F468262

General Info

Members Datasets Scaffolds Average Seq Length
603 248 593 37

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10418604|Ga0099794_104186042
Length 44
Sequence MTISTPGFNAITPVTPVAMEEGLRFAIREGGRTVGAGAVTKVLK

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
3 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
4 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
5 2831864461 Roseateles noduli HZ7 Isolate Nodule
6 2928163908 Burkholderia sp. 567 Isolate Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
10 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
11 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
12 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
17 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
18 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
19 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
20 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
21 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
22 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
23 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
24 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
25 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
26 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
27 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
28 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
29 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
30 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
31 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
32 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
33 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
34 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
35 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
36 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
37 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
38 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
39 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
40 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
41 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
42 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
43 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
46 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
47 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
50 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
51 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
52 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
53 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
54 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
55 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
56 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
57 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
58 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
59 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
60 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
61 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
62 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
63 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
64 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
65 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
66 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
67 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
68 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
69 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
70 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
71 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
72 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
73 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
74 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
75 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
76 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
77 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
78 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
81 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
82 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
94 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
138 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
196 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
197 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
198 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
204 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
205 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
229 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
230 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
231 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
232 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
233 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
234 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
235 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
236 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
237 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
240 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
241 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
248 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.35
Metatranscriptomes 1.99
Isolates 1.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.97
Nodule 0.33
Rhizoplane 7.63
Rhizosphere 80.76
Stem 0
Stem Tuber 0
Unclassified 5.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1011939 3300002705 Bacteria 1940
2 Ga0055533_1016828 3300003756 Bacteria 700
3 Ga0099794_10418604 3300007265 Bacteria 701
4 Ga0114129_10533155 3300009147 Bacteria 1529
5 Ga0163162_12054328 3300013306 Bacteria 655
6 Ga0207657_10023528 3300025919 Bacteria 5735
7 Ga0207644_10040701 3300025931 Bacteria 3285
8 Ga0207648_11625270 3300026089 Bacteria 607
9 Ga0316596_1206465 3300033541 Bacteria 547
10 Ga0373938_0195990 3300034957 Bacteria 558
11 Ga0373940_0189353 3300035088 Bacteria 672
12 Ga0373940_0269609 3300035088 Bacteria 579
13 Ga0373944_0044116 3300035089 Bacteria 1387
14 Ga0373944_0443041 3300035089 Bacteria 505
15 Ga0373949_0264638 3300035090 Bacteria 536
16 Ga0373951_0198162 3300035091 Bacteria 584
17 Ga0373952_0099132 3300035092 Bacteria 766
18 Ga0373923_0048793 3300035111 Bacteria 1768
19 Ga0373936_0043369 3300035113 Bacteria 1808
20 Ga0373939_0198657 3300035114 Bacteria 757
21 Ga0373945_0041920 3300035116 Bacteria 1657
22 Ga0373954_0000068 3300035118 Bacteria 37051
23 Ga0373954_0147224 3300035118 Bacteria 1150
24 Ga0373956_0040679 3300035119 Bacteria 2062
25 Ga0373943_0117949 3300035170 Bacteria 1407
26 Ga0373943_0659570 3300035170 Bacteria 618
27 Ga0373946_0016753 3300035171 Bacteria 2795
28 Ga0373955_0019792 3300035172 Bacteria 3370
29 Ga0373942_0130145 3300035207 Bacteria 793
30 Ga0373942_0136684 3300035207 Bacteria 777
31 Ga0373942_0301715 3300035207 Bacteria 556
32 Ga0373962_0179943 3300035242 Bacteria 706
33 Ga0316574_0005225 3300035398 Bacteria 6904
34 Ga0316574_0032769 3300035398 Bacteria 3159
35 Ga0316574_0082950 3300035398 Bacteria 2037
36 Ga0316574_0083869 3300035398 Bacteria 2026
37 Ga0316574_0086535 3300035398 Bacteria 1994
38 Ga0316574_0166266 3300035398 Bacteria 1421
39 Ga0316574_0202389 3300035398 Bacteria 1275
40 Ga0316574_0237188 3300035398 Bacteria 1166
41 Ga0316574_0314009 3300035398 Bacteria 995
42 Ga0316574_0580986 3300035398 Bacteria 693
43 Ga0316574_0599950 3300035398 Bacteria 680
44 Ga0373924_0555756 3300035410 Bacteria 517
45 Ga0373935_0116104 3300035692 Bacteria 1782
46 Ga0373935_0135502 3300035692 Bacteria 1658
47 Ga0373927_0208177 3300035695 Bacteria 1285
48 Ga0373947_0497192 3300035725 Bacteria 828
49 Ga0373947_0734576 3300035725 Bacteria 673
50 Ga0373947_0795533 3300035725 Bacteria 645
51 Ga0373947_1171712 3300035725 Bacteria 523
52 Ga0373947_1271655 3300035725 Bacteria 501
53 Ga0373937_0001885 3300036401 Bacteria 17619
54 Ga0373937_0032169 3300036401 Bacteria 4757
55 Ga0373937_0170763 3300036401 Bacteria 2040
56 Ga0373937_1003224 3300036401 Bacteria 784
57 Ga0316582_0017882 3300036647 Bacteria 4111
58 Ga0316582_0041240 3300036647 Bacteria 2884
59 Ga0316582_0179121 3300036647 Bacteria 1441
60 Ga0316582_0355948 3300036647 Bacteria 1007
61 Ga0316582_0430158 3300036647 Bacteria 910
62 Ga0316582_0945495 3300036647 Bacteria 589
63 Ga0316584_0001067 3300036712 Bacteria 15995
64 Ga0316584_0066465 3300036712 Bacteria 2702
65 Ga0316584_0139271 3300036712 Bacteria 1810
66 Ga0316584_0168200 3300036712 Bacteria 1627
67 Ga0316584_0176698 3300036712 Bacteria 1581
68 Ga0316584_0261957 3300036712 Bacteria 1260
69 Ga0316584_0699167 3300036712 Bacteria 695
70 Ga0316584_1037135 3300036712 Bacteria 546
71 Ga0373925_0298943 3300037068 Bacteria 1299
72 Ga0373925_0694202 3300037068 Bacteria 839
73 Ga0373925_1132216 3300037068 Bacteria 644
74 Ga0395899_0600202 3300037312 Bacteria 701
75 Ga0395900_0308519 3300037418 Bacteria 1566
76 Ga0395900_0576689 3300037418 Bacteria 1067
77 Ga0395898_0082040 3300037466 Bacteria 3108
78 Ga0395898_0217066 3300037466 Bacteria 1824
79 Ga0395898_0354291 3300037466 Bacteria 1399
80 Ga0395905_0477035 3300037471 Bacteria 1146
81 Ga0395905_1296834 3300037471 Bacteria 632
82 Ga0316581_0079692 3300037588 Bacteria 1007
83 Ga0436364_0132128 3300037853 Bacteria 3889
84 Ga0436364_0148531 3300037853 Bacteria 554
85 Ga0395901_0788181 3300038443 Bacteria 940
86 Ga0395901_1564619 3300038443 Bacteria 614
87 Ga0400491_01726 3300038727 Bacteria 2982
88 Ga0400491_03590 3300038727 Bacteria 1419
89 Ga0400486_22971 3300038742 Bacteria 1154
90 Ga0400483_077033 3300039062 Bacteria 5585
91 Ga0400483_290960 3300039062 Bacteria 1684
92 Ga0400489_88380 3300039093 Bacteria 13920
93 Ga0436365_0166536 3300039437 Bacteria 516
94 Ga0436365_1871876 3300039437 Bacteria 684
95 Ga0436360_0038117 3300039438 Bacteria 850
96 Ga0436360_1084608 3300039438 Bacteria 616
97 Ga0436361_0945621 3300039447 Bacteria 657
98 Ga0436362_0418491 3300039453 Bacteria 538
99 Ga0436362_0428519 3300039453 Bacteria 2373
100 Ga0436362_0486077 3300039453 Bacteria 503
101 Ga0439438_013516 3300041405 Bacteria 2459
102 Ga0439447_025257 3300041407 Bacteria 1531
103 Ga0439453_0165281 3300041408 Bacteria 532
104 Ga0451793_1723255 3300041452 Bacteria 569
105 Ga0451797_1550616 3300041453 Bacteria 596
106 Ga0451795_0265656 3300041456 Bacteria 702
107 Ga0451807_1468850 3300041486 Bacteria 542
108 Ga0451833_1077820 3300041491 Bacteria 650
109 Ga0451833_1176083 3300041491 Bacteria 544
110 Ga0451837_1065402 3300041494 Bacteria 963
111 Ga0451843_0080072 3300041509 Bacteria 1327
112 Ga0451843_1419642 3300041509 Unclassified 687
113 Ga0451843_1473178 3300041509 Bacteria 707
114 Ga0439433_0115622 3300041999 Bacteria 674
115 Ga0439455_0037670 3300042012 Bacteria 1227
116 Ga0439457_140790 3300042014 Bacteria 577
117 Ga0450920_000546 3300042122 Bacteria 5982
118 Ga0450920_071764 3300042122 Bacteria 705
119 Ga0450920_090322 3300042122 Bacteria 631
120 Ga0450888_034685 3300042126 Bacteria 686
121 Ga0450896_026669 3300042133 Bacteria 862
122 Ga0439446_0169546 3300042156 Bacteria 725
123 Ga0450908_107477 3300042184 Bacteria 514
124 Ga0450909_057718 3300042185 Bacteria 611
125 Ga0450909_081943 3300042185 Bacteria 523
126 Ga0439434_0016539 3300042435 Bacteria 2204
127 Ga0439434_0125222 3300042435 Bacteria 840
128 Ga0439435_0114690 3300042436 Bacteria 839
129 Ga0439464_0227998 3300042439 Bacteria 599
130 Ga0439464_0254661 3300042439 Bacteria 568
131 Ga0451577_0000155 3300042876 Bacteria 152745
132 Ga0451577_0590039 3300042876 Bacteria 1008
133 Ga0439440_0120774 3300042993 Bacteria 729
134 Ga0466969_0587072 3300044656 Bacteria 511
135 Ga0453683_0003443 3300044673 Bacteria 11656
136 Ga0453683_0197497 3300044673 Bacteria 1277
137 Ga0453683_0237307 3300044673 Bacteria 1161
138 Ga0453683_0270468 3300044673 Bacteria 1084
139 Ga0466965_0013220 3300044683 Bacteria 3892
140 Ga0466966_0176093 3300044684 Bacteria 1299
141 Ga0466961_0180082 3300044693 Bacteria 1312
142 Ga0453684_0000682 3300044712 Bacteria 121090
143 Ga0453684_0001648 3300044712 Bacteria 60626
144 Ga0453684_0011017 3300044712 Bacteria 15275
145 Ga0453684_0014172 3300044712 Bacteria 12805
146 Ga0453684_0043572 3300044712 Bacteria 6029
147 Ga0453684_0063314 3300044712 Bacteria 4732
148 Ga0453684_0923971 3300044712 Bacteria 933
149 Ga0453684_1248857 3300044712 Bacteria 777
150 Ga0453684_2456947 3300044712 Bacteria 515
151 Ga0453684_2460988 3300044712 Bacteria 514
152 Ga0466959_0016440 3300045049 Bacteria 5407
153 Ga0466959_0194526 3300045049 Bacteria 1414
154 Ga0466959_0677703 3300045049 Bacteria 691
155 Ga0451576_0000909 3300045051 Bacteria 56035
156 Ga0451576_0001406 3300045051 Bacteria 41324
157 Ga0451576_0001727 3300045051 Bacteria 35974
158 Ga0451576_0005544 3300045051 Bacteria 15765
159 Ga0451576_0005749 3300045051 Bacteria 15442
160 Ga0451576_0020903 3300045051 Bacteria 7123
161 Ga0451576_0045423 3300045051 Bacteria 4626
162 Ga0451576_0067294 3300045051 Bacteria 3728
163 Ga0451576_0091730 3300045051 Bacteria 3160
164 Ga0451576_0096057 3300045051 Bacteria 3082
165 Ga0451576_0124945 3300045051 Bacteria 2680
166 Ga0451576_0174113 3300045051 Bacteria 2246
167 Ga0451576_0254456 3300045051 Bacteria 1835
168 Ga0451576_0255239 3300045051 Bacteria 1832
169 Ga0451576_0430474 3300045051 Unclassified 1384
170 Ga0451576_1172867 3300045051 Bacteria 802
171 Ga0451576_2018883 3300045051 Bacteria 594
172 Ga0466958_0085673 3300045836 Bacteria 1944
173 Ga0466967_0098225 3300045976 Bacteria 2673
174 Ga0495617_197443 3300046452 Bacteria 630
175 Ga0495617_219066 3300046452 Bacteria 592
176 Ga0495592_0008724 3300046454 Bacteria 7610
177 Ga0495592_0185308 3300046454 Bacteria 1414
178 Ga0495590_0210043 3300046457 Bacteria 717
179 Ga0495591_000637 3300046458 Bacteria 25949
180 Ga0495591_000658 3300046458 Bacteria 25518
181 Ga0495629_0090850 3300046459 Bacteria 2130
182 Ga0495651_0567908 3300046462 Bacteria 719
183 Ga0495651_0623558 3300046462 Bacteria 678
184 Ga0495653_0006482 3300046463 Bacteria 9597
185 Ga0495580_0009966 3300046472 Bacteria 7430
186 Ga0495580_0141191 3300046472 Bacteria 1669
187 Ga0495580_0173569 3300046472 Bacteria 1489
188 Ga0495582_0738750 3300046473 Bacteria 570
189 Ga0495662_0081639 3300046476 Bacteria 1572
190 Ga0495662_0125977 3300046476 Bacteria 1258
191 Ga0495664_0443104 3300046477 Bacteria 778
192 Ga0495584_0028115 3300046491 Bacteria 2848
193 Ga0495585_0476436 3300046492 Bacteria 595
194 Ga0495594_0594187 3300046499 Bacteria 627
195 Ga0495608_0001279 3300046511 Bacteria 17865
196 Ga0495608_0152274 3300046511 Bacteria 1473
197 Ga0495628_0007233 3300046516 Bacteria 9614
198 Ga0495628_0333478 3300046516 Bacteria 1117
199 Ga0495628_0511892 3300046516 Bacteria 865
200 Ga0495630_0005515 3300046517 Bacteria 8925
201 Ga0495630_0215793 3300046517 Bacteria 1464
202 Ga0495632_0016912 3300046519 Bacteria 4042
203 Ga0495632_0041954 3300046519 Bacteria 2295
204 Ga0495632_0362126 3300046519 Bacteria 636
205 Ga0495632_0407650 3300046519 Bacteria 593
206 Ga0495644_0188839 3300046523 Bacteria 793
207 Ga0495666_0244369 3300046526 Bacteria 818
208 Ga0495666_0251349 3300046526 Bacteria 805
209 Ga0495642_0105845 3300046528 Bacteria 1200
210 Ga0495652_0019580 3300046529 Bacteria 6025
211 Ga0495654_0000715 3300046530 Bacteria 25958
212 Ga0495654_0000730 3300046530 Bacteria 25592
213 Ga0495640_0253731 3300046533 Bacteria 1101
214 Ga0495586_0000357 3300046535 Bacteria 28588
215 Ga0495586_0002201 3300046535 Bacteria 10581
216 Ga0495586_0276452 3300046535 Bacteria 960
217 Ga0495587_0015907 3300046536 Bacteria 4686
218 Ga0495645_0805185 3300046543 Bacteria 563
219 Ga0495667_0004974 3300046559 Bacteria 8988
220 Ga0495667_0082904 3300046559 Bacteria 2082
221 Ga0495667_0292979 3300046559 Bacteria 1032
222 Ga0495656_0601530 3300046615 Bacteria 588
223 Ga0495634_0073672 3300046642 Bacteria 2245
224 Ga0495625_0642110 3300046660 Bacteria 633
225 Ga0495635_0024355 3300046663 Bacteria 4218
226 Ga0495635_0171614 3300046663 Bacteria 1475
227 Ga0495599_0034510 3300046678 Bacteria 3178
228 Ga0495623_0735192 3300046679 Bacteria 503
229 Ga0495647_0270350 3300046681 Bacteria 760
230 Ga0495658_0007271 3300046683 Bacteria 5473
231 Ga0495658_0422793 3300046683 Bacteria 850
232 Ga0495669_0221274 3300046684 Bacteria 907
233 Ga0495670_0153097 3300046691 Bacteria 1210
234 Ga0495636_0518524 3300047318 Bacteria 577
235 Ga0495676_0600787 3300047321 Bacteria 716
236 Ga0495680_0001155 3300047322 Bacteria 29117
237 Ga0495680_0968625 3300047322 Bacteria 545
238 Ga0495680_1050398 3300047322 Bacteria 517
239 Ga0495675_0058692 3300047444 Bacteria 2439
240 Ga0495675_0724728 3300047444 Bacteria 555
241 Ga0495681_0061921 3300047470 Bacteria 1722
242 Ga0495684_0206941 3300047471 Bacteria 1444
243 Ga0495686_0085678 3300047472 Bacteria 1918
244 Ga0495593_0114859 3300047673 Bacteria 1373
245 Ga0495614_0077439 3300048089 Bacteria 1438
246 Ga0495626_0435464 3300048091 Bacteria 504
247 Ga0496100_1292377 3300048903 Bacteria 576
248 Ga0496101_0100238 3300048904 Bacteria 2166
249 Ga0496101_0352610 3300048904 Bacteria 1156
250 Ga0496101_0789947 3300048904 Bacteria 749
251 Ga0496102_0053702 3300048905 Bacteria 3672
252 Ga0496102_0364888 3300048905 Bacteria 1359
253 Ga0496102_0488110 3300048905 Bacteria 1153
254 Ga0496102_0852110 3300048905 Bacteria 833
255 Ga0496103_0609824 3300048906 Bacteria 695
256 Ga0496104_0378931 3300048907 Bacteria 1327
257 Ga0496104_0588951 3300048907 Bacteria 1022
258 Ga0496104_1128262 3300048907 Bacteria 687
259 Ga0496105_0003469 3300048908 Bacteria 11665
260 Ga0496105_0011636 3300048908 Bacteria 6961
261 Ga0496105_0222337 3300048908 Bacteria 1537
262 Ga0496105_0695158 3300048908 Bacteria 781
263 Ga0496106_1118373 3300048909 Bacteria 617
264 Ga0496107_0011982 3300048910 Bacteria 6050
265 Ga0496107_0255308 3300048910 Bacteria 1304
266 Ga0496107_0946506 3300048910 Bacteria 627
267 Ga0496107_1318748 3300048910 Bacteria 516
268 Ga0496108_0023160 3300048911 Bacteria 5107
269 Ga0496108_0992635 3300048911 Bacteria 717
270 Ga0496109_0441997 3300048912 Bacteria 1228
271 Ga0496109_0624070 3300048912 Bacteria 1014
272 Ga0496109_1816822 3300048912 Bacteria 542
273 Ga0496110_0078754 3300048913 Bacteria 2934
274 Ga0496110_0112392 3300048913 Bacteria 2449
275 Ga0496110_1177230 3300048913 Bacteria 675
276 Ga0496111_0001415 3300048914 Bacteria 13651
277 Ga0496111_0021878 3300048914 Bacteria 4469
278 Ga0496111_0092759 3300048914 Bacteria 2213
279 Ga0496112_0004801 3300048915 Bacteria 11536
280 Ga0496112_0025897 3300048915 Bacteria 5636
281 Ga0496113_0059133 3300048916 Bacteria 2886
282 Ga0496113_0298603 3300048916 Bacteria 1289
283 Ga0496113_0616161 3300048916 Bacteria 869
284 Ga0496113_1193636 3300048916 Bacteria 594
285 Ga0496114_0074247 3300048917 Bacteria 2862
286 Ga0496114_0125360 3300048917 Bacteria 2213
287 Ga0496114_1188798 3300048917 Bacteria 648
288 Ga0496115_0486981 3300048918 Bacteria 992
289 Ga0496117_0413697 3300048920 Bacteria 676
290 Ga0496118_0431668 3300048921 Bacteria 674
291 Ga0496122_0033720 3300048925 Bacteria 4204
292 Ga0496122_0344205 3300048925 Bacteria 781
293 Ga0496123_0027793 3300048926 Bacteria 4204
294 Ga0496123_0375709 3300048926 Bacteria 653
295 Ga0496125_0004466 3300048928 Bacteria 16122
296 Ga0496126_0692641 3300048929 Bacteria 793
297 Ga0501306_024109 3300049127 Bacteria 868
298 Ga0501306_091707 3300049127 Bacteria 535
299 Ga0501308_037632 3300049128 Bacteria 671
300 Ga0501305_021437 3300049161 Bacteria 955
301 Ga0501311_005299 3300049527 Bacteria 1409
302 Ga0501311_020013 3300049527 Bacteria 902
303 Ga0501313_003509 3300049529 Bacteria 1563
304 Ga0501315_099062 3300049531 Bacteria 513
305 Ga0501317_111247 3300049533 Bacteria 503
306 Ga0501323_001776 3300049539 Bacteria 1987
307 Ga0501031_0001291 3300049568 Bacteria 15336
308 Ga0501031_0106569 3300049568 Bacteria 1829
309 Ga0501031_0183998 3300049568 Bacteria 1364
310 Ga0501031_0896457 3300049568 Bacteria 568
311 Ga0501032_0002355 3300049569 Bacteria 14808
312 Ga0501032_0152410 3300049569 Bacteria 1519
313 Ga0501032_0626672 3300049569 Bacteria 683
314 Ga0501032_0963801 3300049569 Bacteria 536
315 Ga0501032_0999334 3300049569 Bacteria 525
316 Ga0501033_0001817 3300049570 Bacteria 18639
317 Ga0501033_0642195 3300049570 Bacteria 725
318 Ga0501033_0726342 3300049570 Bacteria 674
319 Ga0501034_0003361 3300049571 Bacteria 18264
320 Ga0501034_0060042 3300049571 Bacteria 3819
321 Ga0501034_1456825 3300049571 Bacteria 559
322 Ga0501036_0002120 3300049572 Bacteria 15493
323 Ga0501036_0035201 3300049572 Bacteria 4236
324 Ga0501036_0037846 3300049572 Bacteria 4080
325 Ga0501036_0077134 3300049572 Bacteria 2819
326 Ga0501036_0116826 3300049572 Bacteria 2253
327 Ga0501036_0190131 3300049572 Bacteria 1727
328 Ga0501036_0489644 3300049572 Bacteria 1023
329 Ga0501036_0761830 3300049572 Bacteria 798
330 Ga0501036_0829609 3300049572 Bacteria 761
331 Ga0501036_1514607 3300049572 Bacteria 542
332 Ga0501037_0006356 3300049573 Bacteria 8638
333 Ga0501037_0044527 3300049573 Bacteria 3259
334 Ga0501037_0407717 3300049573 Bacteria 931
335 Ga0501037_0416790 3300049573 Bacteria 919
336 Ga0501037_0453022 3300049573 Bacteria 875
337 Ga0501037_0833264 3300049573 Bacteria 607
338 Ga0501038_0012174 3300049574 Bacteria 7854
339 Ga0501038_0050221 3300049574 Bacteria 3604
340 Ga0501038_0307171 3300049574 Bacteria 1243
341 Ga0501038_0454243 3300049574 Bacteria 985
342 Ga0501038_1290346 3300049574 Bacteria 527
343 Ga0501038_1294444 3300049574 Bacteria 526
344 Ga0501039_0021864 3300049575 Bacteria 4908
345 Ga0501039_0041934 3300049575 Bacteria 3536
346 Ga0501039_0230821 3300049575 Bacteria 1455
347 Ga0501039_0581005 3300049575 Bacteria 879
348 Ga0501039_0832295 3300049575 Bacteria 719
349 Ga0501039_1040034 3300049575 Bacteria 635
350 Ga0501040_0140739 3300049576 Bacteria 1699
351 Ga0501040_0481900 3300049576 Bacteria 894
352 Ga0501040_0606974 3300049576 Bacteria 790
353 Ga0501040_0630851 3300049576 Bacteria 774
354 Ga0501040_0644305 3300049576 Bacteria 766
355 Ga0501040_0987870 3300049576 Bacteria 610
356 Ga0501041_0011289 3300049577 Bacteria 5280
357 Ga0501041_0021898 3300049577 Bacteria 3828
358 Ga0501041_0308485 3300049577 Bacteria 997
359 Ga0501041_0484224 3300049577 Bacteria 786
360 Ga0501041_0706154 3300049577 Bacteria 645
361 Ga0501042_0562707 3300049578 Bacteria 829
362 Ga0501042_0957255 3300049578 Bacteria 624
363 Ga0501042_1199568 3300049578 Bacteria 553
364 Ga0501043_0871008 3300049579 Bacteria 648
365 Ga0501043_0966961 3300049579 Bacteria 607
366 Ga0501046_1205135 3300049580 Bacteria 520
367 Ga0501047_0004195 3300049581 Bacteria 13568
368 Ga0501047_0014779 3300049581 Bacteria 7430
369 Ga0501047_0143932 3300049581 Bacteria 2261
370 Ga0501047_0299264 3300049581 Bacteria 1451
371 Ga0501047_0350895 3300049581 Bacteria 1312
372 Ga0501047_0791052 3300049581 Bacteria 763
373 Ga0501047_1428616 3300049581 Bacteria 507
374 Ga0501048_0117643 3300049582 Bacteria 1877
375 Ga0501048_0119648 3300049582 Bacteria 1861
376 Ga0501048_0254556 3300049582 Bacteria 1247
377 Ga0501048_0409966 3300049582 Bacteria 969
378 Ga0501048_0601821 3300049582 Bacteria 789
379 Ga0501067_0126598 3300049583 Bacteria 1421
380 Ga0501067_0475879 3300049583 Bacteria 698
381 Ga0501067_0708033 3300049583 Bacteria 566
382 Ga0501068_0032722 3300049584 Bacteria 3092
383 Ga0501068_0143036 3300049584 Bacteria 1500
384 Ga0501068_0335458 3300049584 Bacteria 970
385 Ga0501068_0412507 3300049584 Bacteria 871
386 Ga0501068_0670340 3300049584 Bacteria 677
387 Ga0501069_0367803 3300049585 Bacteria 849
388 Ga0501070_0000089 3300049586 Bacteria 77368
389 Ga0501070_0001904 3300049586 Bacteria 18459
390 Ga0501070_0456456 3300049586 Bacteria 1030
391 Ga0501070_0947090 3300049586 Bacteria 670
392 Ga0501071_0005936 3300049587 Bacteria 7901
393 Ga0501071_0035629 3300049587 Bacteria 3545
394 Ga0501071_0088182 3300049587 Bacteria 2276
395 Ga0501071_0089876 3300049587 Bacteria 2254
396 Ga0501072_0044373 3300049588 Bacteria 3496
397 Ga0501072_0774306 3300049588 Bacteria 752
398 Ga0501073_0020942 3300049589 Bacteria 4716
399 Ga0501073_0152302 3300049589 Bacteria 1602
400 Ga0501073_0391607 3300049589 Bacteria 960
401 Ga0501073_0510598 3300049589 Bacteria 831
402 Ga0501073_0693703 3300049589 Bacteria 702
403 Ga0501073_1206398 3300049589 Bacteria 519
404 Ga0501074_0353230 3300049590 Bacteria 1043
405 Ga0501074_1101261 3300049590 Bacteria 558
406 Ga0501075_0004184 3300049591 Bacteria 9743
407 Ga0501075_0036418 3300049591 Bacteria 3672
408 Ga0501075_0040801 3300049591 Bacteria 3477
409 Ga0501075_0071170 3300049591 Bacteria 2628
410 Ga0501075_0155694 3300049591 Bacteria 1742
411 Ga0501075_0259057 3300049591 Bacteria 1326
412 Ga0501075_0530254 3300049591 Bacteria 898
413 Ga0501075_1245520 3300049591 Bacteria 564
414 Ga0501076_0007088 3300049592 Bacteria 8144
415 Ga0501076_0153543 3300049592 Bacteria 1873
416 Ga0501076_0176263 3300049592 Bacteria 1742
417 Ga0501076_0510023 3300049592 Bacteria 991
418 Ga0501076_0818781 3300049592 Bacteria 768
419 Ga0501076_0869905 3300049592 Bacteria 743
420 Ga0501076_1190234 3300049592 Bacteria 627
421 Ga0501076_1661561 3300049592 Bacteria 524
422 Ga0501077_0019433 3300049593 Bacteria 4297
423 Ga0501077_0356510 3300049593 Bacteria 934
424 Ga0501077_0438165 3300049593 Bacteria 836
425 Ga0501077_0624249 3300049593 Bacteria 692
426 Ga0501077_0915914 3300049593 Bacteria 564
427 Ga0501198_000098 3300049649 Bacteria 16882
428 Ga0501202_006138 3300049652 Bacteria 2144
429 Ga0501222_000051 3300049662 Bacteria 43800
430 Ga0501223_069458 3300049663 Bacteria 695
431 Ga0501079_0013572 3300049741 Bacteria 6214
432 Ga0501079_0027935 3300049741 Bacteria 4327
433 Ga0501079_0276651 3300049741 Bacteria 1312
434 Ga0501079_0454006 3300049741 Bacteria 1006
435 Ga0501079_1293484 3300049741 Bacteria 574
436 Ga0501080_0135372 3300049742 Bacteria 2280
437 Ga0501080_0533660 3300049742 Bacteria 1046
438 Ga0501080_0831194 3300049742 Bacteria 808
439 Ga0501080_0899800 3300049742 Bacteria 771
440 Ga0501081_0039148 3300049743 Bacteria 3243
441 Ga0501081_0199365 3300049743 Bacteria 1451
442 Ga0501081_0324862 3300049743 Bacteria 1131
443 Ga0501081_0438117 3300049743 Bacteria 970
444 Ga0501081_0802729 3300049743 Bacteria 708
445 Ga0501081_1096175 3300049743 Bacteria 602
446 Ga0501081_1437052 3300049743 Bacteria 523
447 Ga0501083_0013514 3300049744 Bacteria 5707
448 Ga0501083_0038466 3300049744 Bacteria 3252
449 Ga0501083_0460642 3300049744 Bacteria 827
450 Ga0501272_013892 3300049769 Bacteria 926
451 Ga0501279_048499 3300049775 Bacteria 668
452 Ga0501283_079476 3300049779 Bacteria 615
453 Ga0501035_0008893 3300049822 Bacteria 9344
454 Ga0501035_0064460 3300049822 Bacteria 3256
455 Ga0501035_0242628 3300049822 Bacteria 1532
456 Ga0501035_0387697 3300049822 Bacteria 1164
457 Ga0501035_0702450 3300049822 Bacteria 815
458 Ga0501035_0940189 3300049822 Bacteria 682
459 Ga0501035_1372686 3300049822 Bacteria 542
460 Ga0501044_0004802 3300049823 Bacteria 15112
461 Ga0501044_0762350 3300049823 Bacteria 849
462 Ga0501044_1013960 3300049823 Bacteria 701
463 Ga0501045_0006501 3300049824 Bacteria 8101
464 Ga0501045_0027460 3300049824 Bacteria 4102
465 Ga0501045_0189186 3300049824 Bacteria 1534
466 Ga0501045_0494421 3300049824 Bacteria 908
467 Ga0501045_0518874 3300049824 Bacteria 884
468 Ga0501045_0712910 3300049824 Bacteria 740
469 Ga0501045_0830537 3300049824 Bacteria 680
470 Ga0501045_1410752 3300049824 Bacteria 506
471 nmdc:mga03683_322344_c1 3300050489 Bacteria 728
472 nmdc:mga03n38_823656_c1 3300050490 Bacteria 541
473 nmdc:mga03n38_916694_c1 3300050490 Bacteria 516
474 nmdc:mga00v17_557699_c1 3300050491 Bacteria 741
475 nmdc:mga00v17_7659_c1 3300050491 Bacteria 5777
476 nmdc:mga00v17_8118_c1 3300050491 Bacteria 5635
477 nmdc:mga0yw44_514509_c1 3300050492 Bacteria 812
478 nmdc:mga0yw44_518877_c1 3300050492 Bacteria 809
479 nmdc:mga0k408_142170_c1 3300050493 Bacteria 1428
480 nmdc:mga0k408_168482_c1 3300050493 Bacteria 1306
481 nmdc:mga0k408_251362_c1 3300050493 Bacteria 1056
482 nmdc:mga0k408_39362_c1 3300050493 Bacteria 2716
483 nmdc:mga0k408_476313_c1 3300050493 Bacteria 741
484 nmdc:mga0k408_814050_c1 3300050493 Bacteria 544
485 nmdc:mga0k408_91115_c1 3300050493 Bacteria 1791
486 nmdc:mga06z11_106580_c1 3300050494 Bacteria 1546
487 nmdc:mga06z11_152800_c1 3300050494 Bacteria 1314
488 nmdc:mga07m45_841203_c1 3300050496 Bacteria 525
489 nmdc:mga05p37_124125_c1 3300050507 Bacteria 3172
490 nmdc:mga05p37_211_c1 3300050507 Bacteria 58827
491 nmdc:mga05p37_30996_c1 3300050507 Bacteria 6530
492 nmdc:mga05p37_431_c1 3300050507 Bacteria 45404
493 nmdc:mga05p37_499419_c1 3300050507 Bacteria 1397
494 nmdc:mga05p37_544901_c1 3300050507 Bacteria 1322
495 nmdc:mga05p37_586422_c1 3300050507 Bacteria 1261
496 nmdc:mga09592_1156282_c1 3300050508 Bacteria 641
497 nmdc:mga09592_1228898_c1 3300050508 Bacteria 618
498 nmdc:mga09592_34394_c1 3300050508 Bacteria 4236
499 nmdc:mga09592_537208_c1 3300050508 Bacteria 1005
500 nmdc:mga0qj67_190374_c1 3300050509 Bacteria 1667
501 nmdc:mga0qj67_32703_c1 3300050509 Bacteria 4058
502 nmdc:mga0qj67_652_c1 3300050509 Bacteria 23881
503 nmdc:mga0qj67_97052_c1 3300050509 Bacteria 2373
504 nmdc:mga06r32_1377698_c1 3300050510 Bacteria 648
505 nmdc:mga06r32_223152_c1 3300050510 Bacteria 1873
506 nmdc:mga06r32_390284_c1 3300050510 Bacteria 1375
507 nmdc:mga08y16_258158_c1 3300050511 Bacteria 1800
508 nmdc:mga08y16_37158_c1 3300050511 Bacteria 5115
509 nmdc:mga08y16_385128_c1 3300050511 Bacteria 1437
510 nmdc:mga08y16_391031_c1 3300050511 Bacteria 1425
511 nmdc:mga08y16_680146_c1 3300050511 Bacteria 1031
512 nmdc:mga08y16_707484_c1 3300050511 Bacteria 1007
513 nmdc:mga08y16_733388_c1 3300050511 Bacteria 985
514 nmdc:mga08y16_758027_c1 3300050511 Bacteria 966
515 nmdc:mga08y16_963006_c1 3300050511 Bacteria 836
516 nmdc:mga0n895_1200_c1 3300050512 Bacteria 19105
517 nmdc:mga0n895_142603_c1 3300050512 Bacteria 2425
518 nmdc:mga0n895_16462_c1 3300050512 Bacteria 1542
519 nmdc:mga0n895_302476_c1 3300050512 Bacteria 1621
520 nmdc:mga0n895_747964_c1 3300050512 Bacteria 971
521 nmdc:mga0n895_8228_c1 3300050512 Bacteria 9018
522 nmdc:mga0rr50_104533_c1 3300050513 Bacteria 2231
523 nmdc:mga0rr50_1146361_c1 3300050513 Bacteria 661
524 nmdc:mga0rr50_1637_c1 3300050513 Bacteria 12325
525 nmdc:mga0rr50_1680673_c1 3300050513 Bacteria 535
526 nmdc:mga0rr50_273600_c1 3300050513 Bacteria 1408
527 nmdc:mga0rr50_385957_c1 3300050513 Bacteria 1182
528 nmdc:mga0rr50_488850_c1 3300050513 Bacteria 1046
529 nmdc:mga0rr50_841366_c1 3300050513 Bacteria 783
530 nmdc:mga08x19_1217613_c1 3300050514 Bacteria 534
531 nmdc:mga08x19_1253678_c1 3300050514 Bacteria 525
532 nmdc:mga08x19_145835_c1 3300050514 Bacteria 1601
533 nmdc:mga08x19_323623_c1 3300050514 Bacteria 1073
534 nmdc:mga08x19_419860_c1 3300050514 Bacteria 939
535 nmdc:mga08x19_435320_c1 3300050514 Bacteria 922
536 nmdc:mga08x19_786251_c1 3300050514 Bacteria 676
537 nmdc:mga08x19_931895_c1 3300050514 Bacteria 617
538 nmdc:mga0a205_1194525_c1 3300050515 Bacteria 608
539 nmdc:mga0a205_1465521_c1 3300050515 Bacteria 531
540 nmdc:mga0a205_1477794_c1 3300050515 Bacteria 528
541 nmdc:mga0a205_217_c1 3300050515 Bacteria 40547
542 nmdc:mga0a205_436757_c1 3300050515 Bacteria 1170
543 nmdc:mga0a205_5725_c1 3300050515 Bacteria 11198
544 nmdc:mga0a205_71944_c1 3300050515 Bacteria 3340
545 nmdc:mga0a205_8513_c1 3300050515 Bacteria 9328
546 nmdc:mga0a205_858260_c1 3300050515 Bacteria 755
547 nmdc:mga0a205_890805_c1 3300050515 Bacteria 737
548 Ga0495601_0178130 3300053077 Bacteria 1390
549 Ga0495601_0272943 3300053077 Bacteria 1103
550 Ga0495601_0330931 3300053077 Bacteria 991
551 Ga0495601_0542013 3300053077 Bacteria 749
552 Ga0495601_0692195 3300053077 Bacteria 651
553 Ga0495595_0008781 3300053084 Bacteria 4161
554 Ga0495595_0442107 3300053084 Bacteria 661
555 Ga0495619_0309947 3300053085 Bacteria 1093
556 Ga0500646_0081032 3300053090 Bacteria 990
557 Ga0500583_0102145 3300053092 Bacteria 1405
558 Ga0500651_0606138 3300053093 Bacteria 593
559 Ga0500562_118217 3300053108 Bacteria 722
560 Ga0500569_048636 3300053109 Bacteria 1271
561 Ga0500594_0006162 3300053118 Bacteria 2687
562 Ga0500652_001479 3300053131 Bacteria 7245
563 Ga0500652_005253 3300053131 Bacteria 4062
564 Ga0500655_102879 3300053133 Bacteria 599
565 Ga0500659_0029531 3300053135 Bacteria 2994
566 Ga0500559_0055846 3300053136 Bacteria 1752
567 Ga0500568_0019513 3300053139 Bacteria 2945
568 Ga0500577_0429413 3300053142 Bacteria 578
569 Ga0500588_0300409 3300053146 Bacteria 607
570 Ga0500604_0049560 3300053151 Bacteria 1291
571 Ga0500616_0002871 3300053153 Bacteria 13824
572 Ga0500609_023187 3300053731 Bacteria 849
573 Ga0501084_0221824 3300054114 Bacteria 1595
574 Ga0501084_0244172 3300054114 Bacteria 1516
575 Ga0501084_0363246 3300054114 Bacteria 1223
576 Ga0501084_0477822 3300054114 Bacteria 1053
577 Ga0501084_0642957 3300054114 Bacteria 895
578 Ga0587128_146247 3300059630 Bacteria 535
579 Ga0501082_0017750 3300060353 Bacteria 6128
580 Ga0501082_0034927 3300060353 Bacteria 4333
581 Ga0501082_0037651 3300060353 Bacteria 4171
582 Ga0501082_0052884 3300060353 Bacteria 3501
583 Ga0501082_0212553 3300060353 Bacteria 1682
584 Ga0501082_0264134 3300060353 Bacteria 1497
585 Ga0501082_1189056 3300060353 Bacteria 666
586 Ga0501082_1242312 3300060353 Bacteria 651
587 Ga0530510_0005256 3300061734 Bacteria 8939
588 Ga0530510_0053431 3300061734 Bacteria 2919
589 Ga0530510_0328844 3300061734 Bacteria 1146
590 Ga0530510_0401222 3300061734 Bacteria 1033
591 Ga0530510_0685858 3300061734 Bacteria 780
592 Ga0530510_1189294 3300061734 Bacteria 584
593 Ga0530510_1405084 3300061734 Bacteria 536

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007265 Ga0099794_10418604 Ga0099794_104186042 36
2 3300013306 Ga0163162_12054328 Ga0163162_120543282 36
3 3300025931 Ga0207644_10040701 Ga0207644_100407016 36
4 3300034957 Ga0373938_0195990 Ga0373938_0195990_17_127 36
5 3300035088 Ga0373940_0189353 Ga0373940_0189353_16_126 36
6 3300035088 Ga0373940_0269609 Ga0373940_0269609_450_560 36
7 3300035089 Ga0373944_0044116 Ga0373944_0044116_18_128 36
8 3300035089 Ga0373944_0443041 Ga0373944_0443041_14_124 36
9 3300035090 Ga0373949_0264638 Ga0373949_0264638_416_526 36
10 3300035091 Ga0373951_0198162 Ga0373951_0198162_454_564 36
11 3300035092 Ga0373952_0099132 Ga0373952_0099132_646_756 36
12 3300035111 Ga0373923_0048793 Ga0373923_0048793_1641_1751 36
13 3300035113 Ga0373936_0043369 Ga0373936_0043369_13_123 36
14 3300035114 Ga0373939_0198657 Ga0373939_0198657_633_743 36
15 3300035116 Ga0373945_0041920 Ga0373945_0041920_1536_1646 36
16 3300035118 Ga0373954_0000068 Ga0373954_0000068_36931_37041 36
17 3300035118 Ga0373954_0147224 Ga0373954_0147224_17_127 36
18 3300035119 Ga0373956_0040679 Ga0373956_0040679_1936_2046 36
19 3300035170 Ga0373943_0117949 Ga0373943_0117949_18_128 36
20 3300035170 Ga0373943_0659570 Ga0373943_0659570_18_128 36
21 3300035171 Ga0373946_0016753 Ga0373946_0016753_13_123 36
22 3300035172 Ga0373955_0019792 Ga0373955_0019792_3250_3360 36
23 3300035207 Ga0373942_0130145 Ga0373942_0130145_12_122 36
24 3300035207 Ga0373942_0136684 Ga0373942_0136684_20_130 36
25 3300035207 Ga0373942_0301715 Ga0373942_0301715_436_546 36
26 3300035242 Ga0373962_0179943 Ga0373962_0179943_23_133 36
27 3300035398 Ga0316574_0005225 Ga0316574_0005225_6782_6892 36
28 3300035398 Ga0316574_0032769 Ga0316574_0032769_19_129 36
29 3300035398 Ga0316574_0082950 Ga0316574_0082950_19_129 36
30 3300035398 Ga0316574_0083869 Ga0316574_0083869_1902_2012 36
31 3300035398 Ga0316574_0086535 Ga0316574_0086535_1872_1982 36
32 3300035398 Ga0316574_0166266 Ga0316574_0166266_1293_1403 36
33 3300035398 Ga0316574_0202389 Ga0316574_0202389_21_131 36
34 3300035398 Ga0316574_0237188 Ga0316574_0237188_21_131 36
35 3300035398 Ga0316574_0314009 Ga0316574_0314009_868_978 36
36 3300035398 Ga0316574_0580986 Ga0316574_0580986_18_128 36
37 3300035398 Ga0316574_0599950 Ga0316574_0599950_556_666 36
38 3300035410 Ga0373924_0555756 Ga0373924_0555756_15_125 36
39 3300035695 Ga0373927_0208177 Ga0373927_0208177_12_122 36
40 3300035725 Ga0373947_0497192 Ga0373947_0497192_707_817 36
41 3300035725 Ga0373947_0734576 Ga0373947_0734576_546_656 36
42 3300035725 Ga0373947_0795533 Ga0373947_0795533_18_128 36
43 3300035725 Ga0373947_1171712 Ga0373947_1171712_396_506 36
44 3300036401 Ga0373937_0001885 Ga0373937_0001885_12_122 36
45 3300036401 Ga0373937_0032169 Ga0373937_0032169_10_120 36
46 3300036401 Ga0373937_0170763 Ga0373937_0170763_17_127 36
47 3300036401 Ga0373937_1003224 Ga0373937_1003224_17_127 36
48 3300036647 Ga0316582_0017882 Ga0316582_0017882_16_126 36
49 3300036647 Ga0316582_0041240 Ga0316582_0041240_2763_2873 36
50 3300036647 Ga0316582_0179121 Ga0316582_0179121_21_131 36
51 3300036647 Ga0316582_0355948 Ga0316582_0355948_16_126 36
52 3300036647 Ga0316582_0945495 Ga0316582_0945495_15_125 36
53 3300036712 Ga0316584_0001067 Ga0316584_0001067_15870_15980 36
54 3300036712 Ga0316584_0066465 Ga0316584_0066465_2576_2686 36
55 3300036712 Ga0316584_0139271 Ga0316584_0139271_19_129 36
56 3300036712 Ga0316584_0168200 Ga0316584_0168200_1506_1616 36
57 3300036712 Ga0316584_0176698 Ga0316584_0176698_1454_1564 36
58 3300036712 Ga0316584_0261957 Ga0316584_0261957_19_129 36
59 3300036712 Ga0316584_0699167 Ga0316584_0699167_570_680 36
60 3300036712 Ga0316584_1037135 Ga0316584_1037135_419_529 36
61 3300037068 Ga0373925_0298943 Ga0373925_0298943_1173_1283 36
62 3300037068 Ga0373925_0694202 Ga0373925_0694202_17_127 36
63 3300037068 Ga0373925_1132216 Ga0373925_1132216_21_131 36
64 3300037466 Ga0395898_0217066 Ga0395898_0217066_1702_1812 36
65 3300037471 Ga0395905_1296834 Ga0395905_1296834_10_120 36
66 3300037588 Ga0316581_0079692 Ga0316581_0079692_886_996 36
67 3300037853 Ga0436364_0132128 Ga0436364_0132128_3761_3871 36
68 3300037853 Ga0436364_0148531 Ga0436364_0148531_19_129 36
69 3300038443 Ga0395901_0788181 Ga0395901_0788181_818_928 36
70 3300038443 Ga0395901_1564619 Ga0395901_1564619_492_602 36
71 3300038727 Ga0400491_01726 Ga0400491_01726_12_122 36
72 3300038727 Ga0400491_03590 Ga0400491_03590_10_120 36
73 3300038742 Ga0400486_22971 Ga0400486_22971_19_129 36
74 3300039062 Ga0400483_077033 Ga0400483_077033_12_122 36
75 3300039093 Ga0400489_88380 Ga0400489_88380_13790_13900 36
76 3300039437 Ga0436365_0166536 Ga0436365_0166536_392_502 36
77 3300039437 Ga0436365_1871876 Ga0436365_1871876_559_669 36
78 3300039438 Ga0436360_0038117 Ga0436360_0038117_16_126 36
79 3300039438 Ga0436360_1084608 Ga0436360_1084608_15_125 36
80 3300039453 Ga0436362_0418491 Ga0436362_0418491_413_523 36
81 3300039453 Ga0436362_0428519 Ga0436362_0428519_21_131 36
82 3300041405 Ga0439438_013516 Ga0439438_013516_10_120 36
83 3300041407 Ga0439447_025257 Ga0439447_025257_1407_1517 36
84 3300041408 Ga0439453_0165281 Ga0439453_0165281_407_517 36
85 3300041452 Ga0451793_1723255 Ga0451793_1723255_10_120 36
86 3300041453 Ga0451797_1550616 Ga0451797_1550616_474_584 36
87 3300041494 Ga0451837_1065402 Ga0451837_1065402_837_947 36
88 3300041509 Ga0451843_1419642 Ga0451843_1419642_567_677 36
89 3300041509 Ga0451843_1473178 Ga0451843_1473178_12_122 36
90 3300041999 Ga0439433_0115622 Ga0439433_0115622_17_127 36
91 3300042012 Ga0439455_0037670 Ga0439455_0037670_1106_1216 36
92 3300042014 Ga0439457_140790 Ga0439457_140790_13_123 36
93 3300042122 Ga0450920_000546 Ga0450920_000546_17_127 36
94 3300042122 Ga0450920_071764 Ga0450920_071764_577_687 36
95 3300042122 Ga0450920_090322 Ga0450920_090322_505_615 36
96 3300042126 Ga0450888_034685 Ga0450888_034685_15_125 36
97 3300042133 Ga0450896_026669 Ga0450896_026669_11_121 36
98 3300042156 Ga0439446_0169546 Ga0439446_0169546_20_130 36
99 3300042184 Ga0450908_107477 Ga0450908_107477_16_126 36
100 3300042185 Ga0450909_057718 Ga0450909_057718_487_597 36
101 3300042185 Ga0450909_081943 Ga0450909_081943_12_122 36
102 3300042435 Ga0439434_0016539 Ga0439434_0016539_2084_2194 36
103 3300042435 Ga0439434_0125222 Ga0439434_0125222_712_822 36
104 3300042436 Ga0439435_0114690 Ga0439435_0114690_11_121 36
105 3300042439 Ga0439464_0227998 Ga0439464_0227998_14_124 36
106 3300042439 Ga0439464_0254661 Ga0439464_0254661_12_122 36
107 3300042876 Ga0451577_0000155 Ga0451577_0000155_152620_152730 36
108 3300042876 Ga0451577_0590039 Ga0451577_0590039_17_127 36
109 3300042993 Ga0439440_0120774 Ga0439440_0120774_13_123 36
110 3300044673 Ga0453683_0003443 Ga0453683_0003443_11531_11641 36
111 3300044673 Ga0453683_0197497 Ga0453683_0197497_15_125 36
112 3300044673 Ga0453683_0237307 Ga0453683_0237307_1031_1141 36
113 3300044673 Ga0453683_0270468 Ga0453683_0270468_16_126 36
114 3300044683 Ga0466965_0013220 Ga0466965_0013220_3768_3878 36
115 3300044684 Ga0466966_0176093 Ga0466966_0176093_19_129 36
116 3300044712 Ga0453684_0000682 Ga0453684_0000682_120964_121074 36
117 3300044712 Ga0453684_0001648 Ga0453684_0001648_60500_60610 36
118 3300044712 Ga0453684_0011017 Ga0453684_0011017_15149_15259 36
119 3300044712 Ga0453684_0014172 Ga0453684_0014172_17_127 36
120 3300044712 Ga0453684_0043572 Ga0453684_0043572_21_131 36
121 3300044712 Ga0453684_0923971 Ga0453684_0923971_809_919 36
122 3300044712 Ga0453684_1248857 Ga0453684_1248857_16_126 36
123 3300044712 Ga0453684_2456947 Ga0453684_2456947_16_126 36
124 3300044712 Ga0453684_2460988 Ga0453684_2460988_394_504 36
125 3300045049 Ga0466959_0016440 Ga0466959_0016440_5281_5391 36
126 3300045049 Ga0466959_0194526 Ga0466959_0194526_11_121 36
127 3300045049 Ga0466959_0677703 Ga0466959_0677703_566_676 36
128 3300045051 Ga0451576_0000909 Ga0451576_0000909_55910_56020 36
129 3300045051 Ga0451576_0001406 Ga0451576_0001406_17_127 36
130 3300045051 Ga0451576_0001727 Ga0451576_0001727_15_125 36
131 3300045051 Ga0451576_0005544 Ga0451576_0005544_15639_15749 36
132 3300045051 Ga0451576_0005749 Ga0451576_0005749_15317_15427 36
133 3300045051 Ga0451576_0020903 Ga0451576_0020903_6996_7106 36
134 3300045051 Ga0451576_0045423 Ga0451576_0045423_14_124 36
135 3300045051 Ga0451576_0067294 Ga0451576_0067294_3604_3714 36
136 3300045051 Ga0451576_0091730 Ga0451576_0091730_3035_3145 36
137 3300045051 Ga0451576_0096057 Ga0451576_0096057_2958_3068 36
138 3300045051 Ga0451576_0124945 Ga0451576_0124945_15_125 36
139 3300045051 Ga0451576_0174113 Ga0451576_0174113_17_127 36
140 3300045051 Ga0451576_0254456 Ga0451576_0254456_1708_1818 36
141 3300045051 Ga0451576_0255239 Ga0451576_0255239_12_122 36
142 3300045051 Ga0451576_0430474 Ga0451576_0430474_1260_1370 36
143 3300045051 Ga0451576_1172867 Ga0451576_1172867_17_127 36
144 3300045051 Ga0451576_2018883 Ga0451576_2018883_470_580 36
145 3300045836 Ga0466958_0085673 Ga0466958_0085673_1823_1933 36
146 3300045976 Ga0466967_0098225 Ga0466967_0098225_17_127 36
147 3300046452 Ga0495617_197443 Ga0495617_197443_14_124 36
148 3300046452 Ga0495617_219066 Ga0495617_219066_464_574 36
149 3300046454 Ga0495592_0008724 Ga0495592_0008724_7486_7596 36
150 3300046454 Ga0495592_0185308 Ga0495592_0185308_21_131 36
151 3300046457 Ga0495590_0210043 Ga0495590_0210043_16_126 36
152 3300046458 Ga0495591_000637 Ga0495591_000637_12_122 36
153 3300046458 Ga0495591_000658 Ga0495591_000658_12_122 36
154 3300046459 Ga0495629_0090850 Ga0495629_0090850_10_120 36
155 3300046462 Ga0495651_0567908 Ga0495651_0567908_592_702 36
156 3300046463 Ga0495653_0006482 Ga0495653_0006482_9475_9585 36
157 3300046472 Ga0495580_0009966 Ga0495580_0009966_12_122 36
158 3300046472 Ga0495580_0141191 Ga0495580_0141191_19_129 36
159 3300046472 Ga0495580_0173569 Ga0495580_0173569_21_131 36
160 3300046473 Ga0495582_0738750 Ga0495582_0738750_447_557 36
161 3300046476 Ga0495662_0081639 Ga0495662_0081639_19_129 36
162 3300046476 Ga0495662_0125977 Ga0495662_0125977_1132_1242 36
163 3300046477 Ga0495664_0443104 Ga0495664_0443104_16_126 36
164 3300046492 Ga0495585_0476436 Ga0495585_0476436_10_120 36
165 3300046511 Ga0495608_0001279 Ga0495608_0001279_17739_17849 36
166 3300046511 Ga0495608_0152274 Ga0495608_0152274_1350_1460 36
167 3300046516 Ga0495628_0007233 Ga0495628_0007233_9487_9597 36
168 3300046516 Ga0495628_0333478 Ga0495628_0333478_991_1101 36
169 3300046516 Ga0495628_0511892 Ga0495628_0511892_739_849 36
170 3300046517 Ga0495630_0005515 Ga0495630_0005515_8801_8911 36
171 3300046517 Ga0495630_0215793 Ga0495630_0215793_17_127 36
172 3300046519 Ga0495632_0407650 Ga0495632_0407650_465_575 36
173 3300046523 Ga0495644_0188839 Ga0495644_0188839_672_782 36
174 3300046526 Ga0495666_0251349 Ga0495666_0251349_680_790 36
175 3300046528 Ga0495642_0105845 Ga0495642_0105845_1077_1187 36
176 3300046529 Ga0495652_0019580 Ga0495652_0019580_13_123 36
177 3300046530 Ga0495654_0000715 Ga0495654_0000715_25837_25947 36
178 3300046530 Ga0495654_0000730 Ga0495654_0000730_25471_25581 36
179 3300046533 Ga0495640_0253731 Ga0495640_0253731_18_128 36
180 3300046535 Ga0495586_0000357 Ga0495586_0000357_21_131 36
181 3300046535 Ga0495586_0002201 Ga0495586_0002201_21_131 36
182 3300046535 Ga0495586_0276452 Ga0495586_0276452_17_127 36
183 3300046536 Ga0495587_0015907 Ga0495587_0015907_20_130 36
184 3300046543 Ga0495645_0805185 Ga0495645_0805185_15_125 36
185 3300046559 Ga0495667_0004974 Ga0495667_0004974_8858_8968 36
186 3300046559 Ga0495667_0082904 Ga0495667_0082904_13_123 36
187 3300046559 Ga0495667_0292979 Ga0495667_0292979_910_1020 36
188 3300046642 Ga0495634_0073672 Ga0495634_0073672_17_127 36
189 3300046660 Ga0495625_0642110 Ga0495625_0642110_510_620 36
190 3300046663 Ga0495635_0024355 Ga0495635_0024355_4097_4207 36
191 3300046678 Ga0495599_0034510 Ga0495599_0034510_3048_3158 36
192 3300046679 Ga0495623_0735192 Ga0495623_0735192_15_125 36
193 3300046683 Ga0495658_0007271 Ga0495658_0007271_13_123 36
194 3300046683 Ga0495658_0422793 Ga0495658_0422793_17_127 36
195 3300046684 Ga0495669_0221274 Ga0495669_0221274_777_887 36
196 3300046691 Ga0495670_0153097 Ga0495670_0153097_16_126 36
197 3300047318 Ga0495636_0518524 Ga0495636_0518524_16_126 36
198 3300047322 Ga0495680_0001155 Ga0495680_0001155_16_126 36
199 3300047322 Ga0495680_0968625 Ga0495680_0968625_24_152 36
200 3300047322 Ga0495680_1050398 Ga0495680_1050398_31_141 36
201 3300047444 Ga0495675_0058692 Ga0495675_0058692_2317_2427 36
202 3300047444 Ga0495675_0724728 Ga0495675_0724728_434_544 36
203 3300047470 Ga0495681_0061921 Ga0495681_0061921_1601_1711 36
204 3300047471 Ga0495684_0206941 Ga0495684_0206941_16_126 36
205 3300047472 Ga0495686_0085678 Ga0495686_0085678_14_124 36
206 3300047673 Ga0495593_0114859 Ga0495593_0114859_1245_1355 36
207 3300048903 Ga0496100_1292377 Ga0496100_1292377_456_566 36
208 3300048904 Ga0496101_0100238 Ga0496101_0100238_17_127 36
209 3300048904 Ga0496101_0352610 Ga0496101_0352610_1036_1146 36
210 3300048904 Ga0496101_0789947 Ga0496101_0789947_625_735 36
211 3300048905 Ga0496102_0053702 Ga0496102_0053702_19_129 36
212 3300048905 Ga0496102_0364888 Ga0496102_0364888_17_127 36
213 3300048905 Ga0496102_0488110 Ga0496102_0488110_16_126 36
214 3300048905 Ga0496102_0852110 Ga0496102_0852110_19_129 36
215 3300048906 Ga0496103_0609824 Ga0496103_0609824_14_124 36
216 3300048907 Ga0496104_0378931 Ga0496104_0378931_12_122 36
217 3300048907 Ga0496104_0588951 Ga0496104_0588951_894_1004 36
218 3300048907 Ga0496104_1128262 Ga0496104_1128262_19_129 36
219 3300048908 Ga0496105_0003469 Ga0496105_0003469_11537_11647 36
220 3300048908 Ga0496105_0011636 Ga0496105_0011636_6833_6943 36
221 3300048908 Ga0496105_0222337 Ga0496105_0222337_20_130 36
222 3300048908 Ga0496105_0695158 Ga0496105_0695158_18_128 36
223 3300048909 Ga0496106_1118373 Ga0496106_1118373_21_131 36
224 3300048910 Ga0496107_0011982 Ga0496107_0011982_17_127 36
225 3300048910 Ga0496107_0255308 Ga0496107_0255308_20_130 36
226 3300048910 Ga0496107_0946506 Ga0496107_0946506_501_611 36
227 3300048910 Ga0496107_1318748 Ga0496107_1318748_390_500 36
228 3300048911 Ga0496108_0023160 Ga0496108_0023160_18_128 36
229 3300048911 Ga0496108_0992635 Ga0496108_0992635_18_128 36
230 3300048912 Ga0496109_0441997 Ga0496109_0441997_14_124 36
231 3300048912 Ga0496109_0624070 Ga0496109_0624070_16_126 36
232 3300048912 Ga0496109_1816822 Ga0496109_1816822_414_524 36
233 3300048913 Ga0496110_0078754 Ga0496110_0078754_2810_2920 36
234 3300048913 Ga0496110_0112392 Ga0496110_0112392_2323_2433 36
235 3300048913 Ga0496110_1177230 Ga0496110_1177230_552_662 36
236 3300048914 Ga0496111_0001415 Ga0496111_0001415_13524_13634 36
237 3300048914 Ga0496111_0021878 Ga0496111_0021878_4341_4451 36
238 3300048914 Ga0496111_0092759 Ga0496111_0092759_19_129 36
239 3300048915 Ga0496112_0004801 Ga0496112_0004801_11414_11524 36
240 3300048915 Ga0496112_0025897 Ga0496112_0025897_5515_5625 36
241 3300048916 Ga0496113_0059133 Ga0496113_0059133_14_124 36
242 3300048916 Ga0496113_0298603 Ga0496113_0298603_20_130 36
243 3300048916 Ga0496113_1193636 Ga0496113_1193636_474_584 36
244 3300048917 Ga0496114_0074247 Ga0496114_0074247_11_121 36
245 3300048917 Ga0496114_0125360 Ga0496114_0125360_2088_2198 36
246 3300048917 Ga0496114_1188798 Ga0496114_1188798_10_120 36
247 3300048918 Ga0496115_0486981 Ga0496115_0486981_19_129 36
248 3300048920 Ga0496117_0413697 Ga0496117_0413697_21_131 36
249 3300048921 Ga0496118_0431668 Ga0496118_0431668_20_130 36
250 3300048925 Ga0496122_0033720 Ga0496122_0033720_4078_4188 36
251 3300048925 Ga0496122_0344205 Ga0496122_0344205_17_127 36
252 3300048926 Ga0496123_0027793 Ga0496123_0027793_17_127 36
253 3300048926 Ga0496123_0375709 Ga0496123_0375709_17_127 36
254 3300048928 Ga0496125_0004466 Ga0496125_0004466_15996_16106 36
255 3300048929 Ga0496126_0692641 Ga0496126_0692641_12_122 36
256 3300049127 Ga0501306_024109 Ga0501306_024109_13_123 36
257 3300049127 Ga0501306_091707 Ga0501306_091707_406_516 36
258 3300049161 Ga0501305_021437 Ga0501305_021437_832_942 36
259 3300049527 Ga0501311_005299 Ga0501311_005299_1280_1390 36
260 3300049527 Ga0501311_020013 Ga0501311_020013_773_883 36
261 3300049529 Ga0501313_003509 Ga0501313_003509_11_121 36
262 3300049531 Ga0501315_099062 Ga0501315_099062_11_121 36
263 3300049533 Ga0501317_111247 Ga0501317_111247_20_130 36
264 3300049539 Ga0501323_001776 Ga0501323_001776_196_306 36
265 3300049568 Ga0501031_0106569 Ga0501031_0106569_15_125 36
266 3300049568 Ga0501031_0183998 Ga0501031_0183998_1240_1350 36
267 3300049568 Ga0501031_0896457 Ga0501031_0896457_444_554 36
268 3300049569 Ga0501032_0002355 Ga0501032_0002355_13_123 36
269 3300049569 Ga0501032_0152410 Ga0501032_0152410_10_120 36
270 3300049569 Ga0501032_0626672 Ga0501032_0626672_560_670 36
271 3300049569 Ga0501032_0963801 Ga0501032_0963801_10_120 36
272 3300049569 Ga0501032_0999334 Ga0501032_0999334_19_129 36
273 3300049570 Ga0501033_0001817 Ga0501033_0001817_17_127 36
274 3300049570 Ga0501033_0642195 Ga0501033_0642195_14_124 36
275 3300049570 Ga0501033_0726342 Ga0501033_0726342_15_125 36
276 3300049571 Ga0501034_0003361 Ga0501034_0003361_17_127 36
277 3300049571 Ga0501034_0060042 Ga0501034_0060042_17_127 36
278 3300049571 Ga0501034_1456825 Ga0501034_1456825_13_123 36
279 3300049572 Ga0501036_0002120 Ga0501036_0002120_12_122 36
280 3300049572 Ga0501036_0035201 Ga0501036_0035201_14_124 36
281 3300049572 Ga0501036_0037846 Ga0501036_0037846_3954_4064 36
282 3300049572 Ga0501036_0077134 Ga0501036_0077134_17_127 36
283 3300049572 Ga0501036_0116826 Ga0501036_0116826_12_122 36
284 3300049572 Ga0501036_0190131 Ga0501036_0190131_12_122 36
285 3300049572 Ga0501036_0489644 Ga0501036_0489644_10_120 36
286 3300049572 Ga0501036_0761830 Ga0501036_0761830_17_127 36
287 3300049572 Ga0501036_0829609 Ga0501036_0829609_21_131 36
288 3300049572 Ga0501036_1514607 Ga0501036_1514607_416_526 36
289 3300049573 Ga0501037_0006356 Ga0501037_0006356_10_120 36
290 3300049573 Ga0501037_0407717 Ga0501037_0407717_15_125 36
291 3300049573 Ga0501037_0416790 Ga0501037_0416790_17_127 36
292 3300049573 Ga0501037_0453022 Ga0501037_0453022_17_127 36
293 3300049573 Ga0501037_0833264 Ga0501037_0833264_483_593 36
294 3300049574 Ga0501038_0012174 Ga0501038_0012174_18_128 36
295 3300049574 Ga0501038_0050221 Ga0501038_0050221_17_127 36
296 3300049574 Ga0501038_0307171 Ga0501038_0307171_1119_1229 36
297 3300049574 Ga0501038_0454243 Ga0501038_0454243_14_124 36
298 3300049574 Ga0501038_1290346 Ga0501038_1290346_15_125 36
299 3300049574 Ga0501038_1294444 Ga0501038_1294444_17_127 36
300 3300049575 Ga0501039_0021864 Ga0501039_0021864_10_120 36
301 3300049575 Ga0501039_0041934 Ga0501039_0041934_14_124 36
302 3300049575 Ga0501039_0230821 Ga0501039_0230821_1322_1432 36
303 3300049575 Ga0501039_0581005 Ga0501039_0581005_15_125 36
304 3300049575 Ga0501039_0832295 Ga0501039_0832295_595_705 36
305 3300049575 Ga0501039_1040034 Ga0501039_1040034_511_621 36
306 3300049576 Ga0501040_0140739 Ga0501040_0140739_1575_1685 36
307 3300049576 Ga0501040_0481900 Ga0501040_0481900_17_127 36
308 3300049576 Ga0501040_0630851 Ga0501040_0630851_16_126 36
309 3300049576 Ga0501040_0644305 Ga0501040_0644305_642_752 36
310 3300049576 Ga0501040_0987870 Ga0501040_0987870_482_592 36
311 3300049577 Ga0501041_0011289 Ga0501041_0011289_10_120 36
312 3300049577 Ga0501041_0021898 Ga0501041_0021898_15_125 36
313 3300049577 Ga0501041_0484224 Ga0501041_0484224_664_774 36
314 3300049577 Ga0501041_0706154 Ga0501041_0706154_521_631 36
315 3300049578 Ga0501042_0562707 Ga0501042_0562707_14_124 36
316 3300049578 Ga0501042_0957255 Ga0501042_0957255_18_128 36
317 3300049578 Ga0501042_1199568 Ga0501042_1199568_21_131 36
318 3300049579 Ga0501043_0871008 Ga0501043_0871008_525_635 36
319 3300049579 Ga0501043_0966961 Ga0501043_0966961_483_593 36
320 3300049580 Ga0501046_1205135 Ga0501046_1205135_398_508 36
321 3300049581 Ga0501047_0004195 Ga0501047_0004195_13443_13553 36
322 3300049581 Ga0501047_0014779 Ga0501047_0014779_17_127 36
323 3300049581 Ga0501047_0143932 Ga0501047_0143932_2137_2247 36
324 3300049581 Ga0501047_0299264 Ga0501047_0299264_16_126 36
325 3300049581 Ga0501047_0350895 Ga0501047_0350895_10_120 36
326 3300049581 Ga0501047_0791052 Ga0501047_0791052_15_125 36
327 3300049581 Ga0501047_1428616 Ga0501047_1428616_16_126 36
328 3300049582 Ga0501048_0117643 Ga0501048_0117643_18_128 36
329 3300049582 Ga0501048_0119648 Ga0501048_0119648_1739_1849 36
330 3300049582 Ga0501048_0254556 Ga0501048_0254556_16_126 36
331 3300049582 Ga0501048_0409966 Ga0501048_0409966_17_127 36
332 3300049582 Ga0501048_0601821 Ga0501048_0601821_13_123 36
333 3300049583 Ga0501067_0126598 Ga0501067_0126598_12_122 36
334 3300049583 Ga0501067_0475879 Ga0501067_0475879_10_120 36
335 3300049584 Ga0501068_0032722 Ga0501068_0032722_16_126 36
336 3300049584 Ga0501068_0143036 Ga0501068_0143036_1376_1486 36
337 3300049584 Ga0501068_0335458 Ga0501068_0335458_843_953 36
338 3300049584 Ga0501068_0412507 Ga0501068_0412507_750_860 36
339 3300049584 Ga0501068_0670340 Ga0501068_0670340_12_122 36
340 3300049585 Ga0501069_0367803 Ga0501069_0367803_13_123 36
341 3300049586 Ga0501070_0000089 Ga0501070_0000089_77247_77357 36
342 3300049586 Ga0501070_0001904 Ga0501070_0001904_18338_18448 36
343 3300049586 Ga0501070_0456456 Ga0501070_0456456_909_1019 36
344 3300049586 Ga0501070_0947090 Ga0501070_0947090_549_659 36
345 3300049587 Ga0501071_0005936 Ga0501071_0005936_14_124 36
346 3300049587 Ga0501071_0035629 Ga0501071_0035629_3422_3532 36
347 3300049587 Ga0501071_0088182 Ga0501071_0088182_2153_2263 36
348 3300049587 Ga0501071_0089876 Ga0501071_0089876_18_128 36
349 3300049588 Ga0501072_0044373 Ga0501072_0044373_16_126 36
350 3300049588 Ga0501072_0774306 Ga0501072_0774306_10_120 36
351 3300049589 Ga0501073_0020942 Ga0501073_0020942_11_121 36
352 3300049589 Ga0501073_0152302 Ga0501073_0152302_15_125 36
353 3300049589 Ga0501073_0391607 Ga0501073_0391607_17_127 36
354 3300049589 Ga0501073_0510598 Ga0501073_0510598_711_821 36
355 3300049589 Ga0501073_0693703 Ga0501073_0693703_580_690 36
356 3300049589 Ga0501073_1206398 Ga0501073_1206398_20_130 36
357 3300049590 Ga0501074_0353230 Ga0501074_0353230_12_122 36
358 3300049590 Ga0501074_1101261 Ga0501074_1101261_14_124 36
359 3300049591 Ga0501075_0004184 Ga0501075_0004184_9618_9728 36
360 3300049591 Ga0501075_0036418 Ga0501075_0036418_19_129 36
361 3300049591 Ga0501075_0040801 Ga0501075_0040801_3350_3460 36
362 3300049591 Ga0501075_0071170 Ga0501075_0071170_19_129 36
363 3300049591 Ga0501075_0155694 Ga0501075_0155694_1609_1719 36
364 3300049591 Ga0501075_0259057 Ga0501075_0259057_18_128 36
365 3300049591 Ga0501075_0530254 Ga0501075_0530254_774_884 36
366 3300049591 Ga0501075_1245520 Ga0501075_1245520_18_128 36
367 3300049592 Ga0501076_0007088 Ga0501076_0007088_15_125 36
368 3300049592 Ga0501076_0153543 Ga0501076_0153543_1752_1862 36
369 3300049592 Ga0501076_0176263 Ga0501076_0176263_17_127 36
370 3300049592 Ga0501076_0510023 Ga0501076_0510023_20_130 36
371 3300049592 Ga0501076_0818781 Ga0501076_0818781_17_127 36
372 3300049592 Ga0501076_0869905 Ga0501076_0869905_619_729 36
373 3300049592 Ga0501076_1190234 Ga0501076_1190234_17_127 36
374 3300049592 Ga0501076_1661561 Ga0501076_1661561_404_514 36
375 3300049593 Ga0501077_0019433 Ga0501077_0019433_11_121 36
376 3300049593 Ga0501077_0356510 Ga0501077_0356510_12_122 36
377 3300049593 Ga0501077_0438165 Ga0501077_0438165_15_125 36
378 3300049593 Ga0501077_0624249 Ga0501077_0624249_17_127 36
379 3300049593 Ga0501077_0915914 Ga0501077_0915914_443_553 36
380 3300049652 Ga0501202_006138 Ga0501202_006138_2015_2125 36
381 3300049741 Ga0501079_0013572 Ga0501079_0013572_10_120 36
382 3300049741 Ga0501079_0027935 Ga0501079_0027935_4207_4317 36
383 3300049741 Ga0501079_0276651 Ga0501079_0276651_12_122 36
384 3300049741 Ga0501079_0454006 Ga0501079_0454006_10_120 36
385 3300049741 Ga0501079_1293484 Ga0501079_1293484_20_130 36
386 3300049742 Ga0501080_0135372 Ga0501080_0135372_17_127 36
387 3300049742 Ga0501080_0533660 Ga0501080_0533660_924_1034 36
388 3300049742 Ga0501080_0831194 Ga0501080_0831194_684_794 36
389 3300049742 Ga0501080_0899800 Ga0501080_0899800_21_131 36
390 3300049743 Ga0501081_0039148 Ga0501081_0039148_3114_3224 36
391 3300049743 Ga0501081_0199365 Ga0501081_0199365_1329_1439 36
392 3300049743 Ga0501081_0324862 Ga0501081_0324862_1011_1121 36
393 3300049743 Ga0501081_0438117 Ga0501081_0438117_848_958 36
394 3300049743 Ga0501081_0802729 Ga0501081_0802729_17_127 36
395 3300049743 Ga0501081_1096175 Ga0501081_1096175_17_127 36
396 3300049743 Ga0501081_1437052 Ga0501081_1437052_17_127 36
397 3300049744 Ga0501083_0013514 Ga0501083_0013514_5580_5690 36
398 3300049744 Ga0501083_0038466 Ga0501083_0038466_13_123 36
399 3300049744 Ga0501083_0460642 Ga0501083_0460642_17_127 36
400 3300049769 Ga0501272_013892 Ga0501272_013892_805_915 36
401 3300049779 Ga0501283_079476 Ga0501283_079476_21_131 36
402 3300049822 Ga0501035_0008893 Ga0501035_0008893_17_127 36
403 3300049822 Ga0501035_0064460 Ga0501035_0064460_18_128 36
404 3300049822 Ga0501035_0242628 Ga0501035_0242628_12_122 36
405 3300049822 Ga0501035_0387697 Ga0501035_0387697_15_125 36
406 3300049822 Ga0501035_0702450 Ga0501035_0702450_691_801 36
407 3300049822 Ga0501035_0940189 Ga0501035_0940189_15_125 36
408 3300049822 Ga0501035_1372686 Ga0501035_1372686_15_125 36
409 3300049823 Ga0501044_0004802 Ga0501044_0004802_14991_15101 36
410 3300049823 Ga0501044_0762350 Ga0501044_0762350_728_838 36
411 3300049823 Ga0501044_1013960 Ga0501044_1013960_16_126 36
412 3300049824 Ga0501045_0006501 Ga0501045_0006501_17_127 36
413 3300049824 Ga0501045_0027460 Ga0501045_0027460_19_129 36
414 3300049824 Ga0501045_0189186 Ga0501045_0189186_11_121 36
415 3300049824 Ga0501045_0494421 Ga0501045_0494421_781_891 36
416 3300049824 Ga0501045_0518874 Ga0501045_0518874_14_124 36
417 3300049824 Ga0501045_0712910 Ga0501045_0712910_620_730 36
418 3300049824 Ga0501045_0830537 Ga0501045_0830537_554_664 36
419 3300049824 Ga0501045_1410752 Ga0501045_1410752_15_125 36
420 3300050489 nmdc:mga03683_322344_c1 nmdc:mga03683_322344_c1_603_713 36
421 3300050490 nmdc:mga03n38_823656_c1 nmdc:mga03n38_823656_c1_10_120 36
422 3300050491 nmdc:mga00v17_557699_c1 nmdc:mga00v17_557699_c1_619_729 36
423 3300050491 nmdc:mga00v17_7659_c1 nmdc:mga00v17_7659_c1_16_126 36
424 3300050491 nmdc:mga00v17_8118_c1 nmdc:mga00v17_8118_c1_16_126 36
425 3300050492 nmdc:mga0yw44_514509_c1 nmdc:mga0yw44_514509_c1_17_127 36
426 3300050492 nmdc:mga0yw44_518877_c1 nmdc:mga0yw44_518877_c1_13_123 36
427 3300050493 nmdc:mga0k408_142170_c1 nmdc:mga0k408_142170_c1_1308_1418 36
428 3300050493 nmdc:mga0k408_168482_c1 nmdc:mga0k408_168482_c1_13_123 36
429 3300050493 nmdc:mga0k408_251362_c1 nmdc:mga0k408_251362_c1_15_125 36
430 3300050493 nmdc:mga0k408_476313_c1 nmdc:mga0k408_476313_c1_619_729 36
431 3300050493 nmdc:mga0k408_814050_c1 nmdc:mga0k408_814050_c1_16_126 36
432 3300050494 nmdc:mga06z11_106580_c1 nmdc:mga06z11_106580_c1_1424_1534 36
433 3300050494 nmdc:mga06z11_152800_c1 nmdc:mga06z11_152800_c1_19_129 36
434 3300050496 nmdc:mga07m45_841203_c1 nmdc:mga07m45_841203_c1_402_512 36
435 3300050507 nmdc:mga05p37_124125_c1 nmdc:mga05p37_124125_c1_3046_3156 36
436 3300050507 nmdc:mga05p37_211_c1 nmdc:mga05p37_211_c1_17_127 36
437 3300050507 nmdc:mga05p37_30996_c1 nmdc:mga05p37_30996_c1_10_120 36
438 3300050507 nmdc:mga05p37_431_c1 nmdc:mga05p37_431_c1_17_127 36
439 3300050507 nmdc:mga05p37_499419_c1 nmdc:mga05p37_499419_c1_1271_1381 36
440 3300050507 nmdc:mga05p37_544901_c1 nmdc:mga05p37_544901_c1_12_122 36
441 3300050507 nmdc:mga05p37_586422_c1 nmdc:mga05p37_586422_c1_1141_1251 36
442 3300050508 nmdc:mga09592_1156282_c1 nmdc:mga09592_1156282_c1_13_123 36
443 3300050508 nmdc:mga09592_1228898_c1 nmdc:mga09592_1228898_c1_18_128 36
444 3300050508 nmdc:mga09592_34394_c1 nmdc:mga09592_34394_c1_19_129 36
445 3300050508 nmdc:mga09592_537208_c1 nmdc:mga09592_537208_c1_879_989 36
446 3300050509 nmdc:mga0qj67_190374_c1 nmdc:mga0qj67_190374_c1_17_127 36
447 3300050509 nmdc:mga0qj67_32703_c1 nmdc:mga0qj67_32703_c1_3932_4042 36
448 3300050509 nmdc:mga0qj67_652_c1 nmdc:mga0qj67_652_c1_17_127 36
449 3300050509 nmdc:mga0qj67_97052_c1 nmdc:mga0qj67_97052_c1_2245_2355 36
450 3300050510 nmdc:mga06r32_1377698_c1 nmdc:mga06r32_1377698_c1_17_127 36
451 3300050510 nmdc:mga06r32_223152_c1 nmdc:mga06r32_223152_c1_1751_1861 36
452 3300050510 nmdc:mga06r32_390284_c1 nmdc:mga06r32_390284_c1_1249_1359 36
453 3300050511 nmdc:mga08y16_258158_c1 nmdc:mga08y16_258158_c1_18_128 36
454 3300050511 nmdc:mga08y16_37158_c1 nmdc:mga08y16_37158_c1_18_128 36
455 3300050511 nmdc:mga08y16_385128_c1 nmdc:mga08y16_385128_c1_18_128 36
456 3300050511 nmdc:mga08y16_391031_c1 nmdc:mga08y16_391031_c1_1296_1406 36
457 3300050511 nmdc:mga08y16_680146_c1 nmdc:mga08y16_680146_c1_15_125 36
458 3300050511 nmdc:mga08y16_707484_c1 nmdc:mga08y16_707484_c1_13_123 36
459 3300050511 nmdc:mga08y16_733388_c1 nmdc:mga08y16_733388_c1_863_973 36
460 3300050511 nmdc:mga08y16_758027_c1 nmdc:mga08y16_758027_c1_841_951 36
461 3300050511 nmdc:mga08y16_963006_c1 nmdc:mga08y16_963006_c1_19_129 36
462 3300050512 nmdc:mga0n895_1200_c1 nmdc:mga0n895_1200_c1_18979_19089 36
463 3300050512 nmdc:mga0n895_142603_c1 nmdc:mga0n895_142603_c1_15_125 36
464 3300050512 nmdc:mga0n895_16462_c1 nmdc:mga0n895_16462_c1_17_127 36
465 3300050512 nmdc:mga0n895_302476_c1 nmdc:mga0n895_302476_c1_1499_1609 36
466 3300050512 nmdc:mga0n895_747964_c1 nmdc:mga0n895_747964_c1_844_954 36
467 3300050512 nmdc:mga0n895_8228_c1 nmdc:mga0n895_8228_c1_15_125 36
468 3300050513 nmdc:mga0rr50_104533_c1 nmdc:mga0rr50_104533_c1_2104_2214 36
469 3300050513 nmdc:mga0rr50_1146361_c1 nmdc:mga0rr50_1146361_c1_517_627 36
470 3300050513 nmdc:mga0rr50_1637_c1 nmdc:mga0rr50_1637_c1_17_127 36
471 3300050513 nmdc:mga0rr50_1680673_c1 nmdc:mga0rr50_1680673_c1_413_523 36
472 3300050513 nmdc:mga0rr50_273600_c1 nmdc:mga0rr50_273600_c1_11_121 36
473 3300050513 nmdc:mga0rr50_385957_c1 nmdc:mga0rr50_385957_c1_17_127 36
474 3300050513 nmdc:mga0rr50_488850_c1 nmdc:mga0rr50_488850_c1_18_128 36
475 3300050513 nmdc:mga0rr50_841366_c1 nmdc:mga0rr50_841366_c1_17_127 36
476 3300050514 nmdc:mga08x19_1217613_c1 nmdc:mga08x19_1217613_c1_17_127 36
477 3300050514 nmdc:mga08x19_1253678_c1 nmdc:mga08x19_1253678_c1_16_126 36
478 3300050514 nmdc:mga08x19_145835_c1 nmdc:mga08x19_145835_c1_1471_1581 36
479 3300050514 nmdc:mga08x19_323623_c1 nmdc:mga08x19_323623_c1_948_1058 36
480 3300050514 nmdc:mga08x19_419860_c1 nmdc:mga08x19_419860_c1_816_926 36
481 3300050514 nmdc:mga08x19_435320_c1 nmdc:mga08x19_435320_c1_17_127 36
482 3300050514 nmdc:mga08x19_931895_c1 nmdc:mga08x19_931895_c1_12_122 36
483 3300050515 nmdc:mga0a205_1465521_c1 nmdc:mga0a205_1465521_c1_17_127 36
484 3300050515 nmdc:mga0a205_1477794_c1 nmdc:mga0a205_1477794_c1_18_128 36
485 3300050515 nmdc:mga0a205_217_c1 nmdc:mga0a205_217_c1_17_127 36
486 3300050515 nmdc:mga0a205_436757_c1 nmdc:mga0a205_436757_c1_20_130 36
487 3300050515 nmdc:mga0a205_5725_c1 nmdc:mga0a205_5725_c1_17_127 36
488 3300050515 nmdc:mga0a205_71944_c1 nmdc:mga0a205_71944_c1_18_128 36
489 3300050515 nmdc:mga0a205_8513_c1 nmdc:mga0a205_8513_c1_17_127 36
490 3300050515 nmdc:mga0a205_858260_c1 nmdc:mga0a205_858260_c1_20_130 36
491 3300050515 nmdc:mga0a205_890805_c1 nmdc:mga0a205_890805_c1_616_726 36
492 3300053077 Ga0495601_0178130 Ga0495601_0178130_17_127 36
493 3300053077 Ga0495601_0330931 Ga0495601_0330931_18_128 36
494 3300053077 Ga0495601_0542013 Ga0495601_0542013_20_130 36
495 3300053077 Ga0495601_0692195 Ga0495601_0692195_19_129 36
496 3300053084 Ga0495595_0008781 Ga0495595_0008781_4036_4146 36
497 3300053084 Ga0495595_0442107 Ga0495595_0442107_535_645 36
498 3300053085 Ga0495619_0309947 Ga0495619_0309947_16_126 36
499 3300053090 Ga0500646_0081032 Ga0500646_0081032_865_975 36
500 3300053092 Ga0500583_0102145 Ga0500583_0102145_1282_1392 36
501 3300053109 Ga0500569_048636 Ga0500569_048636_1111_1221 36
502 3300053118 Ga0500594_0006162 Ga0500594_0006162_13_123 36
503 3300053133 Ga0500655_102879 Ga0500655_102879_16_126 36
504 3300053135 Ga0500659_0029531 Ga0500659_0029531_2869_2979 36
505 3300053136 Ga0500559_0055846 Ga0500559_0055846_18_128 36
506 3300053139 Ga0500568_0019513 Ga0500568_0019513_2824_2934 36
507 3300053142 Ga0500577_0429413 Ga0500577_0429413_17_127 36
508 3300053146 Ga0500588_0300409 Ga0500588_0300409_13_123 36
509 3300053153 Ga0500616_0002871 Ga0500616_0002871_13702_13812 36
510 3300053731 Ga0500609_023187 Ga0500609_023187_723_833 36
511 3300054114 Ga0501084_0221824 Ga0501084_0221824_20_130 36
512 3300054114 Ga0501084_0244172 Ga0501084_0244172_18_128 36
513 3300054114 Ga0501084_0363246 Ga0501084_0363246_1103_1213 36
514 3300054114 Ga0501084_0477822 Ga0501084_0477822_14_124 36
515 3300054114 Ga0501084_0642957 Ga0501084_0642957_771_881 36
516 3300059630 Ga0587128_146247 Ga0587128_146247_48_158 36
517 3300060353 Ga0501082_0017750 Ga0501082_0017750_17_127 36
518 3300060353 Ga0501082_0034927 Ga0501082_0034927_10_120 36
519 3300060353 Ga0501082_0037651 Ga0501082_0037651_4047_4157 36
520 3300060353 Ga0501082_0052884 Ga0501082_0052884_13_123 36
521 3300060353 Ga0501082_0212553 Ga0501082_0212553_17_127 36
522 3300060353 Ga0501082_0264134 Ga0501082_0264134_15_125 36
523 3300060353 Ga0501082_1189056 Ga0501082_1189056_543_653 36
524 3300060353 Ga0501082_1242312 Ga0501082_1242312_15_125 36
525 3300061734 Ga0530510_0005256 Ga0530510_0005256_8814_8924 36
526 3300061734 Ga0530510_0053431 Ga0530510_0053431_2794_2904 36
527 3300061734 Ga0530510_0328844 Ga0530510_0328844_18_128 36
528 3300061734 Ga0530510_0401222 Ga0530510_0401222_895_1005 36
529 3300061734 Ga0530510_0685858 Ga0530510_0685858_10_120 36
530 3300061734 Ga0530510_1189294 Ga0530510_1189294_14_124 36
531 3300061734 Ga0530510_1405084 Ga0530510_1405084_411_521 36
532 iso_pu_bacteria 2728369097 2729145535 36
533 iso_pu_bacteria 2728369097 2729147959 36
534 iso_pu_bacteria 2831864461 2831866799 36
535 iso_pu_bacteria 2831864461 2831867498 36
536 iso_pu_bacteria 2928163908 2928170222 36
537 iso_pu_bacteria 8011350971 8011356018 36
538 iso_pu_bacteria 2643221554 2643789315 37
539 3300026089 Ga0207648_11625270 Ga0207648_116252702 38
540 3300039447 Ga0436361_0945621 Ga0436361_0945621_12_134 38
541 3300044712 Ga0453684_0063314 Ga0453684_0063314_12_128 38
542 3300046499 Ga0495594_0594187 Ga0495594_0594187_13_129 38
543 3300046519 Ga0495632_0016912 Ga0495632_0016912_13_129 38
544 3300046519 Ga0495632_0041954 Ga0495632_0041954_13_129 38
545 3300046519 Ga0495632_0362126 Ga0495632_0362126_13_129 38
546 3300046526 Ga0495666_0244369 Ga0495666_0244369_15_131 38
547 3300046663 Ga0495635_0171614 Ga0495635_0171614_10_126 38
548 3300047321 Ga0495676_0600787 Ga0495676_0600787_10_126 38
549 3300048091 Ga0495626_0435464 Ga0495626_0435464_378_494 38
550 3300048916 Ga0496113_0616161 Ga0496113_0616161_10_126 38
551 3300049568 Ga0501031_0001291 Ga0501031_0001291_10_126 38
552 3300049577 Ga0501041_0308485 Ga0501041_0308485_10_126 38
553 3300049649 Ga0501198_000098 Ga0501198_000098_10_126 38
554 3300049662 Ga0501222_000051 Ga0501222_000051_10_126 38
555 3300049775 Ga0501279_048499 Ga0501279_048499_12_128 38
556 3300050490 nmdc:mga03n38_916694_c1 nmdc:mga03n38_916694_c1_15_131 38
557 3300050493 nmdc:mga0k408_39362_c1 nmdc:mga0k408_39362_c1_15_131 38
558 3300053093 Ga0500651_0606138 Ga0500651_0606138_15_131 38
559 3300053108 Ga0500562_118217 Ga0500562_118217_14_130 38
560 3300053131 Ga0500652_001479 Ga0500652_001479_15_131 38
561 3300053131 Ga0500652_005253 Ga0500652_005253_15_131 38
562 3300041456 Ga0451795_0265656 Ga0451795_0265656_14_139 39
563 3300002705 JGI25156J39149_1011939 JGI25156J39149_10119394 43
564 3300003756 Ga0055533_1016828 Ga0055533_10168281 43
565 3300009147 Ga0114129_10533155 Ga0114129_105331553 43
566 3300025919 Ga0207657_10023528 Ga0207657_100235281 43
567 3300033541 Ga0316596_1206465 Ga0316596_12064652 43
568 3300035692 Ga0373935_0116104 Ga0373935_0116104_1623_1760 43
569 3300035692 Ga0373935_0135502 Ga0373935_0135502_1461_1598 43
570 3300035725 Ga0373947_1271655 Ga0373947_1271655_16_153 43
571 3300036647 Ga0316582_0430158 Ga0316582_0430158_738_899 43
572 3300037312 Ga0395899_0600202 Ga0395899_0600202_545_682 43
573 3300037418 Ga0395900_0308519 Ga0395900_0308519_15_152 43
574 3300037418 Ga0395900_0576689 Ga0395900_0576689_15_152 43
575 3300037466 Ga0395898_0082040 Ga0395898_0082040_12_149 43
576 3300037466 Ga0395898_0354291 Ga0395898_0354291_12_149 43
577 3300037471 Ga0395905_0477035 Ga0395905_0477035_15_152 43
578 3300039062 Ga0400483_290960 Ga0400483_290960_66_203 43
579 3300039453 Ga0436362_0486077 Ga0436362_0486077_13_150 43
580 3300041486 Ga0451807_1468850 Ga0451807_1468850_39_176 43
581 3300041491 Ga0451833_1077820 Ga0451833_1077820_503_634 43
582 3300041491 Ga0451833_1176083 Ga0451833_1176083_97_234 43
583 3300041509 Ga0451843_0080072 Ga0451843_0080072_13_150 43
584 3300044656 Ga0466969_0587072 Ga0466969_0587072_32_169 43
585 3300044693 Ga0466961_0180082 Ga0466961_0180082_1163_1300 43
586 3300046462 Ga0495651_0623558 Ga0495651_0623558_523_660 43
587 3300046491 Ga0495584_0028115 Ga0495584_0028115_2692_2829 43
588 3300046615 Ga0495656_0601530 Ga0495656_0601530_426_563 43
589 3300046681 Ga0495647_0270350 Ga0495647_0270350_610_747 43
590 3300048089 Ga0495614_0077439 Ga0495614_0077439_1278_1415 43
591 3300049128 Ga0501308_037632 Ga0501308_037632_18_155 43
592 3300049573 Ga0501037_0044527 Ga0501037_0044527_26_163 43
593 3300049576 Ga0501040_0606974 Ga0501040_0606974_618_749 43
594 3300049583 Ga0501067_0708033 Ga0501067_0708033_411_542 43
595 3300049663 Ga0501223_069458 Ga0501223_069458_20_157 43
596 3300050493 nmdc:mga0k408_91115_c1 nmdc:mga0k408_91115_c1_16_153 43
597 3300050514 nmdc:mga08x19_786251_c1 nmdc:mga08x19_786251_c1_496_633 43
598 3300050515 nmdc:mga0a205_1194525_c1 nmdc:mga0a205_1194525_c1_461_592 43
599 3300053077 Ga0495601_0272943 Ga0495601_0272943_11_148 43
600 3300053151 Ga0500604_0049560 Ga0500604_0049560_1144_1281 43
601 iso_pu_bacteria 2643221592 2643969993 43
602 iso_pu_bacteria 2643221592 2643971587 43
603 iso_pu_bacteria 2643221648 2644275776 43

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03143

GTP_EFTU_D3

Elongation factor Tu C-terminal domain

5

43

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i4q-assembly1.cif.gz_C-2 contact-dependent inhibition system from escherichia coli nc101 - ternary cdia/cdii/ef-tu complex (domains 2 and 3) 0.8767 13 43
4q7j-assembly1.cif.gz_B complex structure of viral rna polymerase 0.8559 13 43
3mmp-assembly1.cif.gz_A structure of the qb replicase, an rna-dependent rna polymerase consisting of viral and host proteins 0.855 13 43
4yba-assembly1.cif.gz_A the structure of the c.kpn2i controller protein 0.8502 23 37
1efu-assembly1.cif.gz_C elongation factor complex ef-tu/ef-ts from escherichia coli 0.8455 13 43
ID Description Score Start End Superfamily
af_G5ECM6_349_448_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9126 13 43 2.40.30.10
4ybaA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8502 23 37 1.10.260.40
1ti2B03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8149 19 39 2.60.40.10
1aipF03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.7198 1 42 2.40.30.10
1aipF03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.6916 1 42 2.40.30.10
ID Description Score Start End GO Terms
AF-A0A2G3K1C8-F1-model_v4 Translation elongation factor EFTu/EF1A C-terminal domain-containing protein 0.9941 18 43 GO:0003746
GO:0005525
AF-A0A2D5FN94-F1-model_v4 Translation elongation factor EFTu/EF1A C-terminal domain-containing protein 0.9914 18 43 GO:0003746
GO:0005525
AF-A0A2G2QRH3-F1-model_v4 Translation elongation factor EFTu/EF1A C-terminal domain-containing protein 0.9909 18 43 GO:0003746
GO:0005525
AF-A0A537JW36-F1-model_v4 Translation elongation factor EFTu/EF1A C-terminal domain-containing protein 0.9895 18 43 GO:0003746
GO:0005525
AF-A0A662Z9K5-F1-model_v4 Elongation factor Tu C-terminal domain-containing protein 0.9894 17 43 GO:0003746
GO:0005525

Feature Viewer

pLDDT pTM Quality
88.2 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map