
559 2977847289 2977843712 Bacteria 6753583
560 2977864982 2977864932 Bacteria 7534097
561 2977945109 2977942078 Bacteria 7570577
562 2977956019 2977950692 Bacteria 6893264
563 2979715291 2979710463 Bacteria 6785254
564 2979744989 2979742915 Bacteria 7301278
565 2979778312 2979772303 Bacteria 6618277
566 2979800779 2979793036 Bacteria 6808957
567 2979813004 2979808191 Bacteria 7179355
568 2981992328 2981990288 Bacteria 7590678
569 2987639336 2987636660 Bacteria 8088555
570 2987656467 2987652177 Bacteria 6969023
571 2987660113 2987659509 Bacteria 6966464
572 2987669671 2987666974 Bacteria 6509233
573 2987676947 2987673487 Bacteria 6884027
574 2989774247 2989771324 Bacteria 5605128
575 2990713046 2990710928 Bacteria 5002431
576 2996314494 2996310559 Bacteria 6357320
577 2996352802 2996348954 Bacteria 7239054
578 2996387290 2996386984 Bacteria 6978667
579 3003667939 3003665799 Bacteria 7279786
580 3004189161 3004188549 Bacteria 6952365
581 3004199217 3004195979 Bacteria 6776956
582 3004204420 3004203850 Bacteria 7307914
583 3004239765 3004232784 Bacteria 6662140
584 3004250127 3004248173 Bacteria 6563236
585 3004279484 3004275668 Bacteria 7114440
586 642415960 641736154 Bacteria 7689995
587 649871630 649633066 Bacteria 6690028
588 8004317222 8004312739 Bacteria 7444653
589 8004368042 8004361976 Bacteria 6858373
590 8004379014 8004374579 Bacteria 6898112
591 8004389410 8004387939 Bacteria 7049250
592 8004639717 8004633249 Bacteria 6723080
593 8004643387 8004640170 Bacteria 6723001
594 8004717808 8004714634 Bacteria 6776161
595 8018846717 8018845410 Bacteria 8933938
596 8020813526 8020807995 Bacteria 6801506
597 8020941719 8020938398 Bacteria 7472757
598 8020949095 8020945358 Bacteria 8467355
599 8020958806 8020953355 Bacteria 7439080
600 8021121570 8021120328 Bacteria 8782274
601 8040179085 8040173305 Bacteria 6827067
602 8054464218 8054460903 Bacteria 4872905
603 8055619287 8055617313 Bacteria 7548464
604 Ga0495615_0000024
605 SwRhRL2b_contig_2580795
606 JGI24735J21928_10000068
607 JGI25156J39149_1006803
608 JGI25165J46597_1000034
609 Ga0055532_1000778
610 Ga0055527_1000358
611 Ga0055527_1001221
612 Ga0055535_1000842
613 Ga0055535_1002338
614 Ga0055542_1001458
615 Ga0055529_1000639
616 Ga0055536_1000039
617 Ga0055528_1001235
618 Ga0055530_10003479
619 Ga0055530_10016443
620 Ga0055531_10000136
621 Ga0065704_10070331
622 Ga0070658_10202610
623 Ga0070683_100012578
624 Ga0070690_100033524
625 Ga0070670_100035619
626 Ga0070670_100059201
627 Ga0068869_100001012
628 Ga0068869_100013944
629 Ga0070666_10004577
630 Ga0070666_10020753
631 Ga0068868_100000575
632 Ga0068868_100008079
633 Ga0068868_100061091
634 Ga0070660_100000171
635 Ga0070689_100104504
636 Ga0070661_100008798
637 Ga0070661_100054582
638 Ga0070668_100050970
639 Ga0070669_100006001
640 Ga0070675_100005239
641 Ga0070671_100132593
642 Ga0070673_100007729
643 Ga0070659_100000028
644 Ga0070659_100004422
645 Ga0070659_100074692
646 Ga0070667_100000975
647 Ga0070667_100043848
648 Ga0070667_100058191
649 Ga0070701_10014212
650 Ga0070700_100135936
651 Ga0070663_100002297
652 Ga0070663_100028001
653 Ga0070663_100124549
654 Ga0070662_100011608
655 Ga0070684_100025981
656 Ga0068853_100012253
657 Ga0068853_100043536
658 Ga0068853_100223471
659 Ga0070672_100094473
660 Ga0070665_100000162
661 Ga0070665_100104975
662 Ga0068855_100010912
663 Ga0068855_100081416
664 Ga0068855_100204683
665 Ga0070664_100046601
666 Ga0068854_100003737
667 Ga0068856_100062762
668 Ga0068856_100116054
669 Ga0068852_100006709
670 Ga0068852_100025581
671 Ga0068852_100026355
672 Ga0068859_100000918
673 Ga0068859_100013476
674 Ga0068864_100007688
675 Ga0068861_100002482
676 Ga0068851_10020532
677 Ga0068863_100007075
678 Ga0068858_100003339
679 Ga0068860_100135935
680 Ga0068862_100075311
681 Ga0075365_10000225
682 Ga0075365_10026681
683 Ga0075365_10052256
684 Ga0075362_10000769
685 Ga0075362_10009821
686 Ga0075367_10002438
687 Ga0075367_10006041
688 Ga0075369_10009658
689 Ga0075369_10025470
690 Ga0097621_100022941
691 Ga0075370_10012307
692 Ga0068871_100013316
693 Ga0097620_100000918
694 Ga0097620_100013476
695 Ga0099794_10009853
696 Ga0105251_10000257
697 Ga0105250_10011018
698 Ga0105240_10005221
699 Ga0105240_10030666
700 Ga0105241_10048283
701 Ga0105248_10006934
702 Ga0105248_10011984
703 Ga0105248_10014152
704 Ga0105237_10066305
705 Ga0105238_10048047
706 Ga0105238_10071394
707 Ga0105239_10011230
708 Ga0105239_10023220
709 Ga0105239_10166158
710 Ga0157373_10008521
711 Ga0157369_10034668
712 Ga0157369_10056912
713 Ga0157374_10047092
714 Ga0163162_10012231
715 Ga0157375_10068394
716 Ga0163163_10003966
717 Ga0163163_10009511
718 Ga0157377_10003948
719 Ga0157379_10039284
720 Ga0157379_10110540
721 Ga0157376_10003290
722 Ga0182005_1000439
723 Ga0213872_10001399
724 Ga0209566_100608
725 Ga0209672_100042
726 Ga0209672_100131
727 Ga0209147_100012
728 Ga0209147_100046
729 Ga0209147_100052
730 Ga0209258_100030
731 Ga0209258_100073
732 Ga0209026_1000100
733 Ga0209148_1000022
734 Ga0209148_1000524
735 Ga0209759_1001671
736 Ga0209233_1000028
737 Ga0209455_1000024
738 Ga0209455_1000505
739 Ga0209673_1000021
740 Ga0209676_1000094
741 Ga0209025_1015439
742 Ga0209025_1053687
743 Ga0209758_1000105
744 Ga0209758_1009093
745 Ga0209758_1014174
746 Ga0209050_1000205
747 Ga0209050_1025073
748 Ga0209051_1001739
749 Ga0209257_1000110
750 Ga0207656_10004800
751 Ga0207656_10006570
752 Ga0207713_1004373
753 Ga0207680_10020131
754 Ga0207647_10020004
755 Ga0207647_10020851
756 Ga0207647_10028806
757 Ga0207647_10046544
758 Ga0207705_10013177
759 Ga0207695_10003099
760 Ga0207695_10026702
761 Ga0207671_10065556
762 Ga0207660_10033624
763 Ga0207660_10096312
764 Ga0207662_10086520
765 Ga0207657_10000111
766 Ga0207649_10004556
767 Ga0207649_10053516
768 Ga0207694_10029712
769 Ga0207694_10129173
770 Ga0207650_10001979
771 Ga0207659_10016156
772 Ga0207644_10109672
773 Ga0207690_10000009
774 Ga0207690_10003621
775 Ga0207706_10004906
776 Ga0207706_10037163
777 Ga0207706_10163621
778 Ga0207709_10041258
779 Ga0207704_10093964
780 Ga0207691_10057171
781 Ga0207711_10013077
782 Ga0207711_10025423
783 Ga0207689_10024074
784 Ga0207679_10010326
785 Ga0207667_10034927
786 Ga0207667_10292288
787 Ga0207651_10052008
788 Ga0207640_10020259
789 Ga0207658_10002242
790 Ga0207658_10029501
791 Ga0207658_10041889
792 Ga0207677_10000913
793 Ga0207677_10021007
794 Ga0207677_10037205
795 Ga0207703_10002088
796 Ga0207639_10030297
797 Ga0207639_10051220
798 Ga0207678_10000347
799 Ga0207678_10003791
800 Ga0207678_10025794
801 Ga0207708_10131295
802 Ga0207702_10046029
803 Ga0207702_10067251
804 Ga0207641_10005859
805 Ga0207676_10002408
806 Ga0207676_10005004
807 Ga0207676_10185751
808 Ga0207674_10007706
809 Ga0207674_10032056
810 Ga0207674_10103884
811 Ga0207674_10127863
812 Ga0207675_100007717
813 Ga0207675_100009173
814 Ga0209371_1000881
815 Ga0268266_10001790
816 Ga0307517_10038602
817 Ga0307517_10056215
818 Ga0307517_10099452
819 Ga0307515_10106102
820 Ga0265338_10006380
821 Ga0265338_10015723
822 Ga0268256_1000741
823 Ga0307511_10009968
824 Ga0307513_10155060
825 Ga0307509_10019199
826 Ga0307408_100027310
827 Ga0307508_10136012
828 Ga0265314_10000879
829 Ga0265342_10008727
830 Ga0316576_10109348
831 Ga0307412_10047569
832 Ga0307414_10004001
833 Ga0307510_10002541
834 Ga0373955_0093223
835 Ga0373935_0004695
836 Ga0395899_0003020
837 Ga0395900_0025881
838 Ga0395900_0028249
839 Ga0395898_0007674
840 Ga0395898_0091473
841 Ga0395898_0278551
842 Ga0395905_0000125
843 Ga0395905_0000416
844 Ga0395905_0007591
845 Ga0395905_0009918
846 Ga0395905_0020560
847 Ga0395905_0031904
848 Ga0395905_0254524
849 Ga0395901_0018634
850 Ga0395901_0055980
851 Ga0395901_0255411
852 Ga0436365_0747618
853 Ga0436365_1447051
854 Ga0436361_0020532
855 Ga0436363_0819344
856 Ga0451577_0024198
857 Ga0466972_0048884
858 Ga0466961_0009040
859 Ga0466960_0035279
860 Ga0466959_0027111
861 Ga0451576_0018208
862 Ga0495590_0051331
863 Ga0495638_0005541
864 Ga0495638_0014168
865 Ga0495653_0001126
866 Ga0495650_0031359
867 Ga0495605_0016099
868 Ga0495584_0067998
869 Ga0495596_0001347
870 Ga0495607_0014802
871 Ga0495583_0035836
872 Ga0495610_0000606
873 Ga0495628_0017471
874 Ga0495630_0042411
875 Ga0495631_0024869
876 Ga0495632_0022482
877 Ga0495643_0015489
878 Ga0495644_0010584
879 Ga0495642_0027970
880 Ga0495652_0033671
881 Ga0495665_0000129
882 Ga0495597_0020095
883 Ga0495625_0037581
884 Ga0495635_0132621
885 Ga0495623_0000532
886 Ga0495646_0001049
887 Ga0495669_0012680
888 Ga0495624_0005811
889 Ga0495649_0001374
890 Ga0495649_0046475
891 Ga0495660_0009091
892 Ga0495604_0023149
893 Ga0495674_0003652
894 Ga0495683_0000389
895 Ga0495687_000005
896 Ga0495687_000863
897 Ga0495687_045955
898 Ga0495593_0000030
899 Ga0495593_0015507
900 Ga0495602_0004335
901 Ga0495602_0011728
902 Ga0495614_0045105
903 Ga0495626_0001397
904 Ga0495626_0024344
905 Ga0496100_0008747
906 Ga0496102_0089899
907 Ga0496105_0069162
908 Ga0496106_0012135
909 Ga0496106_0112177
910 Ga0496107_0001819
911 Ga0496107_0191982
912 Ga0496108_0038710
913 Ga0496110_0013402
914 Ga0496111_0000967
915 Ga0496111_0018750
916 Ga0496111_0059669
917 Ga0496112_0006420
918 Ga0496113_0005063
919 Ga0496114_0020520
920 Ga0496114_0083051
921 Ga0496115_0007179
922 Ga0496118_0012699
923 Ga0496119_0015972
924 Ga0496120_0000486
925 Ga0496121_0008612
926 Ga0496121_0069207
927 Ga0496122_0001620
928 Ga0496122_0098285
929 Ga0496123_0001243
930 Ga0496123_0043114
931 Ga0496124_0012886
932 Ga0496125_0021907
933 Ga0496125_0024687
934 Ga0496125_0031734
935 Ga0496126_0039283
936 Ga0501031_0000008
937 Ga0501032_0000018
938 Ga0501033_0000032
939 Ga0501034_0000103
940 Ga0501034_0090886
941 Ga0501036_0000012
942 Ga0501036_0183402
943 Ga0501037_0000018
944 Ga0501038_0000017
945 Ga0501039_0000024
946 Ga0501040_0002383
947 Ga0501043_0000594
948 Ga0501043_0074987
949 Ga0501047_0000117
950 Ga0501047_0014824
951 Ga0501080_0106458
952 Ga0501035_0000040
953 Ga0501035_0021499
954 Ga0501044_0000040
955 Ga0501044_0034853
956 nmdc:mga03n38_32726_c1
957 nmdc:mga0yw44_115_c1
958 nmdc:mga0yw44_54306_c1
959 nmdc:mga0k408_28322_c1
960 nmdc:mga06z11_5114_c1
961 nmdc:mga07m45_1947_c1
962 nmdc:mga0sz30_20510_c1
963 Ga0500643_000546
964 Ga0500643_003499
965 Ga0500643_018224
966 Ga0500562_002072
967 Ga0500607_005253
968 Ga0500608_000035
969 Ga0500608_008263
970 Ga0500559_0002765
971 Ga0500568_0005290
972 Ga0500577_0003351
973 Ga0500586_001654
974 Ga0500616_0000402
975 Ga0500620_000972
976 Ga0500622_0001249
977 Ga0500622_0003374
978 Ga0500636_0010859
979 Ga0466962_0034033
980 2509142364
981 2511127311
982 2511168313
983 2513608878
984 2514417354
985 2519462079
986 2585290956
987 2585997290
988 2586001899
989 2596374487
990 2597810962
991 2599605677
992 2599719972
993 2599734535
994 2599747903
995 2599939756
996 2600209946
997 2643769928
998 2643867642
999 2643990560
1000 2644070503
1001 2644294922
1002 2644648908
1003 2676741374
1004 2688597074
1005 2694628904
1006 2694637183
1007 2723574234
1008 2738747054
1009 2739612365
1010 2746084725
1011 2746093068
1012 2753767721
1013 2817258200
1014 2817281386
1015 2817451936
1016 2819634339
1017 2841737571
1018 2841917229
1019 2841922850
1020 2847674822
1021 2854897412
1022 2854921454
1023 2856289702
1024 2856317293
1025 2856322921
1026 2856345930
1027 2856353352
1028 2856360984
1029 2857352152
1030 2857364434
1031 2857508967
1032 2863426843
1033 2869168618
1034 2869172078
1035 2869235229
1036 2869256170
1037 2869257754
1038 2869268563
1039 2869282473
1040 2869287625
1041 2870075152
1042 2871435573
1043 2871443639
1044 2871457798
1045 2871460154
1046 2871474488
1047 2871484109
1048 2871493395
1049 2871496439
1050 2874115510
1051 2874126778
1052 2874134410
1053 2874142128
1054 2874151256
1055 2874158890
1056 2876381330
1057 2876392017
1058 2876397821
1059 2876417309
1060 2878038331
1061 2878744688
1062 2878749136
1063 2878757439
1064 2878760667
1065 2878767708
1066 2878781695
1067 2878795943
1068 2881149703
1069 2881160895
1070 2881166584
1071 2881846699
1072 2881856193
1073 2881862655
1074 2882639509
1075 2882913013
1076 2884961734
1077 2885308062
1078 2885313026
1079 2885333659
1080 2885334593
1081 2885345705
1082 2885352423
1083 2888338154
1084 2888345491
1085 2888354795
1086 2889016414
1087 2889018561
1088 2889310454
1089 2894026609
1090 2902335059
1091 2902405868
1092 2903498600
1093 2903501167
1094 2903541233
1095 2904570527
1096 2904577704
1097 2904664472
1098 2906310174
1099 2906324239
1100 2906357145
1101 2906370236
1102 2906372155
1103 2906395294
1104 2906403416
1105 2906417356
1106 2919173586
1107 2920828901
1108 2922131827
1109 2922154051
1110 2924711124
1111 2924747437
1112 2924765214
1113 2924782719
1114 2924786735
1115 2928125217
1116 2928158942
1117 2928167763
1118 2928177435
1119 2928541905
1120 2937816998
1121 2937840194
1122 2937847341
1123 2937881361
1124 2937977453
1125 2937986696
1126 2937995089
1127 2958039255
1128 2958053115
1129 2958075276
1130 2958088082
1131 2958107125
1132 2958113741
1133 2958132027
1134 2958165646
1135 2958177898
1136 2958181841
1137 2961079685
1138 2961119471
1139 2961129290
1140 2961164105
1141 2961175232
1142 2961190440
1143 2965018829
1144 2965091726
1145 2965127441
1146 2967999766
1147 2968008124
1148 2968020580
1149 2968115726
1150 2968119085
1151 2968145161
1152 2968172508
1153 2970473877
1154 2970507820
1155 2970527207
1156 2970537292
1157 2970544133
1158 2970555520
1159 2970597082
1160 2970634079
1161 2977826598
1162 2977847289
1163 2977864982
1164 2977945109
1165 2977956019
1166 2979715291
1167 2979744989
1168 2979778312
1169 2979800779
1170 2979813004
1171 2981992328
1172 2987639336
1173 2987656467
1174 2987660113
1175 2987669671
1176 2987676947
1177 2989774247
1178 2990713046
1179 2996314494
1180 2996352802
1181 2996387290
1182 3003667939
1183 3004189161
1184 3004199217
1185 3004204420
1186 3004239765
1187 3004250127
1188 3004279484
1189 642415960
1190 649871630
1191 8004317222
1192 8004368042
1193 8004379014
1194 8004389410
1195 8004639717
1196 8004643387
1197 8004717808
1198 8018846717
1199 8020813526
1200 8020941719
1201 8020949095
1202 8020958806
1203 8021121570
1204 8040179085
1205 8054464218
1206 8055619287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01425

Amidase

Amidase

89

521

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yji-assembly1.cif.gz_A the crystal structure of a bacterial aryl acylamidase belonging to the amidase signature (as) enzymes family 0.9327 20 483
4yj6-assembly1.cif.gz_A the crystal structure of a bacterial aryl acylamidase belonging to the amidase signature (as) enzymes family 0.9316 20 483
1ocl-assembly1.cif.gz_A the crystal structure of malonamidase e2 complexed with malonate from bradyrhizobium japonicum 0.924 21 480
1obi-assembly1.cif.gz_B crystal structure of the g130a mutant of malonamidase e2 from bradyrhizobium japonicum 0.9212 21 480
1obl-assembly1.cif.gz_B crystal structure of the s133a mutant of malonamidase e2 complexed with malonate from bradyrhizobium japonicum 0.921 21 480
ID Description Score Start End Superfamily
1o9qA00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.918 21 480 3.90.1300.10
af_P9WQ93_21_468_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9157 22 480 3.90.1300.10
2dc0A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9094 21 479 3.90.1300.10
af_Q58560_2_434_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9083 38 480 3.90.1300.10
af_P9WQ93_21_468_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9079 22 480 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A1Y0EIZ4-F1-model_v4 Amidase (EC 3.5.1.4) 0.9863 21 492 GO:0004040
AF-A0A1I7DZQ0-F1-model_v4 Amidase 0.9827 21 180 GO:0003824
AF-A0A350T4D6-F1-model_v4 Amidase 0.982 42 292 GO:0003824
AF-A0A656JW49-F1-model_v4 Amidase 0.9802 21 209 GO:0003824
AF-A0A531K3K4-F1-model_v4 Amidase 0.977 26 198 GO:0012505

Map