F468174
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 602 | 242 | 599 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300013100|Ga0157373_10146105|Ga0157373_101461051 |
| Length | 262 |
| Sequence | MHIKECDDAGYFCVNFVLMDTRAKTILIADDEQDILEIISYNLLKEGYIVYTATDGNEALEKARALEPDMLILDVMMPFKSGVEVCKILRSETRFKNTLILILTALSDEGSHIKGLDSGADDYVTKPVSPKVLLSRVNALFRRMVKEENDVLAEGDIIIDSSKYTVSVSGNIVSLARKEFELLHLLASKPGRVFLRNEILEQVWGNEVIVGDRTIDVHIRKIRQKLGVNCIATIKGVGYKFKTPTPSNPPERGEQLHSQILH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 3 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 4 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 161 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 162 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 163 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 164 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 171 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 174 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 175 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 176 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 177 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 178 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 179 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 180 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 181 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 182 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 183 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 184 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 201 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 202 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 203 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 204 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 205 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 206 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 211 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 212 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 213 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 214 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 215 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 216 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 217 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 221 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 222 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 223 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 224 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 225 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 226 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 227 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 228 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 236 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 237 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 238 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 239 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 240 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 241 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 242 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.5 |
| Metatranscriptomes | 0 |
| Isolates | 0.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.66 |
| Nodule | 0 |
| Rhizoplane | 1.33 |
| Rhizosphere | 94.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1761633 | 2162886007 | Bacteria | 195701 |
| 2 | rootH2_10065440 | 3300003320 | Bacteria | 1171 |
| 3 | rootH2_10074209 | 3300003320 | Bacteria | 3946 |
| 4 | rootH1_10066422 | 3300003323 | Bacteria | 27266 |
| 5 | rootH1_10129104 | 3300003323 | Bacteria | 1145 |
| 6 | Ga0065704_10000195 | 3300005289 | Bacteria | 195830 |
| 7 | Ga0065712_10096550 | 3300005290 | Bacteria | 2180 |
| 8 | Ga0065712_10124904 | 3300005290 | Bacteria | 1620 |
| 9 | Ga0065712_10128532 | 3300005290 | Bacteria | 1577 |
| 10 | Ga0065712_10245765 | 3300005290 | Bacteria | 972 |
| 11 | Ga0065715_10090610 | 3300005293 | Bacteria | 6748 |
| 12 | Ga0065715_10260744 | 3300005293 | Bacteria | 1139 |
| 13 | Ga0065715_10473877 | 3300005293 | Bacteria | 803 |
| 14 | Ga0065707_10115231 | 3300005295 | Bacteria | 2243 |
| 15 | Ga0065707_10236188 | 3300005295 | Bacteria | 1171 |
| 16 | Ga0070676_10049174 | 3300005328 | Bacteria | 2467 |
| 17 | Ga0070683_100046386 | 3300005329 | Bacteria | 4014 |
| 18 | Ga0070683_100049865 | 3300005329 | Bacteria | 3873 |
| 19 | Ga0070683_100058948 | 3300005329 | Bacteria | 3566 |
| 20 | Ga0070683_100075761 | 3300005329 | Bacteria | 3144 |
| 21 | Ga0070683_100313736 | 3300005329 | Unclassified | 1492 |
| 22 | Ga0070683_100454956 | 3300005329 | Bacteria | 1221 |
| 23 | Ga0070670_100013054 | 3300005331 | Bacteria | 7115 |
| 24 | Ga0070670_100344217 | 3300005331 | Bacteria | 1309 |
| 25 | Ga0070670_100403715 | 3300005331 | Bacteria | 1207 |
| 26 | Ga0070670_100513741 | 3300005331 | Bacteria | 1066 |
| 27 | Ga0070670_100700287 | 3300005331 | Unclassified | 911 |
| 28 | Ga0070677_10010649 | 3300005333 | Bacteria | 3150 |
| 29 | Ga0070677_10022835 | 3300005333 | Bacteria | 2309 |
| 30 | Ga0068869_100029819 | 3300005334 | Bacteria | 3826 |
| 31 | Ga0068869_100035175 | 3300005334 | Bacteria | 3549 |
| 32 | Ga0068869_100188993 | 3300005334 | Bacteria | 1619 |
| 33 | Ga0068869_100226458 | 3300005334 | Bacteria | 1484 |
| 34 | Ga0070666_10030514 | 3300005335 | Bacteria | 3552 |
| 35 | Ga0070680_100057598 | 3300005336 | Bacteria | 3177 |
| 36 | Ga0070680_100063326 | 3300005336 | Bacteria | 3029 |
| 37 | Ga0070680_100203830 | 3300005336 | Bacteria | 1668 |
| 38 | Ga0070682_100000898 | 3300005337 | Bacteria | 17372 |
| 39 | Ga0070682_100005002 | 3300005337 | Bacteria | 7367 |
| 40 | Ga0068868_100014752 | 3300005338 | Bacteria | 5765 |
| 41 | Ga0068868_100054094 | 3300005338 | Bacteria | 3163 |
| 42 | Ga0068868_100123198 | 3300005338 | Bacteria | 2116 |
| 43 | Ga0070660_100011614 | 3300005339 | Bacteria | 6269 |
| 44 | Ga0070689_100003385 | 3300005340 | Bacteria | 10599 |
| 45 | Ga0070689_100008847 | 3300005340 | Bacteria | 7113 |
| 46 | Ga0070689_100663633 | 3300005340 | Bacteria | 908 |
| 47 | Ga0070687_100059417 | 3300005343 | Bacteria | 2013 |
| 48 | Ga0070661_100039511 | 3300005344 | Unclassified | 3438 |
| 49 | Ga0070661_100057180 | 3300005344 | Bacteria | 2858 |
| 50 | Ga0070668_100112716 | 3300005347 | Bacteria | 2166 |
| 51 | Ga0070668_100827447 | 3300005347 | Bacteria | 824 |
| 52 | Ga0070669_100042552 | 3300005353 | Bacteria | 3306 |
| 53 | Ga0070669_100150233 | 3300005353 | Unclassified | 1803 |
| 54 | Ga0070669_100206427 | 3300005353 | Bacteria | 1548 |
| 55 | Ga0070675_100005601 | 3300005354 | Bacteria | 9614 |
| 56 | Ga0070675_100015260 | 3300005354 | Bacteria | 6068 |
| 57 | Ga0070675_100056672 | 3300005354 | Bacteria | 3230 |
| 58 | Ga0070675_100177114 | 3300005354 | Unclassified | 1842 |
| 59 | Ga0070675_100234266 | 3300005354 | Bacteria | 1602 |
| 60 | Ga0070675_100243270 | 3300005354 | Bacteria | 1572 |
| 61 | Ga0070675_100577049 | 3300005354 | Bacteria | 1019 |
| 62 | Ga0070671_100177789 | 3300005355 | Bacteria | 1801 |
| 63 | Ga0070671_100232015 | 3300005355 | Bacteria | 1566 |
| 64 | Ga0070674_100084865 | 3300005356 | Unclassified | 2272 |
| 65 | Ga0070674_100123610 | 3300005356 | Bacteria | 1919 |
| 66 | Ga0070674_100151011 | 3300005356 | Bacteria | 1753 |
| 67 | Ga0070673_100019319 | 3300005364 | Bacteria | 4890 |
| 68 | Ga0070673_100060957 | 3300005364 | Bacteria | 2992 |
| 69 | Ga0070673_100084804 | 3300005364 | Bacteria | 2577 |
| 70 | Ga0070673_100219867 | 3300005364 | Bacteria | 1643 |
| 71 | Ga0070673_100223058 | 3300005364 | Bacteria | 1632 |
| 72 | Ga0070673_100546314 | 3300005364 | Bacteria | 1052 |
| 73 | Ga0070688_100009182 | 3300005365 | Bacteria | 5396 |
| 74 | Ga0070688_100010676 | 3300005365 | Bacteria | 5072 |
| 75 | Ga0070688_100041228 | 3300005365 | Bacteria | 2833 |
| 76 | Ga0070688_100100078 | 3300005365 | Bacteria | 1910 |
| 77 | Ga0070688_100407708 | 3300005365 | Bacteria | 1007 |
| 78 | Ga0070659_100002201 | 3300005366 | Bacteria | 13860 |
| 79 | Ga0070659_100003217 | 3300005366 | Bacteria | 11629 |
| 80 | Ga0070659_100003749 | 3300005366 | Bacteria | 10841 |
| 81 | Ga0070667_100024448 | 3300005367 | Bacteria | 5017 |
| 82 | Ga0070667_100041132 | 3300005367 | Bacteria | 3878 |
| 83 | Ga0070667_100042965 | 3300005367 | Bacteria | 3792 |
| 84 | Ga0070667_100540380 | 3300005367 | Unclassified | 1070 |
| 85 | Ga0070714_100000213 | 3300005435 | Bacteria | 46491 |
| 86 | Ga0070701_10155713 | 3300005438 | Bacteria | 1320 |
| 87 | Ga0070700_100108807 | 3300005441 | Bacteria | 1839 |
| 88 | Ga0070700_100305551 | 3300005441 | Bacteria | 1163 |
| 89 | Ga0070663_100202030 | 3300005455 | Bacteria | 1552 |
| 90 | Ga0070663_100415306 | 3300005455 | Bacteria | 1103 |
| 91 | Ga0070678_100012999 | 3300005456 | Bacteria | 5199 |
| 92 | Ga0070678_100029146 | 3300005456 | Bacteria | 3776 |
| 93 | Ga0070678_100053833 | 3300005456 | Bacteria | 2929 |
| 94 | Ga0070662_100002589 | 3300005457 | Bacteria | 11146 |
| 95 | Ga0070662_100160087 | 3300005457 | Unclassified | 1760 |
| 96 | Ga0070681_10023171 | 3300005458 | Bacteria | 6246 |
| 97 | Ga0070681_10065136 | 3300005458 | Bacteria | 3613 |
| 98 | Ga0070681_10189768 | 3300005458 | Bacteria | 1975 |
| 99 | Ga0068867_100171690 | 3300005459 | Bacteria | 1718 |
| 100 | Ga0068867_100175283 | 3300005459 | Bacteria | 1701 |
| 101 | Ga0068867_100178808 | 3300005459 | Bacteria | 1685 |
| 102 | Ga0068867_100182422 | 3300005459 | Bacteria | 1670 |
| 103 | Ga0068867_100283271 | 3300005459 | Bacteria | 1360 |
| 104 | Ga0068867_100479142 | 3300005459 | Unclassified | 1066 |
| 105 | Ga0068867_100712168 | 3300005459 | Bacteria | 887 |
| 106 | Ga0070685_10042099 | 3300005466 | Bacteria | 2604 |
| 107 | Ga0070685_10139106 | 3300005466 | Bacteria | 1526 |
| 108 | Ga0070698_100002073 | 3300005471 | Bacteria | 22283 |
| 109 | Ga0070698_100006662 | 3300005471 | Bacteria | 12525 |
| 110 | Ga0070679_100410669 | 3300005530 | Bacteria | 1299 |
| 111 | Ga0070679_100521239 | 3300005530 | Bacteria | 1132 |
| 112 | Ga0070679_100707561 | 3300005530 | Bacteria | 950 |
| 113 | Ga0070684_100000986 | 3300005535 | Bacteria | 20347 |
| 114 | Ga0070684_100029966 | 3300005535 | Bacteria | 4618 |
| 115 | Ga0070684_100049346 | 3300005535 | Bacteria | 3652 |
| 116 | Ga0070684_100159848 | 3300005535 | Bacteria | 2043 |
| 117 | Ga0068853_100020987 | 3300005539 | Bacteria | 5437 |
| 118 | Ga0068853_100031075 | 3300005539 | Bacteria | 4515 |
| 119 | Ga0068853_100161431 | 3300005539 | Bacteria | 2023 |
| 120 | Ga0070672_100175708 | 3300005543 | Bacteria | 1783 |
| 121 | Ga0070672_100490682 | 3300005543 | Bacteria | 1061 |
| 122 | Ga0070672_100688149 | 3300005543 | Unclassified | 895 |
| 123 | Ga0070672_100705768 | 3300005543 | Unclassified | 883 |
| 124 | Ga0070686_100019936 | 3300005544 | Unclassified | 3962 |
| 125 | Ga0070686_100046065 | 3300005544 | Bacteria | 2750 |
| 126 | Ga0070693_100140584 | 3300005547 | Bacteria | 1519 |
| 127 | Ga0070693_100202030 | 3300005547 | Unclassified | 1291 |
| 128 | Ga0070665_100003118 | 3300005548 | Bacteria | 17855 |
| 129 | Ga0070665_100211811 | 3300005548 | Bacteria | 1939 |
| 130 | Ga0068855_100010405 | 3300005563 | Bacteria | 11221 |
| 131 | Ga0068855_100071437 | 3300005563 | Bacteria | 4036 |
| 132 | Ga0070664_100001066 | 3300005564 | Bacteria | 21588 |
| 133 | Ga0070664_100010988 | 3300005564 | Bacteria | 7341 |
| 134 | Ga0070664_100015196 | 3300005564 | Bacteria | 6290 |
| 135 | Ga0070664_100182884 | 3300005564 | Bacteria | 1864 |
| 136 | Ga0070664_100202292 | 3300005564 | Bacteria | 1772 |
| 137 | Ga0070664_100445671 | 3300005564 | Bacteria | 1188 |
| 138 | Ga0070664_100713386 | 3300005564 | Bacteria | 935 |
| 139 | Ga0068857_100001057 | 3300005577 | Bacteria | 21331 |
| 140 | Ga0068857_100036876 | 3300005577 | Bacteria | 4331 |
| 141 | Ga0068857_100084064 | 3300005577 | Bacteria | 2844 |
| 142 | Ga0068857_100089028 | 3300005577 | Bacteria | 2762 |
| 143 | Ga0068857_100159720 | 3300005577 | Bacteria | 2045 |
| 144 | Ga0068857_100170350 | 3300005577 | Bacteria | 1979 |
| 145 | Ga0068857_100294249 | 3300005577 | Bacteria | 1496 |
| 146 | Ga0068857_100795688 | 3300005577 | Bacteria | 903 |
| 147 | Ga0068854_100017804 | 3300005578 | Bacteria | 4761 |
| 148 | Ga0068854_100036801 | 3300005578 | Bacteria | 3433 |
| 149 | Ga0068854_100080884 | 3300005578 | Bacteria | 2398 |
| 150 | Ga0068854_100089597 | 3300005578 | Bacteria | 2286 |
| 151 | Ga0068854_100105409 | 3300005578 | Bacteria | 2119 |
| 152 | Ga0068854_100273553 | 3300005578 | Bacteria | 1357 |
| 153 | Ga0068854_100467290 | 3300005578 | Bacteria | 1057 |
| 154 | Ga0068854_100794721 | 3300005578 | Unclassified | 824 |
| 155 | Ga0068856_100008272 | 3300005614 | Bacteria | 10141 |
| 156 | Ga0068852_100000408 | 3300005616 | Bacteria | 28653 |
| 157 | Ga0068852_100025982 | 3300005616 | Bacteria | 4752 |
| 158 | Ga0068852_100031046 | 3300005616 | Bacteria | 4403 |
| 159 | Ga0068852_100079172 | 3300005616 | Bacteria | 2910 |
| 160 | Ga0068852_100201924 | 3300005616 | Unclassified | 1881 |
| 161 | Ga0068852_100205485 | 3300005616 | Unclassified | 1865 |
| 162 | Ga0068852_100247315 | 3300005616 | Bacteria | 1707 |
| 163 | Ga0068859_100020034 | 3300005617 | Bacteria | 6717 |
| 164 | Ga0068859_100070778 | 3300005617 | Bacteria | 3523 |
| 165 | Ga0068859_100107278 | 3300005617 | Bacteria | 2853 |
| 166 | Ga0068859_100123761 | 3300005617 | Bacteria | 2654 |
| 167 | Ga0068859_100148481 | 3300005617 | Bacteria | 2420 |
| 168 | Ga0068859_100482953 | 3300005617 | Bacteria | 1334 |
| 169 | Ga0068859_100507894 | 3300005617 | Bacteria | 1300 |
| 170 | Ga0068864_100005255 | 3300005618 | Bacteria | 10613 |
| 171 | Ga0068864_100022550 | 3300005618 | Bacteria | 5279 |
| 172 | Ga0068864_100045643 | 3300005618 | Bacteria | 3759 |
| 173 | Ga0068864_100092076 | 3300005618 | Unclassified | 2675 |
| 174 | Ga0068864_100279551 | 3300005618 | Bacteria | 1558 |
| 175 | Ga0068866_10141056 | 3300005718 | Bacteria | 1383 |
| 176 | Ga0068866_10363056 | 3300005718 | Bacteria | 924 |
| 177 | Ga0068861_100096295 | 3300005719 | Bacteria | 2345 |
| 178 | Ga0068861_100214083 | 3300005719 | Bacteria | 1625 |
| 179 | Ga0068861_100441983 | 3300005719 | Bacteria | 1163 |
| 180 | Ga0068861_100527192 | 3300005719 | Bacteria | 1072 |
| 181 | Ga0068861_100639610 | 3300005719 | Bacteria | 981 |
| 182 | Ga0068851_10090891 | 3300005834 | Unclassified | 1607 |
| 183 | Ga0068870_10245413 | 3300005840 | Bacteria | 1108 |
| 184 | Ga0068863_100101824 | 3300005841 | Bacteria | 2731 |
| 185 | Ga0068863_100125348 | 3300005841 | Bacteria | 2450 |
| 186 | Ga0068863_100139886 | 3300005841 | Bacteria | 2313 |
| 187 | Ga0068863_100219986 | 3300005841 | Bacteria | 1829 |
| 188 | Ga0068858_100028827 | 3300005842 | Bacteria | 5154 |
| 189 | Ga0068858_100049735 | 3300005842 | Bacteria | 3881 |
| 190 | Ga0068858_100222372 | 3300005842 | Bacteria | 1788 |
| 191 | Ga0068858_100409755 | 3300005842 | Bacteria | 1303 |
| 192 | Ga0068860_100072884 | 3300005843 | Unclassified | 3264 |
| 193 | Ga0068860_100336253 | 3300005843 | Bacteria | 1484 |
| 194 | Ga0081539_10000524 | 3300005985 | Bacteria | 79740 |
| 195 | Ga0081539_10018196 | 3300005985 | Bacteria | 4890 |
| 196 | Ga0070716_100025385 | 3300006173 | Unclassified | 3162 |
| 197 | Ga0075366_10181519 | 3300006195 | Bacteria | 1278 |
| 198 | Ga0097621_100019762 | 3300006237 | Bacteria | 5178 |
| 199 | Ga0097621_100061777 | 3300006237 | Bacteria | 3073 |
| 200 | Ga0097621_100091931 | 3300006237 | Bacteria | 2540 |
| 201 | Ga0097621_100101648 | 3300006237 | Bacteria | 2419 |
| 202 | Ga0097621_100105161 | 3300006237 | Bacteria | 2379 |
| 203 | Ga0097621_100339013 | 3300006237 | Bacteria | 1335 |
| 204 | Ga0068871_100002698 | 3300006358 | Bacteria | 12109 |
| 205 | Ga0068871_100005072 | 3300006358 | Bacteria | 9199 |
| 206 | Ga0068871_100038927 | 3300006358 | Bacteria | 3802 |
| 207 | Ga0068871_100148795 | 3300006358 | Bacteria | 1996 |
| 208 | Ga0068871_100200844 | 3300006358 | Bacteria | 1721 |
| 209 | Ga0068871_100849822 | 3300006358 | Bacteria | 844 |
| 210 | Ga0075428_100125178 | 3300006844 | Bacteria | 2797 |
| 211 | Ga0075428_100645923 | 3300006844 | Bacteria | 1129 |
| 212 | Ga0075431_100000819 | 3300006847 | Bacteria | 27158 |
| 213 | Ga0075434_100216525 | 3300006871 | Bacteria | 1935 |
| 214 | Ga0075429_100008423 | 3300006880 | Bacteria | 8972 |
| 215 | Ga0068865_100769389 | 3300006881 | Unclassified | 828 |
| 216 | Ga0097620_100020031 | 3300006931 | Bacteria | 6717 |
| 217 | Ga0097620_100070782 | 3300006931 | Bacteria | 3523 |
| 218 | Ga0097620_100107270 | 3300006931 | Bacteria | 2853 |
| 219 | Ga0097620_100123764 | 3300006931 | Bacteria | 2654 |
| 220 | Ga0097620_100148482 | 3300006931 | Bacteria | 2420 |
| 221 | Ga0097620_100482965 | 3300006931 | Bacteria | 1334 |
| 222 | Ga0097620_100507894 | 3300006931 | Bacteria | 1300 |
| 223 | Ga0105240_10000101 | 3300009093 | Bacteria | 175584 |
| 224 | Ga0105240_10151300 | 3300009093 | Bacteria | 2763 |
| 225 | Ga0105240_10921005 | 3300009093 | Bacteria | 939 |
| 226 | Ga0111539_10429915 | 3300009094 | Bacteria | 1537 |
| 227 | Ga0111539_10544238 | 3300009094 | Bacteria | 1352 |
| 228 | Ga0105245_10077676 | 3300009098 | Bacteria | 3027 |
| 229 | Ga0105247_10094997 | 3300009101 | Bacteria | 1898 |
| 230 | Ga0105247_10111194 | 3300009101 | Unclassified | 1764 |
| 231 | Ga0105247_10171955 | 3300009101 | Bacteria | 1441 |
| 232 | Ga0114129_10015558 | 3300009147 | Bacteria | 10816 |
| 233 | Ga0114129_10085834 | 3300009147 | Bacteria | 4367 |
| 234 | Ga0105241_10019760 | 3300009174 | Bacteria | 4971 |
| 235 | Ga0105242_10001554 | 3300009176 | Bacteria | 18062 |
| 236 | Ga0105242_10255104 | 3300009176 | Unclassified | 1582 |
| 237 | Ga0105242_10514240 | 3300009176 | Bacteria | 1141 |
| 238 | Ga0105242_10955308 | 3300009176 | Bacteria | 861 |
| 239 | Ga0105248_10532062 | 3300009177 | Unclassified | 1325 |
| 240 | Ga0105237_10011018 | 3300009545 | Bacteria | 9593 |
| 241 | Ga0105249_10004487 | 3300009553 | Bacteria | 12067 |
| 242 | Ga0105249_10047237 | 3300009553 | Bacteria | 3922 |
| 243 | Ga0105249_10168679 | 3300009553 | Bacteria | 2121 |
| 244 | Ga0105249_10950361 | 3300009553 | Unclassified | 927 |
| 245 | Ga0105239_10001340 | 3300010375 | Bacteria | 33201 |
| 246 | Ga0105239_10136443 | 3300010375 | Unclassified | 2731 |
| 247 | Ga0105239_10258554 | 3300010375 | Unclassified | 1956 |
| 248 | Ga0105246_10470554 | 3300011119 | Unclassified | 1061 |
| 249 | Ga0157373_10005796 | 3300013100 | Bacteria | 9249 |
| 250 | Ga0157373_10016506 | 3300013100 | Bacteria | 5384 |
| 251 | Ga0157373_10070571 | 3300013100 | Bacteria | 2469 |
| 252 | Ga0157373_10146105 | 3300013100 | Bacteria | 1663 |
| 253 | Ga0157373_10284207 | 3300013100 | Unclassified | 1173 |
| 254 | Ga0157373_10297973 | 3300013100 | Bacteria | 1144 |
| 255 | Ga0157371_10010553 | 3300013102 | Bacteria | 7179 |
| 256 | Ga0157371_10017434 | 3300013102 | Bacteria | 5334 |
| 257 | Ga0157371_10047056 | 3300013102 | Unclassified | 3066 |
| 258 | Ga0157370_10155762 | 3300013104 | Bacteria | 2125 |
| 259 | Ga0157370_10157212 | 3300013104 | Bacteria | 2115 |
| 260 | Ga0157370_10186269 | 3300013104 | Bacteria | 1927 |
| 261 | Ga0157370_10724093 | 3300013104 | Bacteria | 907 |
| 262 | Ga0157369_10003623 | 3300013105 | Bacteria | 18334 |
| 263 | Ga0157369_10017929 | 3300013105 | Bacteria | 7948 |
| 264 | Ga0157369_10188310 | 3300013105 | Bacteria | 2169 |
| 265 | Ga0157369_10436905 | 3300013105 | Bacteria | 1356 |
| 266 | Ga0157369_10492352 | 3300013105 | Bacteria | 1268 |
| 267 | Ga0157374_10004211 | 3300013296 | Bacteria | 12089 |
| 268 | Ga0157374_10005248 | 3300013296 | Bacteria | 10870 |
| 269 | Ga0157374_10032695 | 3300013296 | Bacteria | 4739 |
| 270 | Ga0157374_10202733 | 3300013296 | Bacteria | 1943 |
| 271 | Ga0157374_10213415 | 3300013296 | Unclassified | 1893 |
| 272 | Ga0157374_10337840 | 3300013296 | Bacteria | 1495 |
| 273 | Ga0157374_10341585 | 3300013296 | Bacteria | 1486 |
| 274 | Ga0157374_10994066 | 3300013296 | Bacteria | 858 |
| 275 | Ga0157378_10010878 | 3300013297 | Bacteria | 7958 |
| 276 | Ga0157378_10042212 | 3300013297 | Bacteria | 4048 |
| 277 | Ga0157378_10113280 | 3300013297 | Bacteria | 2490 |
| 278 | Ga0157378_10121852 | 3300013297 | Bacteria | 2405 |
| 279 | Ga0157378_10195698 | 3300013297 | Unclassified | 1909 |
| 280 | Ga0157378_10913927 | 3300013297 | Bacteria | 909 |
| 281 | Ga0157378_11077751 | 3300013297 | Bacteria | 840 |
| 282 | Ga0163162_10001289 | 3300013306 | Bacteria | 23440 |
| 283 | Ga0163162_10006811 | 3300013306 | Bacteria | 11085 |
| 284 | Ga0163162_10017115 | 3300013306 | Bacteria | 7092 |
| 285 | Ga0163162_10033618 | 3300013306 | Bacteria | 5097 |
| 286 | Ga0163162_10045996 | 3300013306 | Bacteria | 4374 |
| 287 | Ga0163162_10054911 | 3300013306 | Unclassified | 4008 |
| 288 | Ga0163162_10137523 | 3300013306 | Bacteria | 2555 |
| 289 | Ga0163162_10190195 | 3300013306 | Bacteria | 2180 |
| 290 | Ga0163162_10803724 | 3300013306 | Unclassified | 1058 |
| 291 | Ga0157372_10022749 | 3300013307 | Bacteria | 6786 |
| 292 | Ga0157372_10033595 | 3300013307 | Bacteria | 5636 |
| 293 | Ga0157372_10069540 | 3300013307 | Bacteria | 3959 |
| 294 | Ga0157372_10079978 | 3300013307 | Bacteria | 3697 |
| 295 | Ga0157372_10096584 | 3300013307 | Bacteria | 3368 |
| 296 | Ga0157372_10104668 | 3300013307 | Bacteria | 3236 |
| 297 | Ga0157372_10107948 | 3300013307 | Bacteria | 3185 |
| 298 | Ga0157372_10112593 | 3300013307 | Bacteria | 3118 |
| 299 | Ga0157372_10358283 | 3300013307 | Bacteria | 1700 |
| 300 | Ga0157372_10699290 | 3300013307 | Bacteria | 1180 |
| 301 | Ga0157375_10016793 | 3300013308 | Bacteria | 6589 |
| 302 | Ga0157375_10039198 | 3300013308 | Unclassified | 4558 |
| 303 | Ga0157375_10078879 | 3300013308 | Bacteria | 3327 |
| 304 | Ga0157375_10195399 | 3300013308 | Unclassified | 2178 |
| 305 | Ga0157375_10317586 | 3300013308 | Bacteria | 1722 |
| 306 | Ga0157375_10338491 | 3300013308 | Bacteria | 1670 |
| 307 | Ga0163163_10000057 | 3300014325 | Bacteria | 124939 |
| 308 | Ga0163163_10342084 | 3300014325 | Bacteria | 1551 |
| 309 | Ga0163163_10349577 | 3300014325 | Bacteria | 1534 |
| 310 | Ga0163163_10588390 | 3300014325 | Bacteria | 1176 |
| 311 | Ga0157380_10030721 | 3300014326 | Bacteria | 4116 |
| 312 | Ga0157380_10558024 | 3300014326 | Bacteria | 1125 |
| 313 | Ga0157380_10678080 | 3300014326 | Bacteria | 1032 |
| 314 | Ga0157377_10009380 | 3300014745 | Bacteria | 4799 |
| 315 | Ga0157377_10027666 | 3300014745 | Bacteria | 3047 |
| 316 | Ga0157377_10121908 | 3300014745 | Bacteria | 1581 |
| 317 | Ga0157377_10245197 | 3300014745 | Unclassified | 1158 |
| 318 | Ga0157377_10250416 | 3300014745 | Bacteria | 1148 |
| 319 | Ga0157377_10277173 | 3300014745 | Bacteria | 1098 |
| 320 | Ga0157379_10019926 | 3300014968 | Bacteria | 5926 |
| 321 | Ga0157379_10056176 | 3300014968 | Bacteria | 3518 |
| 322 | Ga0157379_10142004 | 3300014968 | Bacteria | 2165 |
| 323 | Ga0157379_10161719 | 3300014968 | Bacteria | 2021 |
| 324 | Ga0157379_10532538 | 3300014968 | Bacteria | 1091 |
| 325 | Ga0157376_10024500 | 3300014969 | Bacteria | 4739 |
| 326 | Ga0157376_10134873 | 3300014969 | Bacteria | 2208 |
| 327 | Ga0157376_10462459 | 3300014969 | Bacteria | 1240 |
| 328 | Ga0157376_11136568 | 3300014969 | Bacteria | 808 |
| 329 | Ga0182005_1066751 | 3300015265 | Bacteria | 986 |
| 330 | Ga0163161_10001319 | 3300017792 | Bacteria | 18478 |
| 331 | Ga0163161_10035337 | 3300017792 | Bacteria | 3576 |
| 332 | Ga0163161_10043822 | 3300017792 | Bacteria | 3222 |
| 333 | Ga0163161_10092411 | 3300017792 | Unclassified | 2240 |
| 334 | Ga0163161_10161003 | 3300017792 | Bacteria | 1711 |
| 335 | Ga0163161_10345879 | 3300017792 | Bacteria | 1181 |
| 336 | Ga0163161_10703309 | 3300017792 | Bacteria | 842 |
| 337 | Ga0213876_10001203 | 3300021384 | Bacteria | 16315 |
| 338 | Ga0213876_10209154 | 3300021384 | Bacteria | 1037 |
| 339 | Ga0207697_10068658 | 3300025315 | Unclassified | 1483 |
| 340 | Ga0207682_10006104 | 3300025893 | Bacteria | 4871 |
| 341 | Ga0207682_10065741 | 3300025893 | Bacteria | 1527 |
| 342 | Ga0207680_10064779 | 3300025903 | Bacteria | 2242 |
| 343 | Ga0207647_10000086 | 3300025904 | Bacteria | 71173 |
| 344 | Ga0207647_10023084 | 3300025904 | Bacteria | 4120 |
| 345 | Ga0207647_10098581 | 3300025904 | Bacteria | 1736 |
| 346 | Ga0207647_10208181 | 3300025904 | Unclassified | 1130 |
| 347 | Ga0207645_10016219 | 3300025907 | Bacteria | 4934 |
| 348 | Ga0207645_10321236 | 3300025907 | Bacteria | 1032 |
| 349 | Ga0207643_10203062 | 3300025908 | Bacteria | 1207 |
| 350 | Ga0207705_10590150 | 3300025909 | Bacteria | 864 |
| 351 | Ga0207654_10136045 | 3300025911 | Unclassified | 1561 |
| 352 | Ga0207654_10377523 | 3300025911 | Bacteria | 981 |
| 353 | Ga0207707_10072889 | 3300025912 | Bacteria | 2994 |
| 354 | Ga0207707_10336164 | 3300025912 | Bacteria | 1303 |
| 355 | Ga0207707_10526505 | 3300025912 | Bacteria | 1006 |
| 356 | Ga0207695_10000020 | 3300025913 | Bacteria | 723025 |
| 357 | Ga0207695_10032968 | 3300025913 | Bacteria | 5659 |
| 358 | Ga0207671_10000149 | 3300025914 | Bacteria | 107722 |
| 359 | Ga0207671_10586589 | 3300025914 | Unclassified | 888 |
| 360 | Ga0207660_10118783 | 3300025917 | Bacteria | 2000 |
| 361 | Ga0207660_10140282 | 3300025917 | Bacteria | 1847 |
| 362 | Ga0207660_10300782 | 3300025917 | Bacteria | 1277 |
| 363 | Ga0207660_10336967 | 3300025917 | Bacteria | 1207 |
| 364 | Ga0207662_10024602 | 3300025918 | Bacteria | 3465 |
| 365 | Ga0207657_10002631 | 3300025919 | Bacteria | 19391 |
| 366 | Ga0207657_10015448 | 3300025919 | Bacteria | 7395 |
| 367 | Ga0207657_10056878 | 3300025919 | Bacteria | 3373 |
| 368 | Ga0207657_10166852 | 3300025919 | Bacteria | 1785 |
| 369 | Ga0207657_10177070 | 3300025919 | Bacteria | 1725 |
| 370 | Ga0207649_10007616 | 3300025920 | Bacteria | 5887 |
| 371 | Ga0207649_10240879 | 3300025920 | Bacteria | 1298 |
| 372 | Ga0207649_10578119 | 3300025920 | Unclassified | 862 |
| 373 | Ga0207681_10176420 | 3300025923 | Bacteria | 1624 |
| 374 | Ga0207681_10243954 | 3300025923 | Bacteria | 1400 |
| 375 | Ga0207681_10514777 | 3300025923 | Bacteria | 981 |
| 376 | Ga0207650_10086041 | 3300025925 | Bacteria | 2392 |
| 377 | Ga0207650_10099559 | 3300025925 | Bacteria | 2235 |
| 378 | Ga0207650_10185890 | 3300025925 | Bacteria | 1658 |
| 379 | Ga0207650_10301321 | 3300025925 | Bacteria | 1309 |
| 380 | Ga0207650_10330083 | 3300025925 | Bacteria | 1251 |
| 381 | Ga0207650_10579723 | 3300025925 | Bacteria | 942 |
| 382 | Ga0207659_10005468 | 3300025926 | Bacteria | 7702 |
| 383 | Ga0207659_10027410 | 3300025926 | Bacteria | 3857 |
| 384 | Ga0207659_10030351 | 3300025926 | Bacteria | 3692 |
| 385 | Ga0207659_10050668 | 3300025926 | Bacteria | 2950 |
| 386 | Ga0207659_10073851 | 3300025926 | Bacteria | 2498 |
| 387 | Ga0207664_10000130 | 3300025929 | Bacteria | 65679 |
| 388 | Ga0207644_10077167 | 3300025931 | Bacteria | 2453 |
| 389 | Ga0207644_10138276 | 3300025931 | Bacteria | 1873 |
| 390 | Ga0207690_10010195 | 3300025932 | Bacteria | 5581 |
| 391 | Ga0207690_10017217 | 3300025932 | Bacteria | 4410 |
| 392 | Ga0207690_10042849 | 3300025932 | Bacteria | 2975 |
| 393 | Ga0207690_10100160 | 3300025932 | Bacteria | 2067 |
| 394 | Ga0207706_10002123 | 3300025933 | Bacteria | 19419 |
| 395 | Ga0207706_10003789 | 3300025933 | Bacteria | 14414 |
| 396 | Ga0207706_10015762 | 3300025933 | Bacteria | 6831 |
| 397 | Ga0207706_10163155 | 3300025933 | Unclassified | 1959 |
| 398 | Ga0207686_10001429 | 3300025934 | Bacteria | 13535 |
| 399 | Ga0207686_10076778 | 3300025934 | Bacteria | 2167 |
| 400 | Ga0207670_10008526 | 3300025936 | Bacteria | 5791 |
| 401 | Ga0207670_10120250 | 3300025936 | Bacteria | 1908 |
| 402 | Ga0207670_10148279 | 3300025936 | Bacteria | 1737 |
| 403 | Ga0207669_10074226 | 3300025937 | Bacteria | 2150 |
| 404 | Ga0207669_10315714 | 3300025937 | Bacteria | 1194 |
| 405 | Ga0207704_10284718 | 3300025938 | Bacteria | 1258 |
| 406 | Ga0207691_10023665 | 3300025940 | Bacteria | 5783 |
| 407 | Ga0207691_10083725 | 3300025940 | Unclassified | 2864 |
| 408 | Ga0207691_10283220 | 3300025940 | Bacteria | 1426 |
| 409 | Ga0207691_10800613 | 3300025940 | Bacteria | 792 |
| 410 | Ga0207711_10029203 | 3300025941 | Bacteria | 4648 |
| 411 | Ga0207689_10018112 | 3300025942 | Bacteria | 5948 |
| 412 | Ga0207689_10031915 | 3300025942 | Bacteria | 4380 |
| 413 | Ga0207689_10066606 | 3300025942 | Bacteria | 2960 |
| 414 | Ga0207689_10086264 | 3300025942 | Bacteria | 2580 |
| 415 | Ga0207661_10028655 | 3300025944 | Bacteria | 4267 |
| 416 | Ga0207661_10144623 | 3300025944 | Bacteria | 2050 |
| 417 | Ga0207661_10347514 | 3300025944 | Unclassified | 1337 |
| 418 | Ga0207661_10540867 | 3300025944 | Bacteria | 1067 |
| 419 | Ga0207679_10052725 | 3300025945 | Bacteria | 2985 |
| 420 | Ga0207679_10069183 | 3300025945 | Bacteria | 2655 |
| 421 | Ga0207679_10091130 | 3300025945 | Bacteria | 2358 |
| 422 | Ga0207679_10290285 | 3300025945 | Bacteria | 1406 |
| 423 | Ga0207667_10042462 | 3300025949 | Bacteria | 4833 |
| 424 | Ga0207667_10109792 | 3300025949 | Bacteria | 2845 |
| 425 | Ga0207667_10424047 | 3300025949 | Bacteria | 1353 |
| 426 | Ga0207667_10754823 | 3300025949 | Bacteria | 972 |
| 427 | Ga0207651_10109883 | 3300025960 | Bacteria | 2067 |
| 428 | Ga0207651_10164013 | 3300025960 | Bacteria | 1745 |
| 429 | Ga0207651_10294594 | 3300025960 | Bacteria | 1347 |
| 430 | Ga0207651_10442176 | 3300025960 | Unclassified | 1114 |
| 431 | Ga0207651_10664613 | 3300025960 | Unclassified | 915 |
| 432 | Ga0207712_10080263 | 3300025961 | Bacteria | 2372 |
| 433 | Ga0207668_10304116 | 3300025972 | Unclassified | 1317 |
| 434 | Ga0207640_10079271 | 3300025981 | Unclassified | 2238 |
| 435 | Ga0207640_10128902 | 3300025981 | Bacteria | 1825 |
| 436 | Ga0207640_10157065 | 3300025981 | Bacteria | 1678 |
| 437 | Ga0207640_10498353 | 3300025981 | Bacteria | 1014 |
| 438 | Ga0207640_10623176 | 3300025981 | Unclassified | 916 |
| 439 | Ga0207658_10110947 | 3300025986 | Unclassified | 2168 |
| 440 | Ga0207658_10180213 | 3300025986 | Bacteria | 1748 |
| 441 | Ga0207677_10027624 | 3300026023 | Bacteria | 3578 |
| 442 | Ga0207677_10059742 | 3300026023 | Bacteria | 2631 |
| 443 | Ga0207677_10136816 | 3300026023 | Bacteria | 1869 |
| 444 | Ga0207677_10183592 | 3300026023 | Unclassified | 1647 |
| 445 | Ga0207677_10213676 | 3300026023 | Bacteria | 1542 |
| 446 | Ga0207703_10116988 | 3300026035 | Unclassified | 2283 |
| 447 | Ga0207703_10188510 | 3300026035 | Bacteria | 1825 |
| 448 | Ga0207639_10047564 | 3300026041 | Bacteria | 3243 |
| 449 | Ga0207639_10128486 | 3300026041 | Bacteria | 2094 |
| 450 | Ga0207639_10143424 | 3300026041 | Bacteria | 1993 |
| 451 | Ga0207639_10302559 | 3300026041 | Bacteria | 1414 |
| 452 | Ga0207678_10075499 | 3300026067 | Bacteria | 2887 |
| 453 | Ga0207678_10099469 | 3300026067 | Bacteria | 2484 |
| 454 | Ga0207678_10458664 | 3300026067 | Bacteria | 1108 |
| 455 | Ga0207678_10732635 | 3300026067 | Bacteria | 871 |
| 456 | Ga0207708_10522470 | 3300026075 | Bacteria | 998 |
| 457 | Ga0207702_10515870 | 3300026078 | Bacteria | 1166 |
| 458 | Ga0207641_10001009 | 3300026088 | Bacteria | 28707 |
| 459 | Ga0207641_10044727 | 3300026088 | Bacteria | 3724 |
| 460 | Ga0207641_10169704 | 3300026088 | Bacteria | 1990 |
| 461 | Ga0207648_10011552 | 3300026089 | Bacteria | 8315 |
| 462 | Ga0207648_10105422 | 3300026089 | Unclassified | 2473 |
| 463 | Ga0207648_10164037 | 3300026089 | Bacteria | 1963 |
| 464 | Ga0207648_10164394 | 3300026089 | Bacteria | 1961 |
| 465 | Ga0207648_10288854 | 3300026089 | Bacteria | 1468 |
| 466 | Ga0207648_10303544 | 3300026089 | Bacteria | 1432 |
| 467 | Ga0207648_10366753 | 3300026089 | Bacteria | 1300 |
| 468 | Ga0207648_10697942 | 3300026089 | Bacteria | 940 |
| 469 | Ga0207676_10046915 | 3300026095 | Bacteria | 3346 |
| 470 | Ga0207676_10162582 | 3300026095 | Bacteria | 1936 |
| 471 | Ga0207676_10183116 | 3300026095 | Bacteria | 1836 |
| 472 | Ga0207676_10257272 | 3300026095 | Bacteria | 1574 |
| 473 | Ga0207676_10265681 | 3300026095 | Bacteria | 1551 |
| 474 | Ga0207676_10308931 | 3300026095 | Bacteria | 1447 |
| 475 | Ga0207676_10498058 | 3300026095 | Unclassified | 1156 |
| 476 | Ga0207674_10006488 | 3300026116 | Bacteria | 13757 |
| 477 | Ga0207674_10023606 | 3300026116 | Bacteria | 6584 |
| 478 | Ga0207674_10029406 | 3300026116 | Bacteria | 5785 |
| 479 | Ga0207674_10166871 | 3300026116 | Bacteria | 2156 |
| 480 | Ga0207674_10228714 | 3300026116 | Bacteria | 1808 |
| 481 | Ga0207674_10293757 | 3300026116 | Bacteria | 1574 |
| 482 | Ga0207675_100001610 | 3300026118 | Bacteria | 22621 |
| 483 | Ga0207675_100089414 | 3300026118 | Unclassified | 2894 |
| 484 | Ga0207675_100115538 | 3300026118 | Bacteria | 2536 |
| 485 | Ga0207675_100137088 | 3300026118 | Bacteria | 2323 |
| 486 | Ga0207675_100151516 | 3300026118 | Bacteria | 2207 |
| 487 | Ga0207675_100335331 | 3300026118 | Bacteria | 1479 |
| 488 | Ga0207683_10016242 | 3300026121 | Bacteria | 6335 |
| 489 | Ga0207683_10075273 | 3300026121 | Bacteria | 2988 |
| 490 | Ga0207683_10183297 | 3300026121 | Bacteria | 1899 |
| 491 | Ga0207683_10232255 | 3300026121 | Bacteria | 1682 |
| 492 | Ga0207698_10002201 | 3300026142 | Bacteria | 11533 |
| 493 | Ga0207698_10037577 | 3300026142 | Bacteria | 3568 |
| 494 | Ga0207698_10072781 | 3300026142 | Bacteria | 2733 |
| 495 | Ga0207698_10297183 | 3300026142 | Bacteria | 1501 |
| 496 | Ga0207698_10334794 | 3300026142 | Bacteria | 1423 |
| 497 | Ga0207698_10426074 | 3300026142 | Bacteria | 1274 |
| 498 | Ga0268266_10039663 | 3300028379 | Bacteria | 4011 |
| 499 | Ga0268266_10091456 | 3300028379 | Bacteria | 2668 |
| 500 | Ga0268265_10164812 | 3300028380 | Bacteria | 1888 |
| 501 | Ga0268264_10078525 | 3300028381 | Bacteria | 2814 |
| 502 | Ga0268264_10131462 | 3300028381 | Bacteria | 2220 |
| 503 | Ga0265338_10265573 | 3300028800 | Bacteria | 1260 |
| 504 | Ga0265327_10000026 | 3300031251 | Bacteria | 379288 |
| 505 | Ga0265327_10000137 | 3300031251 | Bacteria | 160704 |
| 506 | Ga0307513_10126678 | 3300031456 | Bacteria | 2508 |
| 507 | Ga0307410_10580170 | 3300031852 | Bacteria | 933 |
| 508 | Ga0307412_10080211 | 3300031911 | Bacteria | 2254 |
| 509 | Ga0307414_10108576 | 3300032004 | Unclassified | 2106 |
| 510 | Ga0373934_0129562 | 3300035086 | Bacteria | 1029 |
| 511 | Ga0373936_0201376 | 3300035113 | Bacteria | 879 |
| 512 | Ga0373935_0462933 | 3300035692 | Unclassified | 917 |
| 513 | Ga0373933_0403489 | 3300035724 | Bacteria | 892 |
| 514 | Ga0395905_0000147 | 3300037471 | Bacteria | 116389 |
| 515 | Ga0395901_0003274 | 3300038443 | Bacteria | 16310 |
| 516 | Ga0436365_0493931 | 3300039437 | Bacteria | 27882 |
| 517 | Ga0436365_1298184 | 3300039437 | Bacteria | 1021 |
| 518 | Ga0436365_1346643 | 3300039437 | Bacteria | 734 |
| 519 | Ga0451800_1170264 | 3300041459 | Bacteria | 1001 |
| 520 | Ga0451807_0520014 | 3300041486 | Bacteria | 787 |
| 521 | Ga0451807_1625491 | 3300041486 | Bacteria | 1293 |
| 522 | Ga0451853_2800764 | 3300041512 | Unclassified | 838 |
| 523 | Ga0439433_0049887 | 3300041999 | Bacteria | 985 |
| 524 | Ga0451577_0000207 | 3300042876 | Bacteria | 123185 |
| 525 | Ga0466972_0000051 | 3300044658 | Bacteria | 114011 |
| 526 | Ga0466972_0112802 | 3300044658 | Bacteria | 1284 |
| 527 | Ga0453684_0000791 | 3300044712 | Bacteria | 108441 |
| 528 | Ga0466971_0150649 | 3300044719 | Bacteria | 1086 |
| 529 | Ga0466970_0000688 | 3300044765 | Bacteria | 16522 |
| 530 | Ga0466957_0180348 | 3300044842 | Unclassified | 1379 |
| 531 | Ga0466959_0044904 | 3300045049 | Bacteria | 3255 |
| 532 | Ga0451576_0337765 | 3300045051 | Bacteria | 1577 |
| 533 | Ga0466967_0196457 | 3300045976 | Bacteria | 1909 |
| 534 | Ga0495618_0252414 | 3300046514 | Bacteria | 1106 |
| 535 | Ga0495628_0107595 | 3300046516 | Bacteria | 2147 |
| 536 | Ga0495586_0073243 | 3300046535 | Bacteria | 1874 |
| 537 | Ga0495587_0124133 | 3300046536 | Bacteria | 1478 |
| 538 | Ga0495598_0102805 | 3300046537 | Bacteria | 948 |
| 539 | Ga0495645_0125971 | 3300046543 | Bacteria | 1800 |
| 540 | Ga0495667_0440456 | 3300046559 | Bacteria | 819 |
| 541 | Ga0495668_0000358 | 3300046616 | Bacteria | 60551 |
| 542 | Ga0495668_0021334 | 3300046616 | Bacteria | 3716 |
| 543 | Ga0495634_0147324 | 3300046642 | Bacteria | 1491 |
| 544 | Ga0495611_0144668 | 3300046648 | Bacteria | 1110 |
| 545 | Ga0495635_0228688 | 3300046663 | Bacteria | 1257 |
| 546 | Ga0495600_0126170 | 3300046809 | Bacteria | 1665 |
| 547 | Ga0495636_0000025 | 3300047318 | Bacteria | 66081 |
| 548 | Ga0495676_0279107 | 3300047321 | Unclassified | 1132 |
| 549 | Ga0495686_0000268 | 3300047472 | Bacteria | 93255 |
| 550 | Ga0496108_0175714 | 3300048911 | Unclassified | 1854 |
| 551 | Ga0496110_0025271 | 3300048913 | Bacteria | 5074 |
| 552 | Ga0496111_0238757 | 3300048914 | Bacteria | 1350 |
| 553 | Ga0496114_0101492 | 3300048917 | Unclassified | 2457 |
| 554 | Ga0496115_0008451 | 3300048918 | Bacteria | 7616 |
| 555 | Ga0501296_006409 | 3300049519 | Bacteria | 1333 |
| 556 | Ga0501297_016016 | 3300049520 | Bacteria | 902 |
| 557 | Ga0501034_0000004 | 3300049571 | Bacteria | 382255 |
| 558 | Ga0501034_0472874 | 3300049571 | Bacteria | 1169 |
| 559 | Ga0501036_0023793 | 3300049572 | Bacteria | 5162 |
| 560 | Ga0501043_0141045 | 3300049579 | Unclassified | 1887 |
| 561 | Ga0501047_0059686 | 3300049581 | Bacteria | 3683 |
| 562 | Ga0501198_028864 | 3300049649 | Bacteria | 917 |
| 563 | Ga0501201_000380 | 3300049651 | Bacteria | 4079 |
| 564 | Ga0501202_001260 | 3300049652 | Bacteria | 4003 |
| 565 | Ga0501206_000437 | 3300049653 | Bacteria | 4992 |
| 566 | Ga0501207_001771 | 3300049654 | Bacteria | 2733 |
| 567 | Ga0501211_005127 | 3300049658 | Bacteria | 1319 |
| 568 | Ga0501217_000866 | 3300049661 | Bacteria | 5368 |
| 569 | Ga0501223_000626 | 3300049663 | Bacteria | 8471 |
| 570 | Ga0501224_000976 | 3300049664 | Bacteria | 3707 |
| 571 | Ga0501233_003605 | 3300049668 | Bacteria | 2791 |
| 572 | Ga0501235_002060 | 3300049669 | Bacteria | 4319 |
| 573 | Ga0501242_007896 | 3300049674 | Bacteria | 1236 |
| 574 | Ga0501259_000085 | 3300049688 | Bacteria | 13267 |
| 575 | Ga0501221_000040 | 3300049704 | Bacteria | 12964 |
| 576 | Ga0501221_073321 | 3300049704 | Bacteria | 812 |
| 577 | Ga0501225_0000296 | 3300049705 | Bacteria | 15500 |
| 578 | Ga0501245_000232 | 3300049708 | Bacteria | 6303 |
| 579 | Ga0501232_001638 | 3300049757 | Bacteria | 1821 |
| 580 | Ga0501269_005323 | 3300049766 | Bacteria | 1549 |
| 581 | Ga0501035_0154645 | 3300049822 | Bacteria | 1988 |
| 582 | Ga0501035_0388614 | 3300049822 | Bacteria | 1163 |
| 583 | nmdc:mga05p37_15444_c1 | 3300050507 | Bacteria | 9174 |
| 584 | nmdc:mga05p37_361265_c1 | 3300050507 | Bacteria | 1707 |
| 585 | nmdc:mga0qj67_101265_c1 | 3300050509 | Bacteria | 2322 |
| 586 | nmdc:mga06r32_247961_c1 | 3300050510 | Bacteria | 1768 |
| 587 | nmdc:mga06r32_39221_c1 | 3300050510 | Bacteria | 4493 |
| 588 | nmdc:mga08y16_1028047_c1 | 3300050511 | Unclassified | 803 |
| 589 | nmdc:mga0n895_106321_c1 | 3300050512 | Bacteria | 2819 |
| 590 | Ga0495619_0398780 | 3300053085 | Bacteria | 950 |
| 591 | Ga0500646_0020756 | 3300053090 | Unclassified | 1747 |
| 592 | Ga0500556_0046080 | 3300053104 | Bacteria | 1559 |
| 593 | Ga0500592_018961 | 3300053116 | Bacteria | 1105 |
| 594 | Ga0500594_0030131 | 3300053118 | Bacteria | 1423 |
| 595 | Ga0500594_0119522 | 3300053118 | Unclassified | 826 |
| 596 | Ga0500559_0040682 | 3300053136 | Bacteria | 2025 |
| 597 | Ga0500604_0041980 | 3300053151 | Bacteria | 1385 |
| 598 | Ga0500616_0000850 | 3300053153 | Bacteria | 34025 |
| 599 | Ga0500627_0006122 | 3300053158 | Bacteria | 4066 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041486 | Ga0451807_0520014 | Ga0451807_0520014_15_641 | 208 |
| 2 | 3300005530 | Ga0070679_100707561 | Ga0070679_1007075611 | 210 |
| 3 | 3300005985 | Ga0081539_10018196 | Ga0081539_100181962 | 211 |
| 4 | 3300013104 | Ga0157370_10186269 | Ga0157370_101862691 | 214 |
| 5 | 3300005295 | Ga0065707_10115231 | Ga0065707_101152312 | 217 |
| 6 | 3300005577 | Ga0068857_100089028 | Ga0068857_1000890282 | 217 |
| 7 | 3300005618 | Ga0068864_100045643 | Ga0068864_1000456432 | 217 |
| 8 | 3300006844 | Ga0075428_100645923 | Ga0075428_1006459232 | 217 |
| 9 | 3300025925 | Ga0207650_10185890 | Ga0207650_101858901 | 217 |
| 10 | 3300026116 | Ga0207674_10166871 | Ga0207674_101668712 | 217 |
| 11 | 3300005578 | Ga0068854_100105409 | Ga0068854_1001054092 | 219 |
| 12 | 3300009093 | Ga0105240_10921005 | Ga0105240_109210051 | 219 |
| 13 | 3300009545 | Ga0105237_10011018 | Ga0105237_1001101811 | 219 |
| 14 | 3300025914 | Ga0207671_10000149 | Ga0207671_1000014940 | 219 |
| 15 | 3300003323 | rootH1_10129104 | rootH1_101291042 | 220 |
| 16 | 3300005335 | Ga0070666_10030514 | Ga0070666_100305142 | 220 |
| 17 | 3300005367 | Ga0070667_100024448 | Ga0070667_1000244482 | 220 |
| 18 | 3300005456 | Ga0070678_100053833 | Ga0070678_1000538332 | 220 |
| 19 | 3300005841 | Ga0068863_100101824 | Ga0068863_1001018242 | 220 |
| 20 | 3300026095 | Ga0207676_10183116 | Ga0207676_101831162 | 220 |
| 21 | iso_pu_bacteria | 2818991444 | 2819586241 | 221 |
| 22 | iso_pu_bacteria | 2929154850 | 2929158848 | 221 |
| 23 | 3300025907 | Ga0207645_10321236 | Ga0207645_103212361 | 222 |
| 24 | 3300025909 | Ga0207705_10590150 | Ga0207705_105901501 | 222 |
| 25 | 3300005548 | Ga0070665_100003118 | Ga0070665_1000031184 | 223 |
| 26 | 3300005719 | Ga0068861_100639610 | Ga0068861_1006396102 | 223 |
| 27 | 3300006881 | Ga0068865_100769389 | Ga0068865_1007693891 | 223 |
| 28 | 3300009093 | Ga0105240_10151300 | Ga0105240_101513003 | 223 |
| 29 | 3300010375 | Ga0105239_10258554 | Ga0105239_102585541 | 223 |
| 30 | 3300025904 | Ga0207647_10023084 | Ga0207647_100230844 | 223 |
| 31 | 3300025913 | Ga0207695_10032968 | Ga0207695_100329685 | 223 |
| 32 | 3300025914 | Ga0207671_10586589 | Ga0207671_105865891 | 223 |
| 33 | 3300028379 | Ga0268266_10039663 | Ga0268266_100396633 | 223 |
| 34 | 3300041999 | Ga0439433_0049887 | Ga0439433_0049887_214_885 | 223 |
| 35 | 3300049571 | Ga0501034_0000004 | Ga0501034_0000004_370118_370792 | 223 |
| 36 | iso_pu_bacteria | 2881955468 | 2881957107 | 223 |
| 37 | 3300005366 | Ga0070659_100003749 | Ga0070659_1000037497 | 224 |
| 38 | 3300005616 | Ga0068852_100000408 | Ga0068852_1000004084 | 224 |
| 39 | 3300013100 | Ga0157373_10016506 | Ga0157373_100165062 | 224 |
| 40 | 3300013100 | Ga0157373_10070571 | Ga0157373_100705712 | 224 |
| 41 | 3300013102 | Ga0157371_10010553 | Ga0157371_1001055311 | 224 |
| 42 | 3300013307 | Ga0157372_10079978 | Ga0157372_100799782 | 224 |
| 43 | 3300013307 | Ga0157372_10112593 | Ga0157372_101125934 | 224 |
| 44 | 3300025904 | Ga0207647_10000086 | Ga0207647_1000008612 | 224 |
| 45 | 3300025919 | Ga0207657_10166852 | Ga0207657_101668522 | 224 |
| 46 | 3300025919 | Ga0207657_10177070 | Ga0207657_101770702 | 224 |
| 47 | 3300025932 | Ga0207690_10010195 | Ga0207690_100101952 | 224 |
| 48 | 3300025944 | Ga0207661_10144623 | Ga0207661_101446232 | 224 |
| 49 | 3300026041 | Ga0207639_10047564 | Ga0207639_100475643 | 224 |
| 50 | 3300026142 | Ga0207698_10002201 | Ga0207698_100022012 | 224 |
| 51 | 3300026142 | Ga0207698_10297183 | Ga0207698_102971832 | 224 |
| 52 | 3300044658 | Ga0466972_0112802 | Ga0466972_0112802_548_1222 | 224 |
| 53 | 3300045049 | Ga0466959_0044904 | Ga0466959_0044904_933_1607 | 224 |
| 54 | 3300005290 | Ga0065712_10096550 | Ga0065712_100965502 | 225 |
| 55 | 3300005290 | Ga0065712_10124904 | Ga0065712_101249043 | 225 |
| 56 | 3300005290 | Ga0065712_10128532 | Ga0065712_101285322 | 225 |
| 57 | 3300005293 | Ga0065715_10090610 | Ga0065715_100906102 | 225 |
| 58 | 3300005293 | Ga0065715_10473877 | Ga0065715_104738771 | 225 |
| 59 | 3300005295 | Ga0065707_10236188 | Ga0065707_102361882 | 225 |
| 60 | 3300005328 | Ga0070676_10049174 | Ga0070676_100491742 | 225 |
| 61 | 3300005329 | Ga0070683_100049865 | Ga0070683_1000498652 | 225 |
| 62 | 3300005329 | Ga0070683_100058948 | Ga0070683_1000589482 | 225 |
| 63 | 3300005329 | Ga0070683_100075761 | Ga0070683_1000757611 | 225 |
| 64 | 3300005329 | Ga0070683_100454956 | Ga0070683_1004549562 | 225 |
| 65 | 3300005331 | Ga0070670_100013054 | Ga0070670_1000130544 | 225 |
| 66 | 3300005334 | Ga0068869_100029819 | Ga0068869_1000298193 | 225 |
| 67 | 3300005334 | Ga0068869_100035175 | Ga0068869_1000351753 | 225 |
| 68 | 3300005334 | Ga0068869_100188993 | Ga0068869_1001889932 | 225 |
| 69 | 3300005338 | Ga0068868_100014752 | Ga0068868_1000147525 | 225 |
| 70 | 3300005338 | Ga0068868_100054094 | Ga0068868_1000540943 | 225 |
| 71 | 3300005338 | Ga0068868_100123198 | Ga0068868_1001231982 | 225 |
| 72 | 3300005340 | Ga0070689_100003385 | Ga0070689_1000033853 | 225 |
| 73 | 3300005340 | Ga0070689_100008847 | Ga0070689_1000088477 | 225 |
| 74 | 3300005340 | Ga0070689_100663633 | Ga0070689_1006636331 | 225 |
| 75 | 3300005343 | Ga0070687_100059417 | Ga0070687_1000594172 | 225 |
| 76 | 3300005344 | Ga0070661_100057180 | Ga0070661_1000571801 | 225 |
| 77 | 3300005347 | Ga0070668_100827447 | Ga0070668_1008274471 | 225 |
| 78 | 3300005353 | Ga0070669_100042552 | Ga0070669_1000425522 | 225 |
| 79 | 3300005353 | Ga0070669_100150233 | Ga0070669_1001502331 | 225 |
| 80 | 3300005354 | Ga0070675_100015260 | Ga0070675_1000152604 | 225 |
| 81 | 3300005354 | Ga0070675_100056672 | Ga0070675_1000566722 | 225 |
| 82 | 3300005354 | Ga0070675_100577049 | Ga0070675_1005770491 | 225 |
| 83 | 3300005356 | Ga0070674_100084865 | Ga0070674_1000848652 | 225 |
| 84 | 3300005364 | Ga0070673_100060957 | Ga0070673_1000609572 | 225 |
| 85 | 3300005364 | Ga0070673_100084804 | Ga0070673_1000848042 | 225 |
| 86 | 3300005364 | Ga0070673_100219867 | Ga0070673_1002198672 | 225 |
| 87 | 3300005365 | Ga0070688_100009182 | Ga0070688_1000091824 | 225 |
| 88 | 3300005365 | Ga0070688_100010676 | Ga0070688_1000106763 | 225 |
| 89 | 3300005365 | Ga0070688_100041228 | Ga0070688_1000412282 | 225 |
| 90 | 3300005365 | Ga0070688_100100078 | Ga0070688_1001000782 | 225 |
| 91 | 3300005367 | Ga0070667_100041132 | Ga0070667_1000411322 | 225 |
| 92 | 3300005367 | Ga0070667_100042965 | Ga0070667_1000429652 | 225 |
| 93 | 3300005367 | Ga0070667_100540380 | Ga0070667_1005403802 | 225 |
| 94 | 3300005435 | Ga0070714_100000213 | Ga0070714_10000021337 | 225 |
| 95 | 3300005438 | Ga0070701_10155713 | Ga0070701_101557131 | 225 |
| 96 | 3300005455 | Ga0070663_100415306 | Ga0070663_1004153061 | 225 |
| 97 | 3300005456 | Ga0070678_100029146 | Ga0070678_1000291464 | 225 |
| 98 | 3300005459 | Ga0068867_100171690 | Ga0068867_1001716902 | 225 |
| 99 | 3300005459 | Ga0068867_100178808 | Ga0068867_1001788082 | 225 |
| 100 | 3300005459 | Ga0068867_100283271 | Ga0068867_1002832712 | 225 |
| 101 | 3300005459 | Ga0068867_100479142 | Ga0068867_1004791422 | 225 |
| 102 | 3300005466 | Ga0070685_10042099 | Ga0070685_100420991 | 225 |
| 103 | 3300005466 | Ga0070685_10139106 | Ga0070685_101391062 | 225 |
| 104 | 3300005471 | Ga0070698_100002073 | Ga0070698_10000207319 | 225 |
| 105 | 3300005471 | Ga0070698_100006662 | Ga0070698_1000066625 | 225 |
| 106 | 3300005535 | Ga0070684_100000986 | Ga0070684_1000009862 | 225 |
| 107 | 3300005535 | Ga0070684_100029966 | Ga0070684_1000299662 | 225 |
| 108 | 3300005535 | Ga0070684_100159848 | Ga0070684_1001598482 | 225 |
| 109 | 3300005539 | Ga0068853_100031075 | Ga0068853_1000310752 | 225 |
| 110 | 3300005539 | Ga0068853_100161431 | Ga0068853_1001614312 | 225 |
| 111 | 3300005543 | Ga0070672_100490682 | Ga0070672_1004906822 | 225 |
| 112 | 3300005543 | Ga0070672_100688149 | Ga0070672_1006881491 | 225 |
| 113 | 3300005543 | Ga0070672_100705768 | Ga0070672_1007057681 | 225 |
| 114 | 3300005544 | Ga0070686_100019936 | Ga0070686_1000199362 | 225 |
| 115 | 3300005544 | Ga0070686_100046065 | Ga0070686_1000460652 | 225 |
| 116 | 3300005548 | Ga0070665_100211811 | Ga0070665_1002118112 | 225 |
| 117 | 3300005564 | Ga0070664_100001066 | Ga0070664_1000010662 | 225 |
| 118 | 3300005564 | Ga0070664_100010988 | Ga0070664_1000109881 | 225 |
| 119 | 3300005564 | Ga0070664_100202292 | Ga0070664_1002022922 | 225 |
| 120 | 3300005564 | Ga0070664_100713386 | Ga0070664_1007133861 | 225 |
| 121 | 3300005577 | Ga0068857_100001057 | Ga0068857_1000010572 | 225 |
| 122 | 3300005577 | Ga0068857_100084064 | Ga0068857_1000840643 | 225 |
| 123 | 3300005577 | Ga0068857_100159720 | Ga0068857_1001597201 | 225 |
| 124 | 3300005578 | Ga0068854_100017804 | Ga0068854_1000178042 | 225 |
| 125 | 3300005578 | Ga0068854_100036801 | Ga0068854_1000368013 | 225 |
| 126 | 3300005578 | Ga0068854_100467290 | Ga0068854_1004672901 | 225 |
| 127 | 3300005616 | Ga0068852_100025982 | Ga0068852_1000259822 | 225 |
| 128 | 3300005616 | Ga0068852_100201924 | Ga0068852_1002019241 | 225 |
| 129 | 3300005616 | Ga0068852_100205485 | Ga0068852_1002054852 | 225 |
| 130 | 3300005617 | Ga0068859_100020034 | Ga0068859_1000200344 | 225 |
| 131 | 3300005617 | Ga0068859_100070778 | Ga0068859_1000707782 | 225 |
| 132 | 3300005617 | Ga0068859_100107278 | Ga0068859_1001072783 | 225 |
| 133 | 3300005617 | Ga0068859_100148481 | Ga0068859_1001484812 | 225 |
| 134 | 3300005617 | Ga0068859_100482953 | Ga0068859_1004829531 | 225 |
| 135 | 3300005618 | Ga0068864_100005255 | Ga0068864_1000052558 | 225 |
| 136 | 3300005618 | Ga0068864_100092076 | Ga0068864_1000920763 | 225 |
| 137 | 3300005618 | Ga0068864_100279551 | Ga0068864_1002795512 | 225 |
| 138 | 3300005718 | Ga0068866_10141056 | Ga0068866_101410563 | 225 |
| 139 | 3300005718 | Ga0068866_10363056 | Ga0068866_103630561 | 225 |
| 140 | 3300005719 | Ga0068861_100096295 | Ga0068861_1000962953 | 225 |
| 141 | 3300005834 | Ga0068851_10090891 | Ga0068851_100908912 | 225 |
| 142 | 3300005840 | Ga0068870_10245413 | Ga0068870_102454132 | 225 |
| 143 | 3300005841 | Ga0068863_100125348 | Ga0068863_1001253482 | 225 |
| 144 | 3300005841 | Ga0068863_100139886 | Ga0068863_1001398862 | 225 |
| 145 | 3300005841 | Ga0068863_100219986 | Ga0068863_1002199862 | 225 |
| 146 | 3300005842 | Ga0068858_100028827 | Ga0068858_1000288273 | 225 |
| 147 | 3300005842 | Ga0068858_100049735 | Ga0068858_1000497352 | 225 |
| 148 | 3300005842 | Ga0068858_100222372 | Ga0068858_1002223723 | 225 |
| 149 | 3300005842 | Ga0068858_100409755 | Ga0068858_1004097551 | 225 |
| 150 | 3300005843 | Ga0068860_100072884 | Ga0068860_1000728842 | 225 |
| 151 | 3300005843 | Ga0068860_100336253 | Ga0068860_1003362533 | 225 |
| 152 | 3300006173 | Ga0070716_100025385 | Ga0070716_1000253853 | 225 |
| 153 | 3300006195 | Ga0075366_10181519 | Ga0075366_101815191 | 225 |
| 154 | 3300006237 | Ga0097621_100019762 | Ga0097621_1000197622 | 225 |
| 155 | 3300006237 | Ga0097621_100061777 | Ga0097621_1000617772 | 225 |
| 156 | 3300006237 | Ga0097621_100105161 | Ga0097621_1001051611 | 225 |
| 157 | 3300006358 | Ga0068871_100002698 | Ga0068871_1000026982 | 225 |
| 158 | 3300006358 | Ga0068871_100005072 | Ga0068871_1000050726 | 225 |
| 159 | 3300006358 | Ga0068871_100148795 | Ga0068871_1001487952 | 225 |
| 160 | 3300006871 | Ga0075434_100216525 | Ga0075434_1002165252 | 225 |
| 161 | 3300006880 | Ga0075429_100008423 | Ga0075429_1000084232 | 225 |
| 162 | 3300006931 | Ga0097620_100020031 | Ga0097620_1000200314 | 225 |
| 163 | 3300006931 | Ga0097620_100070782 | Ga0097620_1000707822 | 225 |
| 164 | 3300006931 | Ga0097620_100107270 | Ga0097620_1001072702 | 225 |
| 165 | 3300006931 | Ga0097620_100148482 | Ga0097620_1001484822 | 225 |
| 166 | 3300006931 | Ga0097620_100482965 | Ga0097620_1004829651 | 225 |
| 167 | 3300009094 | Ga0111539_10429915 | Ga0111539_104299152 | 225 |
| 168 | 3300009094 | Ga0111539_10544238 | Ga0111539_105442382 | 225 |
| 169 | 3300009098 | Ga0105245_10077676 | Ga0105245_100776762 | 225 |
| 170 | 3300009101 | Ga0105247_10094997 | Ga0105247_100949972 | 225 |
| 171 | 3300009101 | Ga0105247_10111194 | Ga0105247_101111942 | 225 |
| 172 | 3300009101 | Ga0105247_10171955 | Ga0105247_101719552 | 225 |
| 173 | 3300009147 | Ga0114129_10015558 | Ga0114129_100155587 | 225 |
| 174 | 3300009174 | Ga0105241_10019760 | Ga0105241_100197602 | 225 |
| 175 | 3300009176 | Ga0105242_10001554 | Ga0105242_1000155416 | 225 |
| 176 | 3300009176 | Ga0105242_10514240 | Ga0105242_105142401 | 225 |
| 177 | 3300009176 | Ga0105242_10955308 | Ga0105242_109553081 | 225 |
| 178 | 3300009177 | Ga0105248_10532062 | Ga0105248_105320621 | 225 |
| 179 | 3300009553 | Ga0105249_10004487 | Ga0105249_100044875 | 225 |
| 180 | 3300009553 | Ga0105249_10047237 | Ga0105249_100472372 | 225 |
| 181 | 3300009553 | Ga0105249_10168679 | Ga0105249_101686791 | 225 |
| 182 | 3300009553 | Ga0105249_10950361 | Ga0105249_109503611 | 225 |
| 183 | 3300010375 | Ga0105239_10136443 | Ga0105239_101364432 | 225 |
| 184 | 3300011119 | Ga0105246_10470554 | Ga0105246_104705541 | 225 |
| 185 | 3300013100 | Ga0157373_10297973 | Ga0157373_102979731 | 225 |
| 186 | 3300013102 | Ga0157371_10047056 | Ga0157371_100470562 | 225 |
| 187 | 3300013104 | Ga0157370_10157212 | Ga0157370_101572123 | 225 |
| 188 | 3300013296 | Ga0157374_10004211 | Ga0157374_100042113 | 225 |
| 189 | 3300013296 | Ga0157374_10005248 | Ga0157374_100052486 | 225 |
| 190 | 3300013296 | Ga0157374_10341585 | Ga0157374_103415851 | 225 |
| 191 | 3300013296 | Ga0157374_10994066 | Ga0157374_109940661 | 225 |
| 192 | 3300013297 | Ga0157378_10113280 | Ga0157378_101132802 | 225 |
| 193 | 3300013297 | Ga0157378_10121852 | Ga0157378_101218522 | 225 |
| 194 | 3300013297 | Ga0157378_10195698 | Ga0157378_101956982 | 225 |
| 195 | 3300013297 | Ga0157378_10913927 | Ga0157378_109139271 | 225 |
| 196 | 3300013297 | Ga0157378_11077751 | Ga0157378_110777511 | 225 |
| 197 | 3300013306 | Ga0163162_10001289 | Ga0163162_100012896 | 225 |
| 198 | 3300013306 | Ga0163162_10006811 | Ga0163162_100068112 | 225 |
| 199 | 3300013306 | Ga0163162_10017115 | Ga0163162_100171153 | 225 |
| 200 | 3300013306 | Ga0163162_10033618 | Ga0163162_100336182 | 225 |
| 201 | 3300013306 | Ga0163162_10045996 | Ga0163162_100459964 | 225 |
| 202 | 3300013306 | Ga0163162_10137523 | Ga0163162_101375231 | 225 |
| 203 | 3300013306 | Ga0163162_10190195 | Ga0163162_101901951 | 225 |
| 204 | 3300013307 | Ga0157372_10033595 | Ga0157372_100335952 | 225 |
| 205 | 3300013307 | Ga0157372_10107948 | Ga0157372_101079482 | 225 |
| 206 | 3300013307 | Ga0157372_10699290 | Ga0157372_106992901 | 225 |
| 207 | 3300013308 | Ga0157375_10016793 | Ga0157375_100167933 | 225 |
| 208 | 3300013308 | Ga0157375_10039198 | Ga0157375_100391982 | 225 |
| 209 | 3300013308 | Ga0157375_10078879 | Ga0157375_100788792 | 225 |
| 210 | 3300014325 | Ga0163163_10000057 | Ga0163163_1000005740 | 225 |
| 211 | 3300014325 | Ga0163163_10342084 | Ga0163163_103420842 | 225 |
| 212 | 3300014325 | Ga0163163_10588390 | Ga0163163_105883902 | 225 |
| 213 | 3300014326 | Ga0157380_10558024 | Ga0157380_105580242 | 225 |
| 214 | 3300014326 | Ga0157380_10678080 | Ga0157380_106780802 | 225 |
| 215 | 3300014745 | Ga0157377_10009380 | Ga0157377_100093804 | 225 |
| 216 | 3300014745 | Ga0157377_10027666 | Ga0157377_100276663 | 225 |
| 217 | 3300014745 | Ga0157377_10245197 | Ga0157377_102451971 | 225 |
| 218 | 3300014745 | Ga0157377_10250416 | Ga0157377_102504161 | 225 |
| 219 | 3300014968 | Ga0157379_10019926 | Ga0157379_100199264 | 225 |
| 220 | 3300014968 | Ga0157379_10056176 | Ga0157379_100561762 | 225 |
| 221 | 3300014968 | Ga0157379_10142004 | Ga0157379_101420042 | 225 |
| 222 | 3300014968 | Ga0157379_10161719 | Ga0157379_101617192 | 225 |
| 223 | 3300014969 | Ga0157376_10024500 | Ga0157376_100245004 | 225 |
| 224 | 3300014969 | Ga0157376_10134873 | Ga0157376_101348732 | 225 |
| 225 | 3300014969 | Ga0157376_11136568 | Ga0157376_111365681 | 225 |
| 226 | 3300015265 | Ga0182005_1066751 | Ga0182005_10667511 | 225 |
| 227 | 3300017792 | Ga0163161_10001319 | Ga0163161_100013196 | 225 |
| 228 | 3300017792 | Ga0163161_10035337 | Ga0163161_100353371 | 225 |
| 229 | 3300017792 | Ga0163161_10043822 | Ga0163161_100438222 | 225 |
| 230 | 3300017792 | Ga0163161_10092411 | Ga0163161_100924112 | 225 |
| 231 | 3300017792 | Ga0163161_10345879 | Ga0163161_103458791 | 225 |
| 232 | 3300021384 | Ga0213876_10001203 | Ga0213876_100012034 | 225 |
| 233 | 3300025315 | Ga0207697_10068658 | Ga0207697_100686581 | 225 |
| 234 | 3300025893 | Ga0207682_10065741 | Ga0207682_100657412 | 225 |
| 235 | 3300025903 | Ga0207680_10064779 | Ga0207680_100647792 | 225 |
| 236 | 3300025904 | Ga0207647_10098581 | Ga0207647_100985812 | 225 |
| 237 | 3300025907 | Ga0207645_10016219 | Ga0207645_100162192 | 225 |
| 238 | 3300025908 | Ga0207643_10203062 | Ga0207643_102030622 | 225 |
| 239 | 3300025911 | Ga0207654_10136045 | Ga0207654_101360452 | 225 |
| 240 | 3300025911 | Ga0207654_10377523 | Ga0207654_103775231 | 225 |
| 241 | 3300025918 | Ga0207662_10024602 | Ga0207662_100246023 | 225 |
| 242 | 3300025919 | Ga0207657_10056878 | Ga0207657_100568781 | 225 |
| 243 | 3300025920 | Ga0207649_10240879 | Ga0207649_102408792 | 225 |
| 244 | 3300025920 | Ga0207649_10578119 | Ga0207649_105781191 | 225 |
| 245 | 3300025923 | Ga0207681_10243954 | Ga0207681_102439542 | 225 |
| 246 | 3300025923 | Ga0207681_10514777 | Ga0207681_105147771 | 225 |
| 247 | 3300025925 | Ga0207650_10086041 | Ga0207650_100860412 | 225 |
| 248 | 3300025925 | Ga0207650_10579723 | Ga0207650_105797232 | 225 |
| 249 | 3300025926 | Ga0207659_10005468 | Ga0207659_1000546810 | 225 |
| 250 | 3300025926 | Ga0207659_10027410 | Ga0207659_100274102 | 225 |
| 251 | 3300025926 | Ga0207659_10050668 | Ga0207659_100506682 | 225 |
| 252 | 3300025929 | Ga0207664_10000130 | Ga0207664_100001306 | 225 |
| 253 | 3300025932 | Ga0207690_10017217 | Ga0207690_100172172 | 225 |
| 254 | 3300025933 | Ga0207706_10003789 | Ga0207706_100037898 | 225 |
| 255 | 3300025933 | Ga0207706_10015762 | Ga0207706_100157622 | 225 |
| 256 | 3300025934 | Ga0207686_10001429 | Ga0207686_100014293 | 225 |
| 257 | 3300025934 | Ga0207686_10076778 | Ga0207686_100767782 | 225 |
| 258 | 3300025936 | Ga0207670_10008526 | Ga0207670_100085262 | 225 |
| 259 | 3300025936 | Ga0207670_10120250 | Ga0207670_101202502 | 225 |
| 260 | 3300025936 | Ga0207670_10148279 | Ga0207670_101482792 | 225 |
| 261 | 3300025937 | Ga0207669_10315714 | Ga0207669_103157142 | 225 |
| 262 | 3300025938 | Ga0207704_10284718 | Ga0207704_102847182 | 225 |
| 263 | 3300025940 | Ga0207691_10083725 | Ga0207691_100837252 | 225 |
| 264 | 3300025940 | Ga0207691_10283220 | Ga0207691_102832202 | 225 |
| 265 | 3300025940 | Ga0207691_10800613 | Ga0207691_108006131 | 225 |
| 266 | 3300025941 | Ga0207711_10029203 | Ga0207711_100292033 | 225 |
| 267 | 3300025942 | Ga0207689_10018112 | Ga0207689_100181123 | 225 |
| 268 | 3300025942 | Ga0207689_10031915 | Ga0207689_100319154 | 225 |
| 269 | 3300025942 | Ga0207689_10066606 | Ga0207689_100666061 | 225 |
| 270 | 3300025942 | Ga0207689_10086264 | Ga0207689_100862641 | 225 |
| 271 | 3300025944 | Ga0207661_10347514 | Ga0207661_103475142 | 225 |
| 272 | 3300025945 | Ga0207679_10069183 | Ga0207679_100691831 | 225 |
| 273 | 3300025945 | Ga0207679_10091130 | Ga0207679_100911302 | 225 |
| 274 | 3300025949 | Ga0207667_10424047 | Ga0207667_104240472 | 225 |
| 275 | 3300025960 | Ga0207651_10109883 | Ga0207651_101098832 | 225 |
| 276 | 3300025960 | Ga0207651_10442176 | Ga0207651_104421761 | 225 |
| 277 | 3300025960 | Ga0207651_10664613 | Ga0207651_106646131 | 225 |
| 278 | 3300025961 | Ga0207712_10080263 | Ga0207712_100802632 | 225 |
| 279 | 3300025981 | Ga0207640_10079271 | Ga0207640_100792713 | 225 |
| 280 | 3300025981 | Ga0207640_10498353 | Ga0207640_104983531 | 225 |
| 281 | 3300025986 | Ga0207658_10110947 | Ga0207658_101109472 | 225 |
| 282 | 3300025986 | Ga0207658_10180213 | Ga0207658_101802131 | 225 |
| 283 | 3300026023 | Ga0207677_10027624 | Ga0207677_100276241 | 225 |
| 284 | 3300026023 | Ga0207677_10059742 | Ga0207677_100597421 | 225 |
| 285 | 3300026023 | Ga0207677_10136816 | Ga0207677_101368162 | 225 |
| 286 | 3300026023 | Ga0207677_10183592 | Ga0207677_101835922 | 225 |
| 287 | 3300026023 | Ga0207677_10213676 | Ga0207677_102136762 | 225 |
| 288 | 3300026035 | Ga0207703_10116988 | Ga0207703_101169881 | 225 |
| 289 | 3300026035 | Ga0207703_10188510 | Ga0207703_101885102 | 225 |
| 290 | 3300026041 | Ga0207639_10143424 | Ga0207639_101434242 | 225 |
| 291 | 3300026067 | Ga0207678_10075499 | Ga0207678_100754991 | 225 |
| 292 | 3300026067 | Ga0207678_10732635 | Ga0207678_107326351 | 225 |
| 293 | 3300026088 | Ga0207641_10001009 | Ga0207641_1000100917 | 225 |
| 294 | 3300026088 | Ga0207641_10044727 | Ga0207641_100447273 | 225 |
| 295 | 3300026088 | Ga0207641_10169704 | Ga0207641_101697041 | 225 |
| 296 | 3300026089 | Ga0207648_10011552 | Ga0207648_100115522 | 225 |
| 297 | 3300026089 | Ga0207648_10105422 | Ga0207648_101054222 | 225 |
| 298 | 3300026089 | Ga0207648_10164037 | Ga0207648_101640371 | 225 |
| 299 | 3300026089 | Ga0207648_10164394 | Ga0207648_101643942 | 225 |
| 300 | 3300026089 | Ga0207648_10288854 | Ga0207648_102888542 | 225 |
| 301 | 3300026089 | Ga0207648_10303544 | Ga0207648_103035441 | 225 |
| 302 | 3300026089 | Ga0207648_10366753 | Ga0207648_103667532 | 225 |
| 303 | 3300026095 | Ga0207676_10257272 | Ga0207676_102572722 | 225 |
| 304 | 3300026095 | Ga0207676_10265681 | Ga0207676_102656811 | 225 |
| 305 | 3300026095 | Ga0207676_10498058 | Ga0207676_104980582 | 225 |
| 306 | 3300026116 | Ga0207674_10006488 | Ga0207674_100064888 | 225 |
| 307 | 3300026116 | Ga0207674_10023606 | Ga0207674_100236062 | 225 |
| 308 | 3300026118 | Ga0207675_100001610 | Ga0207675_1000016102 | 225 |
| 309 | 3300026118 | Ga0207675_100089414 | Ga0207675_1000894143 | 225 |
| 310 | 3300026118 | Ga0207675_100115538 | Ga0207675_1001155381 | 225 |
| 311 | 3300026118 | Ga0207675_100151516 | Ga0207675_1001515162 | 225 |
| 312 | 3300026121 | Ga0207683_10016242 | Ga0207683_100162421 | 225 |
| 313 | 3300026121 | Ga0207683_10075273 | Ga0207683_100752732 | 225 |
| 314 | 3300026142 | Ga0207698_10072781 | Ga0207698_100727812 | 225 |
| 315 | 3300028379 | Ga0268266_10091456 | Ga0268266_100914562 | 225 |
| 316 | 3300028380 | Ga0268265_10164812 | Ga0268265_101648122 | 225 |
| 317 | 3300028381 | Ga0268264_10078525 | Ga0268264_100785252 | 225 |
| 318 | 3300028381 | Ga0268264_10131462 | Ga0268264_101314622 | 225 |
| 319 | 3300028800 | Ga0265338_10265573 | Ga0265338_102655732 | 225 |
| 320 | 3300031852 | Ga0307410_10580170 | Ga0307410_105801701 | 225 |
| 321 | 3300031911 | Ga0307412_10080211 | Ga0307412_100802112 | 225 |
| 322 | 3300032004 | Ga0307414_10108576 | Ga0307414_101085762 | 225 |
| 323 | 3300035086 | Ga0373934_0129562 | Ga0373934_0129562_223_900 | 225 |
| 324 | 3300035113 | Ga0373936_0201376 | Ga0373936_0201376_72_749 | 225 |
| 325 | 3300035724 | Ga0373933_0403489 | Ga0373933_0403489_125_802 | 225 |
| 326 | 3300039437 | Ga0436365_0493931 | Ga0436365_0493931_11634_12314 | 225 |
| 327 | 3300039437 | Ga0436365_1346643 | Ga0436365_1346643_31_711 | 225 |
| 328 | 3300041486 | Ga0451807_1625491 | Ga0451807_1625491_111_788 | 225 |
| 329 | 3300041512 | Ga0451853_2800764 | Ga0451853_2800764_42_719 | 225 |
| 330 | 3300044658 | Ga0466972_0000051 | Ga0466972_0000051_61734_62411 | 225 |
| 331 | 3300044719 | Ga0466971_0150649 | Ga0466971_0150649_120_797 | 225 |
| 332 | 3300044765 | Ga0466970_0000688 | Ga0466970_0000688_3021_3698 | 225 |
| 333 | 3300044842 | Ga0466957_0180348 | Ga0466957_0180348_265_942 | 225 |
| 334 | 3300046514 | Ga0495618_0252414 | Ga0495618_0252414_111_788 | 225 |
| 335 | 3300046516 | Ga0495628_0107595 | Ga0495628_0107595_115_792 | 225 |
| 336 | 3300046535 | Ga0495586_0073243 | Ga0495586_0073243_634_1311 | 225 |
| 337 | 3300046536 | Ga0495587_0124133 | Ga0495587_0124133_739_1416 | 225 |
| 338 | 3300046537 | Ga0495598_0102805 | Ga0495598_0102805_233_910 | 225 |
| 339 | 3300046559 | Ga0495667_0440456 | Ga0495667_0440456_60_737 | 225 |
| 340 | 3300046642 | Ga0495634_0147324 | Ga0495634_0147324_564_1241 | 225 |
| 341 | 3300046648 | Ga0495611_0144668 | Ga0495611_0144668_252_929 | 225 |
| 342 | 3300046663 | Ga0495635_0228688 | Ga0495635_0228688_440_1117 | 225 |
| 343 | 3300046809 | Ga0495600_0126170 | Ga0495600_0126170_404_1081 | 225 |
| 344 | 3300048911 | Ga0496108_0175714 | Ga0496108_0175714_932_1609 | 225 |
| 345 | 3300048913 | Ga0496110_0025271 | Ga0496110_0025271_182_859 | 225 |
| 346 | 3300048914 | Ga0496111_0238757 | Ga0496111_0238757_445_1122 | 225 |
| 347 | 3300048917 | Ga0496114_0101492 | Ga0496114_0101492_836_1513 | 225 |
| 348 | 3300049519 | Ga0501296_006409 | Ga0501296_006409_74_751 | 225 |
| 349 | 3300049520 | Ga0501297_016016 | Ga0501297_016016_75_752 | 225 |
| 350 | 3300049572 | Ga0501036_0023793 | Ga0501036_0023793_3956_4633 | 225 |
| 351 | 3300049579 | Ga0501043_0141045 | Ga0501043_0141045_1016_1693 | 225 |
| 352 | 3300049581 | Ga0501047_0059686 | Ga0501047_0059686_1670_2347 | 225 |
| 353 | 3300049649 | Ga0501198_028864 | Ga0501198_028864_30_707 | 225 |
| 354 | 3300049651 | Ga0501201_000380 | Ga0501201_000380_365_1042 | 225 |
| 355 | 3300049652 | Ga0501202_001260 | Ga0501202_001260_945_1622 | 225 |
| 356 | 3300049653 | Ga0501206_000437 | Ga0501206_000437_108_785 | 225 |
| 357 | 3300049654 | Ga0501207_001771 | Ga0501207_001771_1394_2071 | 225 |
| 358 | 3300049658 | Ga0501211_005127 | Ga0501211_005127_324_1001 | 225 |
| 359 | 3300049661 | Ga0501217_000866 | Ga0501217_000866_3168_3845 | 225 |
| 360 | 3300049663 | Ga0501223_000626 | Ga0501223_000626_6461_7138 | 225 |
| 361 | 3300049664 | Ga0501224_000976 | Ga0501224_000976_366_1043 | 225 |
| 362 | 3300049668 | Ga0501233_003605 | Ga0501233_003605_412_1089 | 225 |
| 363 | 3300049669 | Ga0501235_002060 | Ga0501235_002060_412_1089 | 225 |
| 364 | 3300049674 | Ga0501242_007896 | Ga0501242_007896_191_868 | 225 |
| 365 | 3300049688 | Ga0501259_000085 | Ga0501259_000085_8328_9005 | 225 |
| 366 | 3300049704 | Ga0501221_000040 | Ga0501221_000040_10771_11448 | 225 |
| 367 | 3300049704 | Ga0501221_073321 | Ga0501221_073321_98_775 | 225 |
| 368 | 3300049705 | Ga0501225_0000296 | Ga0501225_0000296_12112_12789 | 225 |
| 369 | 3300049708 | Ga0501245_000232 | Ga0501245_000232_823_1500 | 225 |
| 370 | 3300049757 | Ga0501232_001638 | Ga0501232_001638_1107_1784 | 225 |
| 371 | 3300050507 | nmdc:mga05p37_15444_c1 | nmdc:mga05p37_15444_c1_8071_8748 | 225 |
| 372 | 3300050509 | nmdc:mga0qj67_101265_c1 | nmdc:mga0qj67_101265_c1_309_986 | 225 |
| 373 | 3300050510 | nmdc:mga06r32_247961_c1 | nmdc:mga06r32_247961_c1_1003_1680 | 225 |
| 374 | 3300050511 | nmdc:mga08y16_1028047_c1 | nmdc:mga08y16_1028047_c1_75_752 | 225 |
| 375 | 3300050512 | nmdc:mga0n895_106321_c1 | nmdc:mga0n895_106321_c1_1386_2063 | 225 |
| 376 | 3300053085 | Ga0495619_0398780 | Ga0495619_0398780_113_790 | 225 |
| 377 | 3300003320 | rootH2_10074209 | rootH2_100742092 | 226 |
| 378 | 3300005290 | Ga0065712_10245765 | Ga0065712_102457651 | 226 |
| 379 | 3300005293 | Ga0065715_10260744 | Ga0065715_102607442 | 226 |
| 380 | 3300005329 | Ga0070683_100046386 | Ga0070683_1000463862 | 226 |
| 381 | 3300005329 | Ga0070683_100313736 | Ga0070683_1003137362 | 226 |
| 382 | 3300005331 | Ga0070670_100344217 | Ga0070670_1003442172 | 226 |
| 383 | 3300005331 | Ga0070670_100403715 | Ga0070670_1004037152 | 226 |
| 384 | 3300005331 | Ga0070670_100513741 | Ga0070670_1005137412 | 226 |
| 385 | 3300005331 | Ga0070670_100700287 | Ga0070670_1007002871 | 226 |
| 386 | 3300005333 | Ga0070677_10010649 | Ga0070677_100106492 | 226 |
| 387 | 3300005333 | Ga0070677_10022835 | Ga0070677_100228351 | 226 |
| 388 | 3300005334 | Ga0068869_100226458 | Ga0068869_1002264583 | 226 |
| 389 | 3300005336 | Ga0070680_100057598 | Ga0070680_1000575982 | 226 |
| 390 | 3300005336 | Ga0070680_100063326 | Ga0070680_1000633263 | 226 |
| 391 | 3300005336 | Ga0070680_100203830 | Ga0070680_1002038302 | 226 |
| 392 | 3300005337 | Ga0070682_100000898 | Ga0070682_10000089813 | 226 |
| 393 | 3300005337 | Ga0070682_100005002 | Ga0070682_1000050022 | 226 |
| 394 | 3300005339 | Ga0070660_100011614 | Ga0070660_1000116145 | 226 |
| 395 | 3300005344 | Ga0070661_100039511 | Ga0070661_1000395115 | 226 |
| 396 | 3300005347 | Ga0070668_100112716 | Ga0070668_1001127162 | 226 |
| 397 | 3300005353 | Ga0070669_100206427 | Ga0070669_1002064272 | 226 |
| 398 | 3300005354 | Ga0070675_100005601 | Ga0070675_1000056012 | 226 |
| 399 | 3300005354 | Ga0070675_100177114 | Ga0070675_1001771142 | 226 |
| 400 | 3300005354 | Ga0070675_100234266 | Ga0070675_1002342662 | 226 |
| 401 | 3300005354 | Ga0070675_100243270 | Ga0070675_1002432702 | 226 |
| 402 | 3300005355 | Ga0070671_100177789 | Ga0070671_1001777893 | 226 |
| 403 | 3300005355 | Ga0070671_100232015 | Ga0070671_1002320152 | 226 |
| 404 | 3300005356 | Ga0070674_100123610 | Ga0070674_1001236102 | 226 |
| 405 | 3300005356 | Ga0070674_100151011 | Ga0070674_1001510112 | 226 |
| 406 | 3300005364 | Ga0070673_100019319 | Ga0070673_1000193193 | 226 |
| 407 | 3300005364 | Ga0070673_100223058 | Ga0070673_1002230582 | 226 |
| 408 | 3300005364 | Ga0070673_100546314 | Ga0070673_1005463141 | 226 |
| 409 | 3300005365 | Ga0070688_100407708 | Ga0070688_1004077081 | 226 |
| 410 | 3300005366 | Ga0070659_100002201 | Ga0070659_1000022014 | 226 |
| 411 | 3300005366 | Ga0070659_100003217 | Ga0070659_10000321712 | 226 |
| 412 | 3300005441 | Ga0070700_100108807 | Ga0070700_1001088072 | 226 |
| 413 | 3300005441 | Ga0070700_100305551 | Ga0070700_1003055511 | 226 |
| 414 | 3300005455 | Ga0070663_100202030 | Ga0070663_1002020302 | 226 |
| 415 | 3300005456 | Ga0070678_100012999 | Ga0070678_1000129992 | 226 |
| 416 | 3300005457 | Ga0070662_100002589 | Ga0070662_1000025892 | 226 |
| 417 | 3300005457 | Ga0070662_100160087 | Ga0070662_1001600871 | 226 |
| 418 | 3300005458 | Ga0070681_10023171 | Ga0070681_100231715 | 226 |
| 419 | 3300005458 | Ga0070681_10065136 | Ga0070681_100651362 | 226 |
| 420 | 3300005458 | Ga0070681_10189768 | Ga0070681_101897682 | 226 |
| 421 | 3300005459 | Ga0068867_100175283 | Ga0068867_1001752832 | 226 |
| 422 | 3300005459 | Ga0068867_100182422 | Ga0068867_1001824222 | 226 |
| 423 | 3300005459 | Ga0068867_100712168 | Ga0068867_1007121681 | 226 |
| 424 | 3300005530 | Ga0070679_100410669 | Ga0070679_1004106691 | 226 |
| 425 | 3300005530 | Ga0070679_100521239 | Ga0070679_1005212391 | 226 |
| 426 | 3300005535 | Ga0070684_100049346 | Ga0070684_1000493463 | 226 |
| 427 | 3300005539 | Ga0068853_100020987 | Ga0068853_1000209876 | 226 |
| 428 | 3300005543 | Ga0070672_100175708 | Ga0070672_1001757082 | 226 |
| 429 | 3300005547 | Ga0070693_100140584 | Ga0070693_1001405842 | 226 |
| 430 | 3300005547 | Ga0070693_100202030 | Ga0070693_1002020302 | 226 |
| 431 | 3300005563 | Ga0068855_100010405 | Ga0068855_1000104052 | 226 |
| 432 | 3300005563 | Ga0068855_100071437 | Ga0068855_1000714374 | 226 |
| 433 | 3300005564 | Ga0070664_100015196 | Ga0070664_1000151965 | 226 |
| 434 | 3300005564 | Ga0070664_100182884 | Ga0070664_1001828841 | 226 |
| 435 | 3300005564 | Ga0070664_100445671 | Ga0070664_1004456712 | 226 |
| 436 | 3300005577 | Ga0068857_100036876 | Ga0068857_1000368763 | 226 |
| 437 | 3300005577 | Ga0068857_100170350 | Ga0068857_1001703503 | 226 |
| 438 | 3300005577 | Ga0068857_100294249 | Ga0068857_1002942492 | 226 |
| 439 | 3300005577 | Ga0068857_100795688 | Ga0068857_1007956881 | 226 |
| 440 | 3300005578 | Ga0068854_100080884 | Ga0068854_1000808842 | 226 |
| 441 | 3300005578 | Ga0068854_100089597 | Ga0068854_1000895972 | 226 |
| 442 | 3300005578 | Ga0068854_100273553 | Ga0068854_1002735532 | 226 |
| 443 | 3300005578 | Ga0068854_100794721 | Ga0068854_1007947211 | 226 |
| 444 | 3300005614 | Ga0068856_100008272 | Ga0068856_10000827214 | 226 |
| 445 | 3300005616 | Ga0068852_100031046 | Ga0068852_1000310462 | 226 |
| 446 | 3300005616 | Ga0068852_100079172 | Ga0068852_1000791722 | 226 |
| 447 | 3300005616 | Ga0068852_100247315 | Ga0068852_1002473151 | 226 |
| 448 | 3300005617 | Ga0068859_100123761 | Ga0068859_1001237612 | 226 |
| 449 | 3300005617 | Ga0068859_100507894 | Ga0068859_1005078942 | 226 |
| 450 | 3300005618 | Ga0068864_100022550 | Ga0068864_1000225502 | 226 |
| 451 | 3300005719 | Ga0068861_100214083 | Ga0068861_1002140832 | 226 |
| 452 | 3300005719 | Ga0068861_100441983 | Ga0068861_1004419832 | 226 |
| 453 | 3300005719 | Ga0068861_100527192 | Ga0068861_1005271921 | 226 |
| 454 | 3300005985 | Ga0081539_10000524 | Ga0081539_1000052444 | 226 |
| 455 | 3300006237 | Ga0097621_100091931 | Ga0097621_1000919311 | 226 |
| 456 | 3300006237 | Ga0097621_100101648 | Ga0097621_1001016482 | 226 |
| 457 | 3300006237 | Ga0097621_100339013 | Ga0097621_1003390131 | 226 |
| 458 | 3300006358 | Ga0068871_100038927 | Ga0068871_1000389272 | 226 |
| 459 | 3300006358 | Ga0068871_100200844 | Ga0068871_1002008442 | 226 |
| 460 | 3300006358 | Ga0068871_100849822 | Ga0068871_1008498221 | 226 |
| 461 | 3300006844 | Ga0075428_100125178 | Ga0075428_1001251784 | 226 |
| 462 | 3300006847 | Ga0075431_100000819 | Ga0075431_10000081922 | 226 |
| 463 | 3300006931 | Ga0097620_100123764 | Ga0097620_1001237642 | 226 |
| 464 | 3300006931 | Ga0097620_100507894 | Ga0097620_1005078942 | 226 |
| 465 | 3300009147 | Ga0114129_10085834 | Ga0114129_100858342 | 226 |
| 466 | 3300009176 | Ga0105242_10255104 | Ga0105242_102551042 | 226 |
| 467 | 3300013100 | Ga0157373_10005796 | Ga0157373_100057963 | 226 |
| 468 | 3300013100 | Ga0157373_10146105 | Ga0157373_101461051 | 226 |
| 469 | 3300013100 | Ga0157373_10284207 | Ga0157373_102842072 | 226 |
| 470 | 3300013102 | Ga0157371_10017434 | Ga0157371_100174343 | 226 |
| 471 | 3300013104 | Ga0157370_10155762 | Ga0157370_101557622 | 226 |
| 472 | 3300013105 | Ga0157369_10003623 | Ga0157369_1000362312 | 226 |
| 473 | 3300013105 | Ga0157369_10017929 | Ga0157369_100179296 | 226 |
| 474 | 3300013105 | Ga0157369_10188310 | Ga0157369_101883101 | 226 |
| 475 | 3300013105 | Ga0157369_10436905 | Ga0157369_104369052 | 226 |
| 476 | 3300013105 | Ga0157369_10492352 | Ga0157369_104923522 | 226 |
| 477 | 3300013296 | Ga0157374_10032695 | Ga0157374_100326952 | 226 |
| 478 | 3300013296 | Ga0157374_10202733 | Ga0157374_102027332 | 226 |
| 479 | 3300013296 | Ga0157374_10213415 | Ga0157374_102134152 | 226 |
| 480 | 3300013296 | Ga0157374_10337840 | Ga0157374_103378401 | 226 |
| 481 | 3300013297 | Ga0157378_10010878 | Ga0157378_100108783 | 226 |
| 482 | 3300013297 | Ga0157378_10042212 | Ga0157378_100422122 | 226 |
| 483 | 3300013306 | Ga0163162_10054911 | Ga0163162_100549112 | 226 |
| 484 | 3300013306 | Ga0163162_10803724 | Ga0163162_108037241 | 226 |
| 485 | 3300013307 | Ga0157372_10022749 | Ga0157372_100227492 | 226 |
| 486 | 3300013307 | Ga0157372_10069540 | Ga0157372_100695403 | 226 |
| 487 | 3300013307 | Ga0157372_10096584 | Ga0157372_100965842 | 226 |
| 488 | 3300013307 | Ga0157372_10104668 | Ga0157372_101046683 | 226 |
| 489 | 3300013307 | Ga0157372_10358283 | Ga0157372_103582832 | 226 |
| 490 | 3300013308 | Ga0157375_10195399 | Ga0157375_101953991 | 226 |
| 491 | 3300013308 | Ga0157375_10317586 | Ga0157375_103175861 | 226 |
| 492 | 3300013308 | Ga0157375_10338491 | Ga0157375_103384912 | 226 |
| 493 | 3300014325 | Ga0163163_10349577 | Ga0163163_103495772 | 226 |
| 494 | 3300014326 | Ga0157380_10030721 | Ga0157380_100307213 | 226 |
| 495 | 3300014745 | Ga0157377_10121908 | Ga0157377_101219082 | 226 |
| 496 | 3300014745 | Ga0157377_10277173 | Ga0157377_102771732 | 226 |
| 497 | 3300014968 | Ga0157379_10532538 | Ga0157379_105325381 | 226 |
| 498 | 3300014969 | Ga0157376_10462459 | Ga0157376_104624592 | 226 |
| 499 | 3300017792 | Ga0163161_10161003 | Ga0163161_101610032 | 226 |
| 500 | 3300017792 | Ga0163161_10703309 | Ga0163161_107033091 | 226 |
| 501 | 3300021384 | Ga0213876_10209154 | Ga0213876_102091541 | 226 |
| 502 | 3300025893 | Ga0207682_10006104 | Ga0207682_100061042 | 226 |
| 503 | 3300025904 | Ga0207647_10208181 | Ga0207647_102081812 | 226 |
| 504 | 3300025912 | Ga0207707_10072889 | Ga0207707_100728892 | 226 |
| 505 | 3300025912 | Ga0207707_10336164 | Ga0207707_103361642 | 226 |
| 506 | 3300025912 | Ga0207707_10526505 | Ga0207707_105265051 | 226 |
| 507 | 3300025917 | Ga0207660_10118783 | Ga0207660_101187832 | 226 |
| 508 | 3300025917 | Ga0207660_10140282 | Ga0207660_101402822 | 226 |
| 509 | 3300025917 | Ga0207660_10300782 | Ga0207660_103007822 | 226 |
| 510 | 3300025917 | Ga0207660_10336967 | Ga0207660_103369672 | 226 |
| 511 | 3300025919 | Ga0207657_10002631 | Ga0207657_1000263116 | 226 |
| 512 | 3300025919 | Ga0207657_10015448 | Ga0207657_100154482 | 226 |
| 513 | 3300025920 | Ga0207649_10007616 | Ga0207649_100076161 | 226 |
| 514 | 3300025923 | Ga0207681_10176420 | Ga0207681_101764202 | 226 |
| 515 | 3300025925 | Ga0207650_10099559 | Ga0207650_100995592 | 226 |
| 516 | 3300025925 | Ga0207650_10301321 | Ga0207650_103013212 | 226 |
| 517 | 3300025925 | Ga0207650_10330083 | Ga0207650_103300832 | 226 |
| 518 | 3300025926 | Ga0207659_10030351 | Ga0207659_100303514 | 226 |
| 519 | 3300025926 | Ga0207659_10073851 | Ga0207659_100738512 | 226 |
| 520 | 3300025931 | Ga0207644_10077167 | Ga0207644_100771672 | 226 |
| 521 | 3300025931 | Ga0207644_10138276 | Ga0207644_101382761 | 226 |
| 522 | 3300025932 | Ga0207690_10042849 | Ga0207690_100428492 | 226 |
| 523 | 3300025932 | Ga0207690_10100160 | Ga0207690_101001602 | 226 |
| 524 | 3300025933 | Ga0207706_10002123 | Ga0207706_100021236 | 226 |
| 525 | 3300025933 | Ga0207706_10163155 | Ga0207706_101631552 | 226 |
| 526 | 3300025937 | Ga0207669_10074226 | Ga0207669_100742262 | 226 |
| 527 | 3300025940 | Ga0207691_10023665 | Ga0207691_100236652 | 226 |
| 528 | 3300025944 | Ga0207661_10028655 | Ga0207661_100286552 | 226 |
| 529 | 3300025944 | Ga0207661_10540867 | Ga0207661_105408672 | 226 |
| 530 | 3300025945 | Ga0207679_10052725 | Ga0207679_100527252 | 226 |
| 531 | 3300025945 | Ga0207679_10290285 | Ga0207679_102902851 | 226 |
| 532 | 3300025949 | Ga0207667_10042462 | Ga0207667_100424624 | 226 |
| 533 | 3300025949 | Ga0207667_10109792 | Ga0207667_101097921 | 226 |
| 534 | 3300025949 | Ga0207667_10754823 | Ga0207667_107548232 | 226 |
| 535 | 3300025960 | Ga0207651_10164013 | Ga0207651_101640132 | 226 |
| 536 | 3300025960 | Ga0207651_10294594 | Ga0207651_102945942 | 226 |
| 537 | 3300025972 | Ga0207668_10304116 | Ga0207668_103041161 | 226 |
| 538 | 3300025981 | Ga0207640_10128902 | Ga0207640_101289022 | 226 |
| 539 | 3300025981 | Ga0207640_10157065 | Ga0207640_101570652 | 226 |
| 540 | 3300025981 | Ga0207640_10623176 | Ga0207640_106231761 | 226 |
| 541 | 3300026041 | Ga0207639_10128486 | Ga0207639_101284862 | 226 |
| 542 | 3300026041 | Ga0207639_10302559 | Ga0207639_103025592 | 226 |
| 543 | 3300026067 | Ga0207678_10099469 | Ga0207678_100994692 | 226 |
| 544 | 3300026067 | Ga0207678_10458664 | Ga0207678_104586642 | 226 |
| 545 | 3300026075 | Ga0207708_10522470 | Ga0207708_105224702 | 226 |
| 546 | 3300026078 | Ga0207702_10515870 | Ga0207702_105158701 | 226 |
| 547 | 3300026089 | Ga0207648_10697942 | Ga0207648_106979421 | 226 |
| 548 | 3300026095 | Ga0207676_10046915 | Ga0207676_100469152 | 226 |
| 549 | 3300026095 | Ga0207676_10162582 | Ga0207676_101625822 | 226 |
| 550 | 3300026095 | Ga0207676_10308931 | Ga0207676_103089312 | 226 |
| 551 | 3300026116 | Ga0207674_10029406 | Ga0207674_100294063 | 226 |
| 552 | 3300026116 | Ga0207674_10228714 | Ga0207674_102287142 | 226 |
| 553 | 3300026116 | Ga0207674_10293757 | Ga0207674_102937572 | 226 |
| 554 | 3300026118 | Ga0207675_100137088 | Ga0207675_1001370882 | 226 |
| 555 | 3300026118 | Ga0207675_100335331 | Ga0207675_1003353312 | 226 |
| 556 | 3300026121 | Ga0207683_10183297 | Ga0207683_101832972 | 226 |
| 557 | 3300026121 | Ga0207683_10232255 | Ga0207683_102322552 | 226 |
| 558 | 3300026142 | Ga0207698_10037577 | Ga0207698_100375772 | 226 |
| 559 | 3300026142 | Ga0207698_10334794 | Ga0207698_103347941 | 226 |
| 560 | 3300026142 | Ga0207698_10426074 | Ga0207698_104260742 | 226 |
| 561 | 3300035692 | Ga0373935_0462933 | Ga0373935_0462933_18_707 | 226 |
| 562 | 3300037471 | Ga0395905_0000147 | Ga0395905_0000147_36060_36743 | 226 |
| 563 | 3300038443 | Ga0395901_0003274 | Ga0395901_0003274_1867_2550 | 226 |
| 564 | 3300039437 | Ga0436365_1298184 | Ga0436365_1298184_177_863 | 226 |
| 565 | 3300041459 | Ga0451800_1170264 | Ga0451800_1170264_221_901 | 226 |
| 566 | 3300045051 | Ga0451576_0337765 | Ga0451576_0337765_479_1159 | 226 |
| 567 | 3300045976 | Ga0466967_0196457 | Ga0466967_0196457_1183_1863 | 226 |
| 568 | 3300046543 | Ga0495645_0125971 | Ga0495645_0125971_53_757 | 226 |
| 569 | 3300047321 | Ga0495676_0279107 | Ga0495676_0279107_406_1092 | 226 |
| 570 | 3300049571 | Ga0501034_0472874 | Ga0501034_0472874_396_1082 | 226 |
| 571 | 3300049822 | Ga0501035_0388614 | Ga0501035_0388614_110_790 | 226 |
| 572 | 3300050507 | nmdc:mga05p37_361265_c1 | nmdc:mga05p37_361265_c1_867_1547 | 226 |
| 573 | 3300050510 | nmdc:mga06r32_39221_c1 | nmdc:mga06r32_39221_c1_3293_3973 | 226 |
| 574 | 3300053090 | Ga0500646_0020756 | Ga0500646_0020756_732_1418 | 226 |
| 575 | 3300031456 | Ga0307513_10126678 | Ga0307513_101266782 | 227 |
| 576 | 3300042876 | Ga0451577_0000207 | Ga0451577_0000207_76225_77001 | 227 |
| 577 | 3300044712 | Ga0453684_0000791 | Ga0453684_0000791_42668_43444 | 227 |
| 578 | 3300046616 | Ga0495668_0021334 | Ga0495668_0021334_2917_3603 | 227 |
| 579 | 3300053118 | Ga0500594_0030131 | Ga0500594_0030131_430_1116 | 227 |
| 580 | 3300053151 | Ga0500604_0041980 | Ga0500604_0041980_347_1033 | 227 |
| 581 | 2162886007 | SwRhRL2b_contig_1761633 | SwRhRL2b_0391.00005570 | 228 |
| 582 | 3300003320 | rootH2_10065440 | rootH2_100654401 | 228 |
| 583 | 3300003323 | rootH1_10066422 | rootH1_100664223 | 228 |
| 584 | 3300005289 | Ga0065704_10000195 | Ga0065704_1000019528 | 228 |
| 585 | 3300009093 | Ga0105240_10000101 | Ga0105240_10000101137 | 228 |
| 586 | 3300010375 | Ga0105239_10001340 | Ga0105239_1000134030 | 228 |
| 587 | 3300013104 | Ga0157370_10724093 | Ga0157370_107240931 | 228 |
| 588 | 3300025913 | Ga0207695_10000020 | Ga0207695_10000020562 | 228 |
| 589 | 3300031251 | Ga0265327_10000026 | Ga0265327_1000002667 | 228 |
| 590 | 3300031251 | Ga0265327_10000137 | Ga0265327_1000013719 | 228 |
| 591 | 3300046616 | Ga0495668_0000358 | Ga0495668_0000358_55516_56202 | 228 |
| 592 | 3300047318 | Ga0495636_0000025 | Ga0495636_0000025_9959_10645 | 228 |
| 593 | 3300047472 | Ga0495686_0000268 | Ga0495686_0000268_20720_21406 | 228 |
| 594 | 3300048918 | Ga0496115_0008451 | Ga0496115_0008451_5595_6281 | 228 |
| 595 | 3300049766 | Ga0501269_005323 | Ga0501269_005323_579_1265 | 228 |
| 596 | 3300049822 | Ga0501035_0154645 | Ga0501035_0154645_517_1203 | 228 |
| 597 | 3300053104 | Ga0500556_0046080 | Ga0500556_0046080_203_889 | 228 |
| 598 | 3300053116 | Ga0500592_018961 | Ga0500592_018961_284_970 | 228 |
| 599 | 3300053118 | Ga0500594_0119522 | Ga0500594_0119522_57_743 | 228 |
| 600 | 3300053136 | Ga0500559_0040682 | Ga0500559_0040682_321_1043 | 228 |
| 601 | 3300053153 | Ga0500616_0000850 | Ga0500616_0000850_8568_9254 | 228 |
| 602 | 3300053158 | Ga0500627_0006122 | Ga0500627_0006122_1794_2480 | 228 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zwm-assembly1.cif.gz_B | crystal structure of yycf receiver domain from bacillus subtilis | 0.9728 | 6 | 125 |
| 4jav-assembly1.cif.gz_D | structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v) | 0.9706 | 6 | 123 |
| 6ifh-assembly1.cif.gz_A | unphosphorylated spo0f from paenisporosarcina sp. tg-14 | 0.9701 | 6 | 124 |
| 2ftk-assembly2.cif.gz_H | berylloflouride spo0f complex with spo0b | 0.968 | 6 | 122 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9678 | 6 | 127 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P21866_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.978 | 6 | 86 | 3.40.50.2300 |
| af_Q2G2U6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9735 | 7 | 91 | 3.40.50.2300 |
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9735 | 7 | 90 | 3.40.50.2300 |
| 4ja2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9708 | 6 | 124 | 3.40.50.2300 |
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.969 | 5 | 86 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P6X3Q8-F1-model_v4 | Hybrid sensor histidine kinase/response regulator | 0.9818 | 6 | 125 |
GO:0000160
GO:0004672 |
| AF-A0A7C1FPA7-F1-model_v4 | Response regulator | 0.9774 | 5 | 127 |
GO:0000160
|
| AF-A0A496UPR2-F1-model_v4 | Diguanylate cyclase response regulator | 0.9769 | 3 | 128 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A849SFK7-F1-model_v4 | Response regulator | 0.9745 | 4 | 129 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A0K8MXI4-F1-model_v4 | Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain | 0.974 | 6 | 128 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar