F468174

General Info

Members Datasets Scaffolds Average Seq Length
602 242 599 226

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10146105|Ga0157373_101461051
Length 262
Sequence MHIKECDDAGYFCVNFVLMDTRAKTILIADDEQDILEIISYNLLKEGYIVYTATDGNEALEKARALEPDMLILDVMMPFKSGVEVCKILRSETRFKNTLILILTALSDEGSHIKGLDSGADDYVTKPVSPKVLLSRVNALFRRMVKEENDVLAEGDIIIDSSKYTVSVSGNIVSLARKEFELLHLLASKPGRVFLRNEILEQVWGNEVIVGDRTIDVHIRKIRQKLGVNCIATIKGVGYKFKTPTPSNPPERGEQLHSQILH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
4 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
205 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
211 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
212 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
213 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
214 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
215 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
216 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
217 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
218 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
219 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
220 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
221 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
222 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
223 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
224 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
225 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
226 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
227 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
236 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
237 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
238 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.66
Nodule 0
Rhizoplane 1.33
Rhizosphere 94.85
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1761633 2162886007 Bacteria 195701
2 rootH2_10065440 3300003320 Bacteria 1171
3 rootH2_10074209 3300003320 Bacteria 3946
4 rootH1_10066422 3300003323 Bacteria 27266
5 rootH1_10129104 3300003323 Bacteria 1145
6 Ga0065704_10000195 3300005289 Bacteria 195830
7 Ga0065712_10096550 3300005290 Bacteria 2180
8 Ga0065712_10124904 3300005290 Bacteria 1620
9 Ga0065712_10128532 3300005290 Bacteria 1577
10 Ga0065712_10245765 3300005290 Bacteria 972
11 Ga0065715_10090610 3300005293 Bacteria 6748
12 Ga0065715_10260744 3300005293 Bacteria 1139
13 Ga0065715_10473877 3300005293 Bacteria 803
14 Ga0065707_10115231 3300005295 Bacteria 2243
15 Ga0065707_10236188 3300005295 Bacteria 1171
16 Ga0070676_10049174 3300005328 Bacteria 2467
17 Ga0070683_100046386 3300005329 Bacteria 4014
18 Ga0070683_100049865 3300005329 Bacteria 3873
19 Ga0070683_100058948 3300005329 Bacteria 3566
20 Ga0070683_100075761 3300005329 Bacteria 3144
21 Ga0070683_100313736 3300005329 Unclassified 1492
22 Ga0070683_100454956 3300005329 Bacteria 1221
23 Ga0070670_100013054 3300005331 Bacteria 7115
24 Ga0070670_100344217 3300005331 Bacteria 1309
25 Ga0070670_100403715 3300005331 Bacteria 1207
26 Ga0070670_100513741 3300005331 Bacteria 1066
27 Ga0070670_100700287 3300005331 Unclassified 911
28 Ga0070677_10010649 3300005333 Bacteria 3150
29 Ga0070677_10022835 3300005333 Bacteria 2309
30 Ga0068869_100029819 3300005334 Bacteria 3826
31 Ga0068869_100035175 3300005334 Bacteria 3549
32 Ga0068869_100188993 3300005334 Bacteria 1619
33 Ga0068869_100226458 3300005334 Bacteria 1484
34 Ga0070666_10030514 3300005335 Bacteria 3552
35 Ga0070680_100057598 3300005336 Bacteria 3177
36 Ga0070680_100063326 3300005336 Bacteria 3029
37 Ga0070680_100203830 3300005336 Bacteria 1668
38 Ga0070682_100000898 3300005337 Bacteria 17372
39 Ga0070682_100005002 3300005337 Bacteria 7367
40 Ga0068868_100014752 3300005338 Bacteria 5765
41 Ga0068868_100054094 3300005338 Bacteria 3163
42 Ga0068868_100123198 3300005338 Bacteria 2116
43 Ga0070660_100011614 3300005339 Bacteria 6269
44 Ga0070689_100003385 3300005340 Bacteria 10599
45 Ga0070689_100008847 3300005340 Bacteria 7113
46 Ga0070689_100663633 3300005340 Bacteria 908
47 Ga0070687_100059417 3300005343 Bacteria 2013
48 Ga0070661_100039511 3300005344 Unclassified 3438
49 Ga0070661_100057180 3300005344 Bacteria 2858
50 Ga0070668_100112716 3300005347 Bacteria 2166
51 Ga0070668_100827447 3300005347 Bacteria 824
52 Ga0070669_100042552 3300005353 Bacteria 3306
53 Ga0070669_100150233 3300005353 Unclassified 1803
54 Ga0070669_100206427 3300005353 Bacteria 1548
55 Ga0070675_100005601 3300005354 Bacteria 9614
56 Ga0070675_100015260 3300005354 Bacteria 6068
57 Ga0070675_100056672 3300005354 Bacteria 3230
58 Ga0070675_100177114 3300005354 Unclassified 1842
59 Ga0070675_100234266 3300005354 Bacteria 1602
60 Ga0070675_100243270 3300005354 Bacteria 1572
61 Ga0070675_100577049 3300005354 Bacteria 1019
62 Ga0070671_100177789 3300005355 Bacteria 1801
63 Ga0070671_100232015 3300005355 Bacteria 1566
64 Ga0070674_100084865 3300005356 Unclassified 2272
65 Ga0070674_100123610 3300005356 Bacteria 1919
66 Ga0070674_100151011 3300005356 Bacteria 1753
67 Ga0070673_100019319 3300005364 Bacteria 4890
68 Ga0070673_100060957 3300005364 Bacteria 2992
69 Ga0070673_100084804 3300005364 Bacteria 2577
70 Ga0070673_100219867 3300005364 Bacteria 1643
71 Ga0070673_100223058 3300005364 Bacteria 1632
72 Ga0070673_100546314 3300005364 Bacteria 1052
73 Ga0070688_100009182 3300005365 Bacteria 5396
74 Ga0070688_100010676 3300005365 Bacteria 5072
75 Ga0070688_100041228 3300005365 Bacteria 2833
76 Ga0070688_100100078 3300005365 Bacteria 1910
77 Ga0070688_100407708 3300005365 Bacteria 1007
78 Ga0070659_100002201 3300005366 Bacteria 13860
79 Ga0070659_100003217 3300005366 Bacteria 11629
80 Ga0070659_100003749 3300005366 Bacteria 10841
81 Ga0070667_100024448 3300005367 Bacteria 5017
82 Ga0070667_100041132 3300005367 Bacteria 3878
83 Ga0070667_100042965 3300005367 Bacteria 3792
84 Ga0070667_100540380 3300005367 Unclassified 1070
85 Ga0070714_100000213 3300005435 Bacteria 46491
86 Ga0070701_10155713 3300005438 Bacteria 1320
87 Ga0070700_100108807 3300005441 Bacteria 1839
88 Ga0070700_100305551 3300005441 Bacteria 1163
89 Ga0070663_100202030 3300005455 Bacteria 1552
90 Ga0070663_100415306 3300005455 Bacteria 1103
91 Ga0070678_100012999 3300005456 Bacteria 5199
92 Ga0070678_100029146 3300005456 Bacteria 3776
93 Ga0070678_100053833 3300005456 Bacteria 2929
94 Ga0070662_100002589 3300005457 Bacteria 11146
95 Ga0070662_100160087 3300005457 Unclassified 1760
96 Ga0070681_10023171 3300005458 Bacteria 6246
97 Ga0070681_10065136 3300005458 Bacteria 3613
98 Ga0070681_10189768 3300005458 Bacteria 1975
99 Ga0068867_100171690 3300005459 Bacteria 1718
100 Ga0068867_100175283 3300005459 Bacteria 1701
101 Ga0068867_100178808 3300005459 Bacteria 1685
102 Ga0068867_100182422 3300005459 Bacteria 1670
103 Ga0068867_100283271 3300005459 Bacteria 1360
104 Ga0068867_100479142 3300005459 Unclassified 1066
105 Ga0068867_100712168 3300005459 Bacteria 887
106 Ga0070685_10042099 3300005466 Bacteria 2604
107 Ga0070685_10139106 3300005466 Bacteria 1526
108 Ga0070698_100002073 3300005471 Bacteria 22283
109 Ga0070698_100006662 3300005471 Bacteria 12525
110 Ga0070679_100410669 3300005530 Bacteria 1299
111 Ga0070679_100521239 3300005530 Bacteria 1132
112 Ga0070679_100707561 3300005530 Bacteria 950
113 Ga0070684_100000986 3300005535 Bacteria 20347
114 Ga0070684_100029966 3300005535 Bacteria 4618
115 Ga0070684_100049346 3300005535 Bacteria 3652
116 Ga0070684_100159848 3300005535 Bacteria 2043
117 Ga0068853_100020987 3300005539 Bacteria 5437
118 Ga0068853_100031075 3300005539 Bacteria 4515
119 Ga0068853_100161431 3300005539 Bacteria 2023
120 Ga0070672_100175708 3300005543 Bacteria 1783
121 Ga0070672_100490682 3300005543 Bacteria 1061
122 Ga0070672_100688149 3300005543 Unclassified 895
123 Ga0070672_100705768 3300005543 Unclassified 883
124 Ga0070686_100019936 3300005544 Unclassified 3962
125 Ga0070686_100046065 3300005544 Bacteria 2750
126 Ga0070693_100140584 3300005547 Bacteria 1519
127 Ga0070693_100202030 3300005547 Unclassified 1291
128 Ga0070665_100003118 3300005548 Bacteria 17855
129 Ga0070665_100211811 3300005548 Bacteria 1939
130 Ga0068855_100010405 3300005563 Bacteria 11221
131 Ga0068855_100071437 3300005563 Bacteria 4036
132 Ga0070664_100001066 3300005564 Bacteria 21588
133 Ga0070664_100010988 3300005564 Bacteria 7341
134 Ga0070664_100015196 3300005564 Bacteria 6290
135 Ga0070664_100182884 3300005564 Bacteria 1864
136 Ga0070664_100202292 3300005564 Bacteria 1772
137 Ga0070664_100445671 3300005564 Bacteria 1188
138 Ga0070664_100713386 3300005564 Bacteria 935
139 Ga0068857_100001057 3300005577 Bacteria 21331
140 Ga0068857_100036876 3300005577 Bacteria 4331
141 Ga0068857_100084064 3300005577 Bacteria 2844
142 Ga0068857_100089028 3300005577 Bacteria 2762
143 Ga0068857_100159720 3300005577 Bacteria 2045
144 Ga0068857_100170350 3300005577 Bacteria 1979
145 Ga0068857_100294249 3300005577 Bacteria 1496
146 Ga0068857_100795688 3300005577 Bacteria 903
147 Ga0068854_100017804 3300005578 Bacteria 4761
148 Ga0068854_100036801 3300005578 Bacteria 3433
149 Ga0068854_100080884 3300005578 Bacteria 2398
150 Ga0068854_100089597 3300005578 Bacteria 2286
151 Ga0068854_100105409 3300005578 Bacteria 2119
152 Ga0068854_100273553 3300005578 Bacteria 1357
153 Ga0068854_100467290 3300005578 Bacteria 1057
154 Ga0068854_100794721 3300005578 Unclassified 824
155 Ga0068856_100008272 3300005614 Bacteria 10141
156 Ga0068852_100000408 3300005616 Bacteria 28653
157 Ga0068852_100025982 3300005616 Bacteria 4752
158 Ga0068852_100031046 3300005616 Bacteria 4403
159 Ga0068852_100079172 3300005616 Bacteria 2910
160 Ga0068852_100201924 3300005616 Unclassified 1881
161 Ga0068852_100205485 3300005616 Unclassified 1865
162 Ga0068852_100247315 3300005616 Bacteria 1707
163 Ga0068859_100020034 3300005617 Bacteria 6717
164 Ga0068859_100070778 3300005617 Bacteria 3523
165 Ga0068859_100107278 3300005617 Bacteria 2853
166 Ga0068859_100123761 3300005617 Bacteria 2654
167 Ga0068859_100148481 3300005617 Bacteria 2420
168 Ga0068859_100482953 3300005617 Bacteria 1334
169 Ga0068859_100507894 3300005617 Bacteria 1300
170 Ga0068864_100005255 3300005618 Bacteria 10613
171 Ga0068864_100022550 3300005618 Bacteria 5279
172 Ga0068864_100045643 3300005618 Bacteria 3759
173 Ga0068864_100092076 3300005618 Unclassified 2675
174 Ga0068864_100279551 3300005618 Bacteria 1558
175 Ga0068866_10141056 3300005718 Bacteria 1383
176 Ga0068866_10363056 3300005718 Bacteria 924
177 Ga0068861_100096295 3300005719 Bacteria 2345
178 Ga0068861_100214083 3300005719 Bacteria 1625
179 Ga0068861_100441983 3300005719 Bacteria 1163
180 Ga0068861_100527192 3300005719 Bacteria 1072
181 Ga0068861_100639610 3300005719 Bacteria 981
182 Ga0068851_10090891 3300005834 Unclassified 1607
183 Ga0068870_10245413 3300005840 Bacteria 1108
184 Ga0068863_100101824 3300005841 Bacteria 2731
185 Ga0068863_100125348 3300005841 Bacteria 2450
186 Ga0068863_100139886 3300005841 Bacteria 2313
187 Ga0068863_100219986 3300005841 Bacteria 1829
188 Ga0068858_100028827 3300005842 Bacteria 5154
189 Ga0068858_100049735 3300005842 Bacteria 3881
190 Ga0068858_100222372 3300005842 Bacteria 1788
191 Ga0068858_100409755 3300005842 Bacteria 1303
192 Ga0068860_100072884 3300005843 Unclassified 3264
193 Ga0068860_100336253 3300005843 Bacteria 1484
194 Ga0081539_10000524 3300005985 Bacteria 79740
195 Ga0081539_10018196 3300005985 Bacteria 4890
196 Ga0070716_100025385 3300006173 Unclassified 3162
197 Ga0075366_10181519 3300006195 Bacteria 1278
198 Ga0097621_100019762 3300006237 Bacteria 5178
199 Ga0097621_100061777 3300006237 Bacteria 3073
200 Ga0097621_100091931 3300006237 Bacteria 2540
201 Ga0097621_100101648 3300006237 Bacteria 2419
202 Ga0097621_100105161 3300006237 Bacteria 2379
203 Ga0097621_100339013 3300006237 Bacteria 1335
204 Ga0068871_100002698 3300006358 Bacteria 12109
205 Ga0068871_100005072 3300006358 Bacteria 9199
206 Ga0068871_100038927 3300006358 Bacteria 3802
207 Ga0068871_100148795 3300006358 Bacteria 1996
208 Ga0068871_100200844 3300006358 Bacteria 1721
209 Ga0068871_100849822 3300006358 Bacteria 844
210 Ga0075428_100125178 3300006844 Bacteria 2797
211 Ga0075428_100645923 3300006844 Bacteria 1129
212 Ga0075431_100000819 3300006847 Bacteria 27158
213 Ga0075434_100216525 3300006871 Bacteria 1935
214 Ga0075429_100008423 3300006880 Bacteria 8972
215 Ga0068865_100769389 3300006881 Unclassified 828
216 Ga0097620_100020031 3300006931 Bacteria 6717
217 Ga0097620_100070782 3300006931 Bacteria 3523
218 Ga0097620_100107270 3300006931 Bacteria 2853
219 Ga0097620_100123764 3300006931 Bacteria 2654
220 Ga0097620_100148482 3300006931 Bacteria 2420
221 Ga0097620_100482965 3300006931 Bacteria 1334
222 Ga0097620_100507894 3300006931 Bacteria 1300
223 Ga0105240_10000101 3300009093 Bacteria 175584
224 Ga0105240_10151300 3300009093 Bacteria 2763
225 Ga0105240_10921005 3300009093 Bacteria 939
226 Ga0111539_10429915 3300009094 Bacteria 1537
227 Ga0111539_10544238 3300009094 Bacteria 1352
228 Ga0105245_10077676 3300009098 Bacteria 3027
229 Ga0105247_10094997 3300009101 Bacteria 1898
230 Ga0105247_10111194 3300009101 Unclassified 1764
231 Ga0105247_10171955 3300009101 Bacteria 1441
232 Ga0114129_10015558 3300009147 Bacteria 10816
233 Ga0114129_10085834 3300009147 Bacteria 4367
234 Ga0105241_10019760 3300009174 Bacteria 4971
235 Ga0105242_10001554 3300009176 Bacteria 18062
236 Ga0105242_10255104 3300009176 Unclassified 1582
237 Ga0105242_10514240 3300009176 Bacteria 1141
238 Ga0105242_10955308 3300009176 Bacteria 861
239 Ga0105248_10532062 3300009177 Unclassified 1325
240 Ga0105237_10011018 3300009545 Bacteria 9593
241 Ga0105249_10004487 3300009553 Bacteria 12067
242 Ga0105249_10047237 3300009553 Bacteria 3922
243 Ga0105249_10168679 3300009553 Bacteria 2121
244 Ga0105249_10950361 3300009553 Unclassified 927
245 Ga0105239_10001340 3300010375 Bacteria 33201
246 Ga0105239_10136443 3300010375 Unclassified 2731
247 Ga0105239_10258554 3300010375 Unclassified 1956
248 Ga0105246_10470554 3300011119 Unclassified 1061
249 Ga0157373_10005796 3300013100 Bacteria 9249
250 Ga0157373_10016506 3300013100 Bacteria 5384
251 Ga0157373_10070571 3300013100 Bacteria 2469
252 Ga0157373_10146105 3300013100 Bacteria 1663
253 Ga0157373_10284207 3300013100 Unclassified 1173
254 Ga0157373_10297973 3300013100 Bacteria 1144
255 Ga0157371_10010553 3300013102 Bacteria 7179
256 Ga0157371_10017434 3300013102 Bacteria 5334
257 Ga0157371_10047056 3300013102 Unclassified 3066
258 Ga0157370_10155762 3300013104 Bacteria 2125
259 Ga0157370_10157212 3300013104 Bacteria 2115
260 Ga0157370_10186269 3300013104 Bacteria 1927
261 Ga0157370_10724093 3300013104 Bacteria 907
262 Ga0157369_10003623 3300013105 Bacteria 18334
263 Ga0157369_10017929 3300013105 Bacteria 7948
264 Ga0157369_10188310 3300013105 Bacteria 2169
265 Ga0157369_10436905 3300013105 Bacteria 1356
266 Ga0157369_10492352 3300013105 Bacteria 1268
267 Ga0157374_10004211 3300013296 Bacteria 12089
268 Ga0157374_10005248 3300013296 Bacteria 10870
269 Ga0157374_10032695 3300013296 Bacteria 4739
270 Ga0157374_10202733 3300013296 Bacteria 1943
271 Ga0157374_10213415 3300013296 Unclassified 1893
272 Ga0157374_10337840 3300013296 Bacteria 1495
273 Ga0157374_10341585 3300013296 Bacteria 1486
274 Ga0157374_10994066 3300013296 Bacteria 858
275 Ga0157378_10010878 3300013297 Bacteria 7958
276 Ga0157378_10042212 3300013297 Bacteria 4048
277 Ga0157378_10113280 3300013297 Bacteria 2490
278 Ga0157378_10121852 3300013297 Bacteria 2405
279 Ga0157378_10195698 3300013297 Unclassified 1909
280 Ga0157378_10913927 3300013297 Bacteria 909
281 Ga0157378_11077751 3300013297 Bacteria 840
282 Ga0163162_10001289 3300013306 Bacteria 23440
283 Ga0163162_10006811 3300013306 Bacteria 11085
284 Ga0163162_10017115 3300013306 Bacteria 7092
285 Ga0163162_10033618 3300013306 Bacteria 5097
286 Ga0163162_10045996 3300013306 Bacteria 4374
287 Ga0163162_10054911 3300013306 Unclassified 4008
288 Ga0163162_10137523 3300013306 Bacteria 2555
289 Ga0163162_10190195 3300013306 Bacteria 2180
290 Ga0163162_10803724 3300013306 Unclassified 1058
291 Ga0157372_10022749 3300013307 Bacteria 6786
292 Ga0157372_10033595 3300013307 Bacteria 5636
293 Ga0157372_10069540 3300013307 Bacteria 3959
294 Ga0157372_10079978 3300013307 Bacteria 3697
295 Ga0157372_10096584 3300013307 Bacteria 3368
296 Ga0157372_10104668 3300013307 Bacteria 3236
297 Ga0157372_10107948 3300013307 Bacteria 3185
298 Ga0157372_10112593 3300013307 Bacteria 3118
299 Ga0157372_10358283 3300013307 Bacteria 1700
300 Ga0157372_10699290 3300013307 Bacteria 1180
301 Ga0157375_10016793 3300013308 Bacteria 6589
302 Ga0157375_10039198 3300013308 Unclassified 4558
303 Ga0157375_10078879 3300013308 Bacteria 3327
304 Ga0157375_10195399 3300013308 Unclassified 2178
305 Ga0157375_10317586 3300013308 Bacteria 1722
306 Ga0157375_10338491 3300013308 Bacteria 1670
307 Ga0163163_10000057 3300014325 Bacteria 124939
308 Ga0163163_10342084 3300014325 Bacteria 1551
309 Ga0163163_10349577 3300014325 Bacteria 1534
310 Ga0163163_10588390 3300014325 Bacteria 1176
311 Ga0157380_10030721 3300014326 Bacteria 4116
312 Ga0157380_10558024 3300014326 Bacteria 1125
313 Ga0157380_10678080 3300014326 Bacteria 1032
314 Ga0157377_10009380 3300014745 Bacteria 4799
315 Ga0157377_10027666 3300014745 Bacteria 3047
316 Ga0157377_10121908 3300014745 Bacteria 1581
317 Ga0157377_10245197 3300014745 Unclassified 1158
318 Ga0157377_10250416 3300014745 Bacteria 1148
319 Ga0157377_10277173 3300014745 Bacteria 1098
320 Ga0157379_10019926 3300014968 Bacteria 5926
321 Ga0157379_10056176 3300014968 Bacteria 3518
322 Ga0157379_10142004 3300014968 Bacteria 2165
323 Ga0157379_10161719 3300014968 Bacteria 2021
324 Ga0157379_10532538 3300014968 Bacteria 1091
325 Ga0157376_10024500 3300014969 Bacteria 4739
326 Ga0157376_10134873 3300014969 Bacteria 2208
327 Ga0157376_10462459 3300014969 Bacteria 1240
328 Ga0157376_11136568 3300014969 Bacteria 808
329 Ga0182005_1066751 3300015265 Bacteria 986
330 Ga0163161_10001319 3300017792 Bacteria 18478
331 Ga0163161_10035337 3300017792 Bacteria 3576
332 Ga0163161_10043822 3300017792 Bacteria 3222
333 Ga0163161_10092411 3300017792 Unclassified 2240
334 Ga0163161_10161003 3300017792 Bacteria 1711
335 Ga0163161_10345879 3300017792 Bacteria 1181
336 Ga0163161_10703309 3300017792 Bacteria 842
337 Ga0213876_10001203 3300021384 Bacteria 16315
338 Ga0213876_10209154 3300021384 Bacteria 1037
339 Ga0207697_10068658 3300025315 Unclassified 1483
340 Ga0207682_10006104 3300025893 Bacteria 4871
341 Ga0207682_10065741 3300025893 Bacteria 1527
342 Ga0207680_10064779 3300025903 Bacteria 2242
343 Ga0207647_10000086 3300025904 Bacteria 71173
344 Ga0207647_10023084 3300025904 Bacteria 4120
345 Ga0207647_10098581 3300025904 Bacteria 1736
346 Ga0207647_10208181 3300025904 Unclassified 1130
347 Ga0207645_10016219 3300025907 Bacteria 4934
348 Ga0207645_10321236 3300025907 Bacteria 1032
349 Ga0207643_10203062 3300025908 Bacteria 1207
350 Ga0207705_10590150 3300025909 Bacteria 864
351 Ga0207654_10136045 3300025911 Unclassified 1561
352 Ga0207654_10377523 3300025911 Bacteria 981
353 Ga0207707_10072889 3300025912 Bacteria 2994
354 Ga0207707_10336164 3300025912 Bacteria 1303
355 Ga0207707_10526505 3300025912 Bacteria 1006
356 Ga0207695_10000020 3300025913 Bacteria 723025
357 Ga0207695_10032968 3300025913 Bacteria 5659
358 Ga0207671_10000149 3300025914 Bacteria 107722
359 Ga0207671_10586589 3300025914 Unclassified 888
360 Ga0207660_10118783 3300025917 Bacteria 2000
361 Ga0207660_10140282 3300025917 Bacteria 1847
362 Ga0207660_10300782 3300025917 Bacteria 1277
363 Ga0207660_10336967 3300025917 Bacteria 1207
364 Ga0207662_10024602 3300025918 Bacteria 3465
365 Ga0207657_10002631 3300025919 Bacteria 19391
366 Ga0207657_10015448 3300025919 Bacteria 7395
367 Ga0207657_10056878 3300025919 Bacteria 3373
368 Ga0207657_10166852 3300025919 Bacteria 1785
369 Ga0207657_10177070 3300025919 Bacteria 1725
370 Ga0207649_10007616 3300025920 Bacteria 5887
371 Ga0207649_10240879 3300025920 Bacteria 1298
372 Ga0207649_10578119 3300025920 Unclassified 862
373 Ga0207681_10176420 3300025923 Bacteria 1624
374 Ga0207681_10243954 3300025923 Bacteria 1400
375 Ga0207681_10514777 3300025923 Bacteria 981
376 Ga0207650_10086041 3300025925 Bacteria 2392
377 Ga0207650_10099559 3300025925 Bacteria 2235
378 Ga0207650_10185890 3300025925 Bacteria 1658
379 Ga0207650_10301321 3300025925 Bacteria 1309
380 Ga0207650_10330083 3300025925 Bacteria 1251
381 Ga0207650_10579723 3300025925 Bacteria 942
382 Ga0207659_10005468 3300025926 Bacteria 7702
383 Ga0207659_10027410 3300025926 Bacteria 3857
384 Ga0207659_10030351 3300025926 Bacteria 3692
385 Ga0207659_10050668 3300025926 Bacteria 2950
386 Ga0207659_10073851 3300025926 Bacteria 2498
387 Ga0207664_10000130 3300025929 Bacteria 65679
388 Ga0207644_10077167 3300025931 Bacteria 2453
389 Ga0207644_10138276 3300025931 Bacteria 1873
390 Ga0207690_10010195 3300025932 Bacteria 5581
391 Ga0207690_10017217 3300025932 Bacteria 4410
392 Ga0207690_10042849 3300025932 Bacteria 2975
393 Ga0207690_10100160 3300025932 Bacteria 2067
394 Ga0207706_10002123 3300025933 Bacteria 19419
395 Ga0207706_10003789 3300025933 Bacteria 14414
396 Ga0207706_10015762 3300025933 Bacteria 6831
397 Ga0207706_10163155 3300025933 Unclassified 1959
398 Ga0207686_10001429 3300025934 Bacteria 13535
399 Ga0207686_10076778 3300025934 Bacteria 2167
400 Ga0207670_10008526 3300025936 Bacteria 5791
401 Ga0207670_10120250 3300025936 Bacteria 1908
402 Ga0207670_10148279 3300025936 Bacteria 1737
403 Ga0207669_10074226 3300025937 Bacteria 2150
404 Ga0207669_10315714 3300025937 Bacteria 1194
405 Ga0207704_10284718 3300025938 Bacteria 1258
406 Ga0207691_10023665 3300025940 Bacteria 5783
407 Ga0207691_10083725 3300025940 Unclassified 2864
408 Ga0207691_10283220 3300025940 Bacteria 1426
409 Ga0207691_10800613 3300025940 Bacteria 792
410 Ga0207711_10029203 3300025941 Bacteria 4648
411 Ga0207689_10018112 3300025942 Bacteria 5948
412 Ga0207689_10031915 3300025942 Bacteria 4380
413 Ga0207689_10066606 3300025942 Bacteria 2960
414 Ga0207689_10086264 3300025942 Bacteria 2580
415 Ga0207661_10028655 3300025944 Bacteria 4267
416 Ga0207661_10144623 3300025944 Bacteria 2050
417 Ga0207661_10347514 3300025944 Unclassified 1337
418 Ga0207661_10540867 3300025944 Bacteria 1067
419 Ga0207679_10052725 3300025945 Bacteria 2985
420 Ga0207679_10069183 3300025945 Bacteria 2655
421 Ga0207679_10091130 3300025945 Bacteria 2358
422 Ga0207679_10290285 3300025945 Bacteria 1406
423 Ga0207667_10042462 3300025949 Bacteria 4833
424 Ga0207667_10109792 3300025949 Bacteria 2845
425 Ga0207667_10424047 3300025949 Bacteria 1353
426 Ga0207667_10754823 3300025949 Bacteria 972
427 Ga0207651_10109883 3300025960 Bacteria 2067
428 Ga0207651_10164013 3300025960 Bacteria 1745
429 Ga0207651_10294594 3300025960 Bacteria 1347
430 Ga0207651_10442176 3300025960 Unclassified 1114
431 Ga0207651_10664613 3300025960 Unclassified 915
432 Ga0207712_10080263 3300025961 Bacteria 2372
433 Ga0207668_10304116 3300025972 Unclassified 1317
434 Ga0207640_10079271 3300025981 Unclassified 2238
435 Ga0207640_10128902 3300025981 Bacteria 1825
436 Ga0207640_10157065 3300025981 Bacteria 1678
437 Ga0207640_10498353 3300025981 Bacteria 1014
438 Ga0207640_10623176 3300025981 Unclassified 916
439 Ga0207658_10110947 3300025986 Unclassified 2168
440 Ga0207658_10180213 3300025986 Bacteria 1748
441 Ga0207677_10027624 3300026023 Bacteria 3578
442 Ga0207677_10059742 3300026023 Bacteria 2631
443 Ga0207677_10136816 3300026023 Bacteria 1869
444 Ga0207677_10183592 3300026023 Unclassified 1647
445 Ga0207677_10213676 3300026023 Bacteria 1542
446 Ga0207703_10116988 3300026035 Unclassified 2283
447 Ga0207703_10188510 3300026035 Bacteria 1825
448 Ga0207639_10047564 3300026041 Bacteria 3243
449 Ga0207639_10128486 3300026041 Bacteria 2094
450 Ga0207639_10143424 3300026041 Bacteria 1993
451 Ga0207639_10302559 3300026041 Bacteria 1414
452 Ga0207678_10075499 3300026067 Bacteria 2887
453 Ga0207678_10099469 3300026067 Bacteria 2484
454 Ga0207678_10458664 3300026067 Bacteria 1108
455 Ga0207678_10732635 3300026067 Bacteria 871
456 Ga0207708_10522470 3300026075 Bacteria 998
457 Ga0207702_10515870 3300026078 Bacteria 1166
458 Ga0207641_10001009 3300026088 Bacteria 28707
459 Ga0207641_10044727 3300026088 Bacteria 3724
460 Ga0207641_10169704 3300026088 Bacteria 1990
461 Ga0207648_10011552 3300026089 Bacteria 8315
462 Ga0207648_10105422 3300026089 Unclassified 2473
463 Ga0207648_10164037 3300026089 Bacteria 1963
464 Ga0207648_10164394 3300026089 Bacteria 1961
465 Ga0207648_10288854 3300026089 Bacteria 1468
466 Ga0207648_10303544 3300026089 Bacteria 1432
467 Ga0207648_10366753 3300026089 Bacteria 1300
468 Ga0207648_10697942 3300026089 Bacteria 940
469 Ga0207676_10046915 3300026095 Bacteria 3346
470 Ga0207676_10162582 3300026095 Bacteria 1936
471 Ga0207676_10183116 3300026095 Bacteria 1836
472 Ga0207676_10257272 3300026095 Bacteria 1574
473 Ga0207676_10265681 3300026095 Bacteria 1551
474 Ga0207676_10308931 3300026095 Bacteria 1447
475 Ga0207676_10498058 3300026095 Unclassified 1156
476 Ga0207674_10006488 3300026116 Bacteria 13757
477 Ga0207674_10023606 3300026116 Bacteria 6584
478 Ga0207674_10029406 3300026116 Bacteria 5785
479 Ga0207674_10166871 3300026116 Bacteria 2156
480 Ga0207674_10228714 3300026116 Bacteria 1808
481 Ga0207674_10293757 3300026116 Bacteria 1574
482 Ga0207675_100001610 3300026118 Bacteria 22621
483 Ga0207675_100089414 3300026118 Unclassified 2894
484 Ga0207675_100115538 3300026118 Bacteria 2536
485 Ga0207675_100137088 3300026118 Bacteria 2323
486 Ga0207675_100151516 3300026118 Bacteria 2207
487 Ga0207675_100335331 3300026118 Bacteria 1479
488 Ga0207683_10016242 3300026121 Bacteria 6335
489 Ga0207683_10075273 3300026121 Bacteria 2988
490 Ga0207683_10183297 3300026121 Bacteria 1899
491 Ga0207683_10232255 3300026121 Bacteria 1682
492 Ga0207698_10002201 3300026142 Bacteria 11533
493 Ga0207698_10037577 3300026142 Bacteria 3568
494 Ga0207698_10072781 3300026142 Bacteria 2733
495 Ga0207698_10297183 3300026142 Bacteria 1501
496 Ga0207698_10334794 3300026142 Bacteria 1423
497 Ga0207698_10426074 3300026142 Bacteria 1274
498 Ga0268266_10039663 3300028379 Bacteria 4011
499 Ga0268266_10091456 3300028379 Bacteria 2668
500 Ga0268265_10164812 3300028380 Bacteria 1888
501 Ga0268264_10078525 3300028381 Bacteria 2814
502 Ga0268264_10131462 3300028381 Bacteria 2220
503 Ga0265338_10265573 3300028800 Bacteria 1260
504 Ga0265327_10000026 3300031251 Bacteria 379288
505 Ga0265327_10000137 3300031251 Bacteria 160704
506 Ga0307513_10126678 3300031456 Bacteria 2508
507 Ga0307410_10580170 3300031852 Bacteria 933
508 Ga0307412_10080211 3300031911 Bacteria 2254
509 Ga0307414_10108576 3300032004 Unclassified 2106
510 Ga0373934_0129562 3300035086 Bacteria 1029
511 Ga0373936_0201376 3300035113 Bacteria 879
512 Ga0373935_0462933 3300035692 Unclassified 917
513 Ga0373933_0403489 3300035724 Bacteria 892
514 Ga0395905_0000147 3300037471 Bacteria 116389
515 Ga0395901_0003274 3300038443 Bacteria 16310
516 Ga0436365_0493931 3300039437 Bacteria 27882
517 Ga0436365_1298184 3300039437 Bacteria 1021
518 Ga0436365_1346643 3300039437 Bacteria 734
519 Ga0451800_1170264 3300041459 Bacteria 1001
520 Ga0451807_0520014 3300041486 Bacteria 787
521 Ga0451807_1625491 3300041486 Bacteria 1293
522 Ga0451853_2800764 3300041512 Unclassified 838
523 Ga0439433_0049887 3300041999 Bacteria 985
524 Ga0451577_0000207 3300042876 Bacteria 123185
525 Ga0466972_0000051 3300044658 Bacteria 114011
526 Ga0466972_0112802 3300044658 Bacteria 1284
527 Ga0453684_0000791 3300044712 Bacteria 108441
528 Ga0466971_0150649 3300044719 Bacteria 1086
529 Ga0466970_0000688 3300044765 Bacteria 16522
530 Ga0466957_0180348 3300044842 Unclassified 1379
531 Ga0466959_0044904 3300045049 Bacteria 3255
532 Ga0451576_0337765 3300045051 Bacteria 1577
533 Ga0466967_0196457 3300045976 Bacteria 1909
534 Ga0495618_0252414 3300046514 Bacteria 1106
535 Ga0495628_0107595 3300046516 Bacteria 2147
536 Ga0495586_0073243 3300046535 Bacteria 1874
537 Ga0495587_0124133 3300046536 Bacteria 1478
538 Ga0495598_0102805 3300046537 Bacteria 948
539 Ga0495645_0125971 3300046543 Bacteria 1800
540 Ga0495667_0440456 3300046559 Bacteria 819
541 Ga0495668_0000358 3300046616 Bacteria 60551
542 Ga0495668_0021334 3300046616 Bacteria 3716
543 Ga0495634_0147324 3300046642 Bacteria 1491
544 Ga0495611_0144668 3300046648 Bacteria 1110
545 Ga0495635_0228688 3300046663 Bacteria 1257
546 Ga0495600_0126170 3300046809 Bacteria 1665
547 Ga0495636_0000025 3300047318 Bacteria 66081
548 Ga0495676_0279107 3300047321 Unclassified 1132
549 Ga0495686_0000268 3300047472 Bacteria 93255
550 Ga0496108_0175714 3300048911 Unclassified 1854
551 Ga0496110_0025271 3300048913 Bacteria 5074
552 Ga0496111_0238757 3300048914 Bacteria 1350
553 Ga0496114_0101492 3300048917 Unclassified 2457
554 Ga0496115_0008451 3300048918 Bacteria 7616
555 Ga0501296_006409 3300049519 Bacteria 1333
556 Ga0501297_016016 3300049520 Bacteria 902
557 Ga0501034_0000004 3300049571 Bacteria 382255
558 Ga0501034_0472874 3300049571 Bacteria 1169
559 Ga0501036_0023793 3300049572 Bacteria 5162
560 Ga0501043_0141045 3300049579 Unclassified 1887
561 Ga0501047_0059686 3300049581 Bacteria 3683
562 Ga0501198_028864 3300049649 Bacteria 917
563 Ga0501201_000380 3300049651 Bacteria 4079
564 Ga0501202_001260 3300049652 Bacteria 4003
565 Ga0501206_000437 3300049653 Bacteria 4992
566 Ga0501207_001771 3300049654 Bacteria 2733
567 Ga0501211_005127 3300049658 Bacteria 1319
568 Ga0501217_000866 3300049661 Bacteria 5368
569 Ga0501223_000626 3300049663 Bacteria 8471
570 Ga0501224_000976 3300049664 Bacteria 3707
571 Ga0501233_003605 3300049668 Bacteria 2791
572 Ga0501235_002060 3300049669 Bacteria 4319
573 Ga0501242_007896 3300049674 Bacteria 1236
574 Ga0501259_000085 3300049688 Bacteria 13267
575 Ga0501221_000040 3300049704 Bacteria 12964
576 Ga0501221_073321 3300049704 Bacteria 812
577 Ga0501225_0000296 3300049705 Bacteria 15500
578 Ga0501245_000232 3300049708 Bacteria 6303
579 Ga0501232_001638 3300049757 Bacteria 1821
580 Ga0501269_005323 3300049766 Bacteria 1549
581 Ga0501035_0154645 3300049822 Bacteria 1988
582 Ga0501035_0388614 3300049822 Bacteria 1163
583 nmdc:mga05p37_15444_c1 3300050507 Bacteria 9174
584 nmdc:mga05p37_361265_c1 3300050507 Bacteria 1707
585 nmdc:mga0qj67_101265_c1 3300050509 Bacteria 2322
586 nmdc:mga06r32_247961_c1 3300050510 Bacteria 1768
587 nmdc:mga06r32_39221_c1 3300050510 Bacteria 4493
588 nmdc:mga08y16_1028047_c1 3300050511 Unclassified 803
589 nmdc:mga0n895_106321_c1 3300050512 Bacteria 2819
590 Ga0495619_0398780 3300053085 Bacteria 950
591 Ga0500646_0020756 3300053090 Unclassified 1747
592 Ga0500556_0046080 3300053104 Bacteria 1559
593 Ga0500592_018961 3300053116 Bacteria 1105
594 Ga0500594_0030131 3300053118 Bacteria 1423
595 Ga0500594_0119522 3300053118 Unclassified 826
596 Ga0500559_0040682 3300053136 Bacteria 2025
597 Ga0500604_0041980 3300053151 Bacteria 1385
598 Ga0500616_0000850 3300053153 Bacteria 34025
599 Ga0500627_0006122 3300053158 Bacteria 4066

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_0520014 Ga0451807_0520014_15_641 208
2 3300005530 Ga0070679_100707561 Ga0070679_1007075611 210
3 3300005985 Ga0081539_10018196 Ga0081539_100181962 211
4 3300013104 Ga0157370_10186269 Ga0157370_101862691 214
5 3300005295 Ga0065707_10115231 Ga0065707_101152312 217
6 3300005577 Ga0068857_100089028 Ga0068857_1000890282 217
7 3300005618 Ga0068864_100045643 Ga0068864_1000456432 217
8 3300006844 Ga0075428_100645923 Ga0075428_1006459232 217
9 3300025925 Ga0207650_10185890 Ga0207650_101858901 217
10 3300026116 Ga0207674_10166871 Ga0207674_101668712 217
11 3300005578 Ga0068854_100105409 Ga0068854_1001054092 219
12 3300009093 Ga0105240_10921005 Ga0105240_109210051 219
13 3300009545 Ga0105237_10011018 Ga0105237_1001101811 219
14 3300025914 Ga0207671_10000149 Ga0207671_1000014940 219
15 3300003323 rootH1_10129104 rootH1_101291042 220
16 3300005335 Ga0070666_10030514 Ga0070666_100305142 220
17 3300005367 Ga0070667_100024448 Ga0070667_1000244482 220
18 3300005456 Ga0070678_100053833 Ga0070678_1000538332 220
19 3300005841 Ga0068863_100101824 Ga0068863_1001018242 220
20 3300026095 Ga0207676_10183116 Ga0207676_101831162 220
21 iso_pu_bacteria 2818991444 2819586241 221
22 iso_pu_bacteria 2929154850 2929158848 221
23 3300025907 Ga0207645_10321236 Ga0207645_103212361 222
24 3300025909 Ga0207705_10590150 Ga0207705_105901501 222
25 3300005548 Ga0070665_100003118 Ga0070665_1000031184 223
26 3300005719 Ga0068861_100639610 Ga0068861_1006396102 223
27 3300006881 Ga0068865_100769389 Ga0068865_1007693891 223
28 3300009093 Ga0105240_10151300 Ga0105240_101513003 223
29 3300010375 Ga0105239_10258554 Ga0105239_102585541 223
30 3300025904 Ga0207647_10023084 Ga0207647_100230844 223
31 3300025913 Ga0207695_10032968 Ga0207695_100329685 223
32 3300025914 Ga0207671_10586589 Ga0207671_105865891 223
33 3300028379 Ga0268266_10039663 Ga0268266_100396633 223
34 3300041999 Ga0439433_0049887 Ga0439433_0049887_214_885 223
35 3300049571 Ga0501034_0000004 Ga0501034_0000004_370118_370792 223
36 iso_pu_bacteria 2881955468 2881957107 223
37 3300005366 Ga0070659_100003749 Ga0070659_1000037497 224
38 3300005616 Ga0068852_100000408 Ga0068852_1000004084 224
39 3300013100 Ga0157373_10016506 Ga0157373_100165062 224
40 3300013100 Ga0157373_10070571 Ga0157373_100705712 224
41 3300013102 Ga0157371_10010553 Ga0157371_1001055311 224
42 3300013307 Ga0157372_10079978 Ga0157372_100799782 224
43 3300013307 Ga0157372_10112593 Ga0157372_101125934 224
44 3300025904 Ga0207647_10000086 Ga0207647_1000008612 224
45 3300025919 Ga0207657_10166852 Ga0207657_101668522 224
46 3300025919 Ga0207657_10177070 Ga0207657_101770702 224
47 3300025932 Ga0207690_10010195 Ga0207690_100101952 224
48 3300025944 Ga0207661_10144623 Ga0207661_101446232 224
49 3300026041 Ga0207639_10047564 Ga0207639_100475643 224
50 3300026142 Ga0207698_10002201 Ga0207698_100022012 224
51 3300026142 Ga0207698_10297183 Ga0207698_102971832 224
52 3300044658 Ga0466972_0112802 Ga0466972_0112802_548_1222 224
53 3300045049 Ga0466959_0044904 Ga0466959_0044904_933_1607 224
54 3300005290 Ga0065712_10096550 Ga0065712_100965502 225
55 3300005290 Ga0065712_10124904 Ga0065712_101249043 225
56 3300005290 Ga0065712_10128532 Ga0065712_101285322 225
57 3300005293 Ga0065715_10090610 Ga0065715_100906102 225
58 3300005293 Ga0065715_10473877 Ga0065715_104738771 225
59 3300005295 Ga0065707_10236188 Ga0065707_102361882 225
60 3300005328 Ga0070676_10049174 Ga0070676_100491742 225
61 3300005329 Ga0070683_100049865 Ga0070683_1000498652 225
62 3300005329 Ga0070683_100058948 Ga0070683_1000589482 225
63 3300005329 Ga0070683_100075761 Ga0070683_1000757611 225
64 3300005329 Ga0070683_100454956 Ga0070683_1004549562 225
65 3300005331 Ga0070670_100013054 Ga0070670_1000130544 225
66 3300005334 Ga0068869_100029819 Ga0068869_1000298193 225
67 3300005334 Ga0068869_100035175 Ga0068869_1000351753 225
68 3300005334 Ga0068869_100188993 Ga0068869_1001889932 225
69 3300005338 Ga0068868_100014752 Ga0068868_1000147525 225
70 3300005338 Ga0068868_100054094 Ga0068868_1000540943 225
71 3300005338 Ga0068868_100123198 Ga0068868_1001231982 225
72 3300005340 Ga0070689_100003385 Ga0070689_1000033853 225
73 3300005340 Ga0070689_100008847 Ga0070689_1000088477 225
74 3300005340 Ga0070689_100663633 Ga0070689_1006636331 225
75 3300005343 Ga0070687_100059417 Ga0070687_1000594172 225
76 3300005344 Ga0070661_100057180 Ga0070661_1000571801 225
77 3300005347 Ga0070668_100827447 Ga0070668_1008274471 225
78 3300005353 Ga0070669_100042552 Ga0070669_1000425522 225
79 3300005353 Ga0070669_100150233 Ga0070669_1001502331 225
80 3300005354 Ga0070675_100015260 Ga0070675_1000152604 225
81 3300005354 Ga0070675_100056672 Ga0070675_1000566722 225
82 3300005354 Ga0070675_100577049 Ga0070675_1005770491 225
83 3300005356 Ga0070674_100084865 Ga0070674_1000848652 225
84 3300005364 Ga0070673_100060957 Ga0070673_1000609572 225
85 3300005364 Ga0070673_100084804 Ga0070673_1000848042 225
86 3300005364 Ga0070673_100219867 Ga0070673_1002198672 225
87 3300005365 Ga0070688_100009182 Ga0070688_1000091824 225
88 3300005365 Ga0070688_100010676 Ga0070688_1000106763 225
89 3300005365 Ga0070688_100041228 Ga0070688_1000412282 225
90 3300005365 Ga0070688_100100078 Ga0070688_1001000782 225
91 3300005367 Ga0070667_100041132 Ga0070667_1000411322 225
92 3300005367 Ga0070667_100042965 Ga0070667_1000429652 225
93 3300005367 Ga0070667_100540380 Ga0070667_1005403802 225
94 3300005435 Ga0070714_100000213 Ga0070714_10000021337 225
95 3300005438 Ga0070701_10155713 Ga0070701_101557131 225
96 3300005455 Ga0070663_100415306 Ga0070663_1004153061 225
97 3300005456 Ga0070678_100029146 Ga0070678_1000291464 225
98 3300005459 Ga0068867_100171690 Ga0068867_1001716902 225
99 3300005459 Ga0068867_100178808 Ga0068867_1001788082 225
100 3300005459 Ga0068867_100283271 Ga0068867_1002832712 225
101 3300005459 Ga0068867_100479142 Ga0068867_1004791422 225
102 3300005466 Ga0070685_10042099 Ga0070685_100420991 225
103 3300005466 Ga0070685_10139106 Ga0070685_101391062 225
104 3300005471 Ga0070698_100002073 Ga0070698_10000207319 225
105 3300005471 Ga0070698_100006662 Ga0070698_1000066625 225
106 3300005535 Ga0070684_100000986 Ga0070684_1000009862 225
107 3300005535 Ga0070684_100029966 Ga0070684_1000299662 225
108 3300005535 Ga0070684_100159848 Ga0070684_1001598482 225
109 3300005539 Ga0068853_100031075 Ga0068853_1000310752 225
110 3300005539 Ga0068853_100161431 Ga0068853_1001614312 225
111 3300005543 Ga0070672_100490682 Ga0070672_1004906822 225
112 3300005543 Ga0070672_100688149 Ga0070672_1006881491 225
113 3300005543 Ga0070672_100705768 Ga0070672_1007057681 225
114 3300005544 Ga0070686_100019936 Ga0070686_1000199362 225
115 3300005544 Ga0070686_100046065 Ga0070686_1000460652 225
116 3300005548 Ga0070665_100211811 Ga0070665_1002118112 225
117 3300005564 Ga0070664_100001066 Ga0070664_1000010662 225
118 3300005564 Ga0070664_100010988 Ga0070664_1000109881 225
119 3300005564 Ga0070664_100202292 Ga0070664_1002022922 225
120 3300005564 Ga0070664_100713386 Ga0070664_1007133861 225
121 3300005577 Ga0068857_100001057 Ga0068857_1000010572 225
122 3300005577 Ga0068857_100084064 Ga0068857_1000840643 225
123 3300005577 Ga0068857_100159720 Ga0068857_1001597201 225
124 3300005578 Ga0068854_100017804 Ga0068854_1000178042 225
125 3300005578 Ga0068854_100036801 Ga0068854_1000368013 225
126 3300005578 Ga0068854_100467290 Ga0068854_1004672901 225
127 3300005616 Ga0068852_100025982 Ga0068852_1000259822 225
128 3300005616 Ga0068852_100201924 Ga0068852_1002019241 225
129 3300005616 Ga0068852_100205485 Ga0068852_1002054852 225
130 3300005617 Ga0068859_100020034 Ga0068859_1000200344 225
131 3300005617 Ga0068859_100070778 Ga0068859_1000707782 225
132 3300005617 Ga0068859_100107278 Ga0068859_1001072783 225
133 3300005617 Ga0068859_100148481 Ga0068859_1001484812 225
134 3300005617 Ga0068859_100482953 Ga0068859_1004829531 225
135 3300005618 Ga0068864_100005255 Ga0068864_1000052558 225
136 3300005618 Ga0068864_100092076 Ga0068864_1000920763 225
137 3300005618 Ga0068864_100279551 Ga0068864_1002795512 225
138 3300005718 Ga0068866_10141056 Ga0068866_101410563 225
139 3300005718 Ga0068866_10363056 Ga0068866_103630561 225
140 3300005719 Ga0068861_100096295 Ga0068861_1000962953 225
141 3300005834 Ga0068851_10090891 Ga0068851_100908912 225
142 3300005840 Ga0068870_10245413 Ga0068870_102454132 225
143 3300005841 Ga0068863_100125348 Ga0068863_1001253482 225
144 3300005841 Ga0068863_100139886 Ga0068863_1001398862 225
145 3300005841 Ga0068863_100219986 Ga0068863_1002199862 225
146 3300005842 Ga0068858_100028827 Ga0068858_1000288273 225
147 3300005842 Ga0068858_100049735 Ga0068858_1000497352 225
148 3300005842 Ga0068858_100222372 Ga0068858_1002223723 225
149 3300005842 Ga0068858_100409755 Ga0068858_1004097551 225
150 3300005843 Ga0068860_100072884 Ga0068860_1000728842 225
151 3300005843 Ga0068860_100336253 Ga0068860_1003362533 225
152 3300006173 Ga0070716_100025385 Ga0070716_1000253853 225
153 3300006195 Ga0075366_10181519 Ga0075366_101815191 225
154 3300006237 Ga0097621_100019762 Ga0097621_1000197622 225
155 3300006237 Ga0097621_100061777 Ga0097621_1000617772 225
156 3300006237 Ga0097621_100105161 Ga0097621_1001051611 225
157 3300006358 Ga0068871_100002698 Ga0068871_1000026982 225
158 3300006358 Ga0068871_100005072 Ga0068871_1000050726 225
159 3300006358 Ga0068871_100148795 Ga0068871_1001487952 225
160 3300006871 Ga0075434_100216525 Ga0075434_1002165252 225
161 3300006880 Ga0075429_100008423 Ga0075429_1000084232 225
162 3300006931 Ga0097620_100020031 Ga0097620_1000200314 225
163 3300006931 Ga0097620_100070782 Ga0097620_1000707822 225
164 3300006931 Ga0097620_100107270 Ga0097620_1001072702 225
165 3300006931 Ga0097620_100148482 Ga0097620_1001484822 225
166 3300006931 Ga0097620_100482965 Ga0097620_1004829651 225
167 3300009094 Ga0111539_10429915 Ga0111539_104299152 225
168 3300009094 Ga0111539_10544238 Ga0111539_105442382 225
169 3300009098 Ga0105245_10077676 Ga0105245_100776762 225
170 3300009101 Ga0105247_10094997 Ga0105247_100949972 225
171 3300009101 Ga0105247_10111194 Ga0105247_101111942 225
172 3300009101 Ga0105247_10171955 Ga0105247_101719552 225
173 3300009147 Ga0114129_10015558 Ga0114129_100155587 225
174 3300009174 Ga0105241_10019760 Ga0105241_100197602 225
175 3300009176 Ga0105242_10001554 Ga0105242_1000155416 225
176 3300009176 Ga0105242_10514240 Ga0105242_105142401 225
177 3300009176 Ga0105242_10955308 Ga0105242_109553081 225
178 3300009177 Ga0105248_10532062 Ga0105248_105320621 225
179 3300009553 Ga0105249_10004487 Ga0105249_100044875 225
180 3300009553 Ga0105249_10047237 Ga0105249_100472372 225
181 3300009553 Ga0105249_10168679 Ga0105249_101686791 225
182 3300009553 Ga0105249_10950361 Ga0105249_109503611 225
183 3300010375 Ga0105239_10136443 Ga0105239_101364432 225
184 3300011119 Ga0105246_10470554 Ga0105246_104705541 225
185 3300013100 Ga0157373_10297973 Ga0157373_102979731 225
186 3300013102 Ga0157371_10047056 Ga0157371_100470562 225
187 3300013104 Ga0157370_10157212 Ga0157370_101572123 225
188 3300013296 Ga0157374_10004211 Ga0157374_100042113 225
189 3300013296 Ga0157374_10005248 Ga0157374_100052486 225
190 3300013296 Ga0157374_10341585 Ga0157374_103415851 225
191 3300013296 Ga0157374_10994066 Ga0157374_109940661 225
192 3300013297 Ga0157378_10113280 Ga0157378_101132802 225
193 3300013297 Ga0157378_10121852 Ga0157378_101218522 225
194 3300013297 Ga0157378_10195698 Ga0157378_101956982 225
195 3300013297 Ga0157378_10913927 Ga0157378_109139271 225
196 3300013297 Ga0157378_11077751 Ga0157378_110777511 225
197 3300013306 Ga0163162_10001289 Ga0163162_100012896 225
198 3300013306 Ga0163162_10006811 Ga0163162_100068112 225
199 3300013306 Ga0163162_10017115 Ga0163162_100171153 225
200 3300013306 Ga0163162_10033618 Ga0163162_100336182 225
201 3300013306 Ga0163162_10045996 Ga0163162_100459964 225
202 3300013306 Ga0163162_10137523 Ga0163162_101375231 225
203 3300013306 Ga0163162_10190195 Ga0163162_101901951 225
204 3300013307 Ga0157372_10033595 Ga0157372_100335952 225
205 3300013307 Ga0157372_10107948 Ga0157372_101079482 225
206 3300013307 Ga0157372_10699290 Ga0157372_106992901 225
207 3300013308 Ga0157375_10016793 Ga0157375_100167933 225
208 3300013308 Ga0157375_10039198 Ga0157375_100391982 225
209 3300013308 Ga0157375_10078879 Ga0157375_100788792 225
210 3300014325 Ga0163163_10000057 Ga0163163_1000005740 225
211 3300014325 Ga0163163_10342084 Ga0163163_103420842 225
212 3300014325 Ga0163163_10588390 Ga0163163_105883902 225
213 3300014326 Ga0157380_10558024 Ga0157380_105580242 225
214 3300014326 Ga0157380_10678080 Ga0157380_106780802 225
215 3300014745 Ga0157377_10009380 Ga0157377_100093804 225
216 3300014745 Ga0157377_10027666 Ga0157377_100276663 225
217 3300014745 Ga0157377_10245197 Ga0157377_102451971 225
218 3300014745 Ga0157377_10250416 Ga0157377_102504161 225
219 3300014968 Ga0157379_10019926 Ga0157379_100199264 225
220 3300014968 Ga0157379_10056176 Ga0157379_100561762 225
221 3300014968 Ga0157379_10142004 Ga0157379_101420042 225
222 3300014968 Ga0157379_10161719 Ga0157379_101617192 225
223 3300014969 Ga0157376_10024500 Ga0157376_100245004 225
224 3300014969 Ga0157376_10134873 Ga0157376_101348732 225
225 3300014969 Ga0157376_11136568 Ga0157376_111365681 225
226 3300015265 Ga0182005_1066751 Ga0182005_10667511 225
227 3300017792 Ga0163161_10001319 Ga0163161_100013196 225
228 3300017792 Ga0163161_10035337 Ga0163161_100353371 225
229 3300017792 Ga0163161_10043822 Ga0163161_100438222 225
230 3300017792 Ga0163161_10092411 Ga0163161_100924112 225
231 3300017792 Ga0163161_10345879 Ga0163161_103458791 225
232 3300021384 Ga0213876_10001203 Ga0213876_100012034 225
233 3300025315 Ga0207697_10068658 Ga0207697_100686581 225
234 3300025893 Ga0207682_10065741 Ga0207682_100657412 225
235 3300025903 Ga0207680_10064779 Ga0207680_100647792 225
236 3300025904 Ga0207647_10098581 Ga0207647_100985812 225
237 3300025907 Ga0207645_10016219 Ga0207645_100162192 225
238 3300025908 Ga0207643_10203062 Ga0207643_102030622 225
239 3300025911 Ga0207654_10136045 Ga0207654_101360452 225
240 3300025911 Ga0207654_10377523 Ga0207654_103775231 225
241 3300025918 Ga0207662_10024602 Ga0207662_100246023 225
242 3300025919 Ga0207657_10056878 Ga0207657_100568781 225
243 3300025920 Ga0207649_10240879 Ga0207649_102408792 225
244 3300025920 Ga0207649_10578119 Ga0207649_105781191 225
245 3300025923 Ga0207681_10243954 Ga0207681_102439542 225
246 3300025923 Ga0207681_10514777 Ga0207681_105147771 225
247 3300025925 Ga0207650_10086041 Ga0207650_100860412 225
248 3300025925 Ga0207650_10579723 Ga0207650_105797232 225
249 3300025926 Ga0207659_10005468 Ga0207659_1000546810 225
250 3300025926 Ga0207659_10027410 Ga0207659_100274102 225
251 3300025926 Ga0207659_10050668 Ga0207659_100506682 225
252 3300025929 Ga0207664_10000130 Ga0207664_100001306 225
253 3300025932 Ga0207690_10017217 Ga0207690_100172172 225
254 3300025933 Ga0207706_10003789 Ga0207706_100037898 225
255 3300025933 Ga0207706_10015762 Ga0207706_100157622 225
256 3300025934 Ga0207686_10001429 Ga0207686_100014293 225
257 3300025934 Ga0207686_10076778 Ga0207686_100767782 225
258 3300025936 Ga0207670_10008526 Ga0207670_100085262 225
259 3300025936 Ga0207670_10120250 Ga0207670_101202502 225
260 3300025936 Ga0207670_10148279 Ga0207670_101482792 225
261 3300025937 Ga0207669_10315714 Ga0207669_103157142 225
262 3300025938 Ga0207704_10284718 Ga0207704_102847182 225
263 3300025940 Ga0207691_10083725 Ga0207691_100837252 225
264 3300025940 Ga0207691_10283220 Ga0207691_102832202 225
265 3300025940 Ga0207691_10800613 Ga0207691_108006131 225
266 3300025941 Ga0207711_10029203 Ga0207711_100292033 225
267 3300025942 Ga0207689_10018112 Ga0207689_100181123 225
268 3300025942 Ga0207689_10031915 Ga0207689_100319154 225
269 3300025942 Ga0207689_10066606 Ga0207689_100666061 225
270 3300025942 Ga0207689_10086264 Ga0207689_100862641 225
271 3300025944 Ga0207661_10347514 Ga0207661_103475142 225
272 3300025945 Ga0207679_10069183 Ga0207679_100691831 225
273 3300025945 Ga0207679_10091130 Ga0207679_100911302 225
274 3300025949 Ga0207667_10424047 Ga0207667_104240472 225
275 3300025960 Ga0207651_10109883 Ga0207651_101098832 225
276 3300025960 Ga0207651_10442176 Ga0207651_104421761 225
277 3300025960 Ga0207651_10664613 Ga0207651_106646131 225
278 3300025961 Ga0207712_10080263 Ga0207712_100802632 225
279 3300025981 Ga0207640_10079271 Ga0207640_100792713 225
280 3300025981 Ga0207640_10498353 Ga0207640_104983531 225
281 3300025986 Ga0207658_10110947 Ga0207658_101109472 225
282 3300025986 Ga0207658_10180213 Ga0207658_101802131 225
283 3300026023 Ga0207677_10027624 Ga0207677_100276241 225
284 3300026023 Ga0207677_10059742 Ga0207677_100597421 225
285 3300026023 Ga0207677_10136816 Ga0207677_101368162 225
286 3300026023 Ga0207677_10183592 Ga0207677_101835922 225
287 3300026023 Ga0207677_10213676 Ga0207677_102136762 225
288 3300026035 Ga0207703_10116988 Ga0207703_101169881 225
289 3300026035 Ga0207703_10188510 Ga0207703_101885102 225
290 3300026041 Ga0207639_10143424 Ga0207639_101434242 225
291 3300026067 Ga0207678_10075499 Ga0207678_100754991 225
292 3300026067 Ga0207678_10732635 Ga0207678_107326351 225
293 3300026088 Ga0207641_10001009 Ga0207641_1000100917 225
294 3300026088 Ga0207641_10044727 Ga0207641_100447273 225
295 3300026088 Ga0207641_10169704 Ga0207641_101697041 225
296 3300026089 Ga0207648_10011552 Ga0207648_100115522 225
297 3300026089 Ga0207648_10105422 Ga0207648_101054222 225
298 3300026089 Ga0207648_10164037 Ga0207648_101640371 225
299 3300026089 Ga0207648_10164394 Ga0207648_101643942 225
300 3300026089 Ga0207648_10288854 Ga0207648_102888542 225
301 3300026089 Ga0207648_10303544 Ga0207648_103035441 225
302 3300026089 Ga0207648_10366753 Ga0207648_103667532 225
303 3300026095 Ga0207676_10257272 Ga0207676_102572722 225
304 3300026095 Ga0207676_10265681 Ga0207676_102656811 225
305 3300026095 Ga0207676_10498058 Ga0207676_104980582 225
306 3300026116 Ga0207674_10006488 Ga0207674_100064888 225
307 3300026116 Ga0207674_10023606 Ga0207674_100236062 225
308 3300026118 Ga0207675_100001610 Ga0207675_1000016102 225
309 3300026118 Ga0207675_100089414 Ga0207675_1000894143 225
310 3300026118 Ga0207675_100115538 Ga0207675_1001155381 225
311 3300026118 Ga0207675_100151516 Ga0207675_1001515162 225
312 3300026121 Ga0207683_10016242 Ga0207683_100162421 225
313 3300026121 Ga0207683_10075273 Ga0207683_100752732 225
314 3300026142 Ga0207698_10072781 Ga0207698_100727812 225
315 3300028379 Ga0268266_10091456 Ga0268266_100914562 225
316 3300028380 Ga0268265_10164812 Ga0268265_101648122 225
317 3300028381 Ga0268264_10078525 Ga0268264_100785252 225
318 3300028381 Ga0268264_10131462 Ga0268264_101314622 225
319 3300028800 Ga0265338_10265573 Ga0265338_102655732 225
320 3300031852 Ga0307410_10580170 Ga0307410_105801701 225
321 3300031911 Ga0307412_10080211 Ga0307412_100802112 225
322 3300032004 Ga0307414_10108576 Ga0307414_101085762 225
323 3300035086 Ga0373934_0129562 Ga0373934_0129562_223_900 225
324 3300035113 Ga0373936_0201376 Ga0373936_0201376_72_749 225
325 3300035724 Ga0373933_0403489 Ga0373933_0403489_125_802 225
326 3300039437 Ga0436365_0493931 Ga0436365_0493931_11634_12314 225
327 3300039437 Ga0436365_1346643 Ga0436365_1346643_31_711 225
328 3300041486 Ga0451807_1625491 Ga0451807_1625491_111_788 225
329 3300041512 Ga0451853_2800764 Ga0451853_2800764_42_719 225
330 3300044658 Ga0466972_0000051 Ga0466972_0000051_61734_62411 225
331 3300044719 Ga0466971_0150649 Ga0466971_0150649_120_797 225
332 3300044765 Ga0466970_0000688 Ga0466970_0000688_3021_3698 225
333 3300044842 Ga0466957_0180348 Ga0466957_0180348_265_942 225
334 3300046514 Ga0495618_0252414 Ga0495618_0252414_111_788 225
335 3300046516 Ga0495628_0107595 Ga0495628_0107595_115_792 225
336 3300046535 Ga0495586_0073243 Ga0495586_0073243_634_1311 225
337 3300046536 Ga0495587_0124133 Ga0495587_0124133_739_1416 225
338 3300046537 Ga0495598_0102805 Ga0495598_0102805_233_910 225
339 3300046559 Ga0495667_0440456 Ga0495667_0440456_60_737 225
340 3300046642 Ga0495634_0147324 Ga0495634_0147324_564_1241 225
341 3300046648 Ga0495611_0144668 Ga0495611_0144668_252_929 225
342 3300046663 Ga0495635_0228688 Ga0495635_0228688_440_1117 225
343 3300046809 Ga0495600_0126170 Ga0495600_0126170_404_1081 225
344 3300048911 Ga0496108_0175714 Ga0496108_0175714_932_1609 225
345 3300048913 Ga0496110_0025271 Ga0496110_0025271_182_859 225
346 3300048914 Ga0496111_0238757 Ga0496111_0238757_445_1122 225
347 3300048917 Ga0496114_0101492 Ga0496114_0101492_836_1513 225
348 3300049519 Ga0501296_006409 Ga0501296_006409_74_751 225
349 3300049520 Ga0501297_016016 Ga0501297_016016_75_752 225
350 3300049572 Ga0501036_0023793 Ga0501036_0023793_3956_4633 225
351 3300049579 Ga0501043_0141045 Ga0501043_0141045_1016_1693 225
352 3300049581 Ga0501047_0059686 Ga0501047_0059686_1670_2347 225
353 3300049649 Ga0501198_028864 Ga0501198_028864_30_707 225
354 3300049651 Ga0501201_000380 Ga0501201_000380_365_1042 225
355 3300049652 Ga0501202_001260 Ga0501202_001260_945_1622 225
356 3300049653 Ga0501206_000437 Ga0501206_000437_108_785 225
357 3300049654 Ga0501207_001771 Ga0501207_001771_1394_2071 225
358 3300049658 Ga0501211_005127 Ga0501211_005127_324_1001 225
359 3300049661 Ga0501217_000866 Ga0501217_000866_3168_3845 225
360 3300049663 Ga0501223_000626 Ga0501223_000626_6461_7138 225
361 3300049664 Ga0501224_000976 Ga0501224_000976_366_1043 225
362 3300049668 Ga0501233_003605 Ga0501233_003605_412_1089 225
363 3300049669 Ga0501235_002060 Ga0501235_002060_412_1089 225
364 3300049674 Ga0501242_007896 Ga0501242_007896_191_868 225
365 3300049688 Ga0501259_000085 Ga0501259_000085_8328_9005 225
366 3300049704 Ga0501221_000040 Ga0501221_000040_10771_11448 225
367 3300049704 Ga0501221_073321 Ga0501221_073321_98_775 225
368 3300049705 Ga0501225_0000296 Ga0501225_0000296_12112_12789 225
369 3300049708 Ga0501245_000232 Ga0501245_000232_823_1500 225
370 3300049757 Ga0501232_001638 Ga0501232_001638_1107_1784 225
371 3300050507 nmdc:mga05p37_15444_c1 nmdc:mga05p37_15444_c1_8071_8748 225
372 3300050509 nmdc:mga0qj67_101265_c1 nmdc:mga0qj67_101265_c1_309_986 225
373 3300050510 nmdc:mga06r32_247961_c1 nmdc:mga06r32_247961_c1_1003_1680 225
374 3300050511 nmdc:mga08y16_1028047_c1 nmdc:mga08y16_1028047_c1_75_752 225
375 3300050512 nmdc:mga0n895_106321_c1 nmdc:mga0n895_106321_c1_1386_2063 225
376 3300053085 Ga0495619_0398780 Ga0495619_0398780_113_790 225
377 3300003320 rootH2_10074209 rootH2_100742092 226
378 3300005290 Ga0065712_10245765 Ga0065712_102457651 226
379 3300005293 Ga0065715_10260744 Ga0065715_102607442 226
380 3300005329 Ga0070683_100046386 Ga0070683_1000463862 226
381 3300005329 Ga0070683_100313736 Ga0070683_1003137362 226
382 3300005331 Ga0070670_100344217 Ga0070670_1003442172 226
383 3300005331 Ga0070670_100403715 Ga0070670_1004037152 226
384 3300005331 Ga0070670_100513741 Ga0070670_1005137412 226
385 3300005331 Ga0070670_100700287 Ga0070670_1007002871 226
386 3300005333 Ga0070677_10010649 Ga0070677_100106492 226
387 3300005333 Ga0070677_10022835 Ga0070677_100228351 226
388 3300005334 Ga0068869_100226458 Ga0068869_1002264583 226
389 3300005336 Ga0070680_100057598 Ga0070680_1000575982 226
390 3300005336 Ga0070680_100063326 Ga0070680_1000633263 226
391 3300005336 Ga0070680_100203830 Ga0070680_1002038302 226
392 3300005337 Ga0070682_100000898 Ga0070682_10000089813 226
393 3300005337 Ga0070682_100005002 Ga0070682_1000050022 226
394 3300005339 Ga0070660_100011614 Ga0070660_1000116145 226
395 3300005344 Ga0070661_100039511 Ga0070661_1000395115 226
396 3300005347 Ga0070668_100112716 Ga0070668_1001127162 226
397 3300005353 Ga0070669_100206427 Ga0070669_1002064272 226
398 3300005354 Ga0070675_100005601 Ga0070675_1000056012 226
399 3300005354 Ga0070675_100177114 Ga0070675_1001771142 226
400 3300005354 Ga0070675_100234266 Ga0070675_1002342662 226
401 3300005354 Ga0070675_100243270 Ga0070675_1002432702 226
402 3300005355 Ga0070671_100177789 Ga0070671_1001777893 226
403 3300005355 Ga0070671_100232015 Ga0070671_1002320152 226
404 3300005356 Ga0070674_100123610 Ga0070674_1001236102 226
405 3300005356 Ga0070674_100151011 Ga0070674_1001510112 226
406 3300005364 Ga0070673_100019319 Ga0070673_1000193193 226
407 3300005364 Ga0070673_100223058 Ga0070673_1002230582 226
408 3300005364 Ga0070673_100546314 Ga0070673_1005463141 226
409 3300005365 Ga0070688_100407708 Ga0070688_1004077081 226
410 3300005366 Ga0070659_100002201 Ga0070659_1000022014 226
411 3300005366 Ga0070659_100003217 Ga0070659_10000321712 226
412 3300005441 Ga0070700_100108807 Ga0070700_1001088072 226
413 3300005441 Ga0070700_100305551 Ga0070700_1003055511 226
414 3300005455 Ga0070663_100202030 Ga0070663_1002020302 226
415 3300005456 Ga0070678_100012999 Ga0070678_1000129992 226
416 3300005457 Ga0070662_100002589 Ga0070662_1000025892 226
417 3300005457 Ga0070662_100160087 Ga0070662_1001600871 226
418 3300005458 Ga0070681_10023171 Ga0070681_100231715 226
419 3300005458 Ga0070681_10065136 Ga0070681_100651362 226
420 3300005458 Ga0070681_10189768 Ga0070681_101897682 226
421 3300005459 Ga0068867_100175283 Ga0068867_1001752832 226
422 3300005459 Ga0068867_100182422 Ga0068867_1001824222 226
423 3300005459 Ga0068867_100712168 Ga0068867_1007121681 226
424 3300005530 Ga0070679_100410669 Ga0070679_1004106691 226
425 3300005530 Ga0070679_100521239 Ga0070679_1005212391 226
426 3300005535 Ga0070684_100049346 Ga0070684_1000493463 226
427 3300005539 Ga0068853_100020987 Ga0068853_1000209876 226
428 3300005543 Ga0070672_100175708 Ga0070672_1001757082 226
429 3300005547 Ga0070693_100140584 Ga0070693_1001405842 226
430 3300005547 Ga0070693_100202030 Ga0070693_1002020302 226
431 3300005563 Ga0068855_100010405 Ga0068855_1000104052 226
432 3300005563 Ga0068855_100071437 Ga0068855_1000714374 226
433 3300005564 Ga0070664_100015196 Ga0070664_1000151965 226
434 3300005564 Ga0070664_100182884 Ga0070664_1001828841 226
435 3300005564 Ga0070664_100445671 Ga0070664_1004456712 226
436 3300005577 Ga0068857_100036876 Ga0068857_1000368763 226
437 3300005577 Ga0068857_100170350 Ga0068857_1001703503 226
438 3300005577 Ga0068857_100294249 Ga0068857_1002942492 226
439 3300005577 Ga0068857_100795688 Ga0068857_1007956881 226
440 3300005578 Ga0068854_100080884 Ga0068854_1000808842 226
441 3300005578 Ga0068854_100089597 Ga0068854_1000895972 226
442 3300005578 Ga0068854_100273553 Ga0068854_1002735532 226
443 3300005578 Ga0068854_100794721 Ga0068854_1007947211 226
444 3300005614 Ga0068856_100008272 Ga0068856_10000827214 226
445 3300005616 Ga0068852_100031046 Ga0068852_1000310462 226
446 3300005616 Ga0068852_100079172 Ga0068852_1000791722 226
447 3300005616 Ga0068852_100247315 Ga0068852_1002473151 226
448 3300005617 Ga0068859_100123761 Ga0068859_1001237612 226
449 3300005617 Ga0068859_100507894 Ga0068859_1005078942 226
450 3300005618 Ga0068864_100022550 Ga0068864_1000225502 226
451 3300005719 Ga0068861_100214083 Ga0068861_1002140832 226
452 3300005719 Ga0068861_100441983 Ga0068861_1004419832 226
453 3300005719 Ga0068861_100527192 Ga0068861_1005271921 226
454 3300005985 Ga0081539_10000524 Ga0081539_1000052444 226
455 3300006237 Ga0097621_100091931 Ga0097621_1000919311 226
456 3300006237 Ga0097621_100101648 Ga0097621_1001016482 226
457 3300006237 Ga0097621_100339013 Ga0097621_1003390131 226
458 3300006358 Ga0068871_100038927 Ga0068871_1000389272 226
459 3300006358 Ga0068871_100200844 Ga0068871_1002008442 226
460 3300006358 Ga0068871_100849822 Ga0068871_1008498221 226
461 3300006844 Ga0075428_100125178 Ga0075428_1001251784 226
462 3300006847 Ga0075431_100000819 Ga0075431_10000081922 226
463 3300006931 Ga0097620_100123764 Ga0097620_1001237642 226
464 3300006931 Ga0097620_100507894 Ga0097620_1005078942 226
465 3300009147 Ga0114129_10085834 Ga0114129_100858342 226
466 3300009176 Ga0105242_10255104 Ga0105242_102551042 226
467 3300013100 Ga0157373_10005796 Ga0157373_100057963 226
468 3300013100 Ga0157373_10146105 Ga0157373_101461051 226
469 3300013100 Ga0157373_10284207 Ga0157373_102842072 226
470 3300013102 Ga0157371_10017434 Ga0157371_100174343 226
471 3300013104 Ga0157370_10155762 Ga0157370_101557622 226
472 3300013105 Ga0157369_10003623 Ga0157369_1000362312 226
473 3300013105 Ga0157369_10017929 Ga0157369_100179296 226
474 3300013105 Ga0157369_10188310 Ga0157369_101883101 226
475 3300013105 Ga0157369_10436905 Ga0157369_104369052 226
476 3300013105 Ga0157369_10492352 Ga0157369_104923522 226
477 3300013296 Ga0157374_10032695 Ga0157374_100326952 226
478 3300013296 Ga0157374_10202733 Ga0157374_102027332 226
479 3300013296 Ga0157374_10213415 Ga0157374_102134152 226
480 3300013296 Ga0157374_10337840 Ga0157374_103378401 226
481 3300013297 Ga0157378_10010878 Ga0157378_100108783 226
482 3300013297 Ga0157378_10042212 Ga0157378_100422122 226
483 3300013306 Ga0163162_10054911 Ga0163162_100549112 226
484 3300013306 Ga0163162_10803724 Ga0163162_108037241 226
485 3300013307 Ga0157372_10022749 Ga0157372_100227492 226
486 3300013307 Ga0157372_10069540 Ga0157372_100695403 226
487 3300013307 Ga0157372_10096584 Ga0157372_100965842 226
488 3300013307 Ga0157372_10104668 Ga0157372_101046683 226
489 3300013307 Ga0157372_10358283 Ga0157372_103582832 226
490 3300013308 Ga0157375_10195399 Ga0157375_101953991 226
491 3300013308 Ga0157375_10317586 Ga0157375_103175861 226
492 3300013308 Ga0157375_10338491 Ga0157375_103384912 226
493 3300014325 Ga0163163_10349577 Ga0163163_103495772 226
494 3300014326 Ga0157380_10030721 Ga0157380_100307213 226
495 3300014745 Ga0157377_10121908 Ga0157377_101219082 226
496 3300014745 Ga0157377_10277173 Ga0157377_102771732 226
497 3300014968 Ga0157379_10532538 Ga0157379_105325381 226
498 3300014969 Ga0157376_10462459 Ga0157376_104624592 226
499 3300017792 Ga0163161_10161003 Ga0163161_101610032 226
500 3300017792 Ga0163161_10703309 Ga0163161_107033091 226
501 3300021384 Ga0213876_10209154 Ga0213876_102091541 226
502 3300025893 Ga0207682_10006104 Ga0207682_100061042 226
503 3300025904 Ga0207647_10208181 Ga0207647_102081812 226
504 3300025912 Ga0207707_10072889 Ga0207707_100728892 226
505 3300025912 Ga0207707_10336164 Ga0207707_103361642 226
506 3300025912 Ga0207707_10526505 Ga0207707_105265051 226
507 3300025917 Ga0207660_10118783 Ga0207660_101187832 226
508 3300025917 Ga0207660_10140282 Ga0207660_101402822 226
509 3300025917 Ga0207660_10300782 Ga0207660_103007822 226
510 3300025917 Ga0207660_10336967 Ga0207660_103369672 226
511 3300025919 Ga0207657_10002631 Ga0207657_1000263116 226
512 3300025919 Ga0207657_10015448 Ga0207657_100154482 226
513 3300025920 Ga0207649_10007616 Ga0207649_100076161 226
514 3300025923 Ga0207681_10176420 Ga0207681_101764202 226
515 3300025925 Ga0207650_10099559 Ga0207650_100995592 226
516 3300025925 Ga0207650_10301321 Ga0207650_103013212 226
517 3300025925 Ga0207650_10330083 Ga0207650_103300832 226
518 3300025926 Ga0207659_10030351 Ga0207659_100303514 226
519 3300025926 Ga0207659_10073851 Ga0207659_100738512 226
520 3300025931 Ga0207644_10077167 Ga0207644_100771672 226
521 3300025931 Ga0207644_10138276 Ga0207644_101382761 226
522 3300025932 Ga0207690_10042849 Ga0207690_100428492 226
523 3300025932 Ga0207690_10100160 Ga0207690_101001602 226
524 3300025933 Ga0207706_10002123 Ga0207706_100021236 226
525 3300025933 Ga0207706_10163155 Ga0207706_101631552 226
526 3300025937 Ga0207669_10074226 Ga0207669_100742262 226
527 3300025940 Ga0207691_10023665 Ga0207691_100236652 226
528 3300025944 Ga0207661_10028655 Ga0207661_100286552 226
529 3300025944 Ga0207661_10540867 Ga0207661_105408672 226
530 3300025945 Ga0207679_10052725 Ga0207679_100527252 226
531 3300025945 Ga0207679_10290285 Ga0207679_102902851 226
532 3300025949 Ga0207667_10042462 Ga0207667_100424624 226
533 3300025949 Ga0207667_10109792 Ga0207667_101097921 226
534 3300025949 Ga0207667_10754823 Ga0207667_107548232 226
535 3300025960 Ga0207651_10164013 Ga0207651_101640132 226
536 3300025960 Ga0207651_10294594 Ga0207651_102945942 226
537 3300025972 Ga0207668_10304116 Ga0207668_103041161 226
538 3300025981 Ga0207640_10128902 Ga0207640_101289022 226
539 3300025981 Ga0207640_10157065 Ga0207640_101570652 226
540 3300025981 Ga0207640_10623176 Ga0207640_106231761 226
541 3300026041 Ga0207639_10128486 Ga0207639_101284862 226
542 3300026041 Ga0207639_10302559 Ga0207639_103025592 226
543 3300026067 Ga0207678_10099469 Ga0207678_100994692 226
544 3300026067 Ga0207678_10458664 Ga0207678_104586642 226
545 3300026075 Ga0207708_10522470 Ga0207708_105224702 226
546 3300026078 Ga0207702_10515870 Ga0207702_105158701 226
547 3300026089 Ga0207648_10697942 Ga0207648_106979421 226
548 3300026095 Ga0207676_10046915 Ga0207676_100469152 226
549 3300026095 Ga0207676_10162582 Ga0207676_101625822 226
550 3300026095 Ga0207676_10308931 Ga0207676_103089312 226
551 3300026116 Ga0207674_10029406 Ga0207674_100294063 226
552 3300026116 Ga0207674_10228714 Ga0207674_102287142 226
553 3300026116 Ga0207674_10293757 Ga0207674_102937572 226
554 3300026118 Ga0207675_100137088 Ga0207675_1001370882 226
555 3300026118 Ga0207675_100335331 Ga0207675_1003353312 226
556 3300026121 Ga0207683_10183297 Ga0207683_101832972 226
557 3300026121 Ga0207683_10232255 Ga0207683_102322552 226
558 3300026142 Ga0207698_10037577 Ga0207698_100375772 226
559 3300026142 Ga0207698_10334794 Ga0207698_103347941 226
560 3300026142 Ga0207698_10426074 Ga0207698_104260742 226
561 3300035692 Ga0373935_0462933 Ga0373935_0462933_18_707 226
562 3300037471 Ga0395905_0000147 Ga0395905_0000147_36060_36743 226
563 3300038443 Ga0395901_0003274 Ga0395901_0003274_1867_2550 226
564 3300039437 Ga0436365_1298184 Ga0436365_1298184_177_863 226
565 3300041459 Ga0451800_1170264 Ga0451800_1170264_221_901 226
566 3300045051 Ga0451576_0337765 Ga0451576_0337765_479_1159 226
567 3300045976 Ga0466967_0196457 Ga0466967_0196457_1183_1863 226
568 3300046543 Ga0495645_0125971 Ga0495645_0125971_53_757 226
569 3300047321 Ga0495676_0279107 Ga0495676_0279107_406_1092 226
570 3300049571 Ga0501034_0472874 Ga0501034_0472874_396_1082 226
571 3300049822 Ga0501035_0388614 Ga0501035_0388614_110_790 226
572 3300050507 nmdc:mga05p37_361265_c1 nmdc:mga05p37_361265_c1_867_1547 226
573 3300050510 nmdc:mga06r32_39221_c1 nmdc:mga06r32_39221_c1_3293_3973 226
574 3300053090 Ga0500646_0020756 Ga0500646_0020756_732_1418 226
575 3300031456 Ga0307513_10126678 Ga0307513_101266782 227
576 3300042876 Ga0451577_0000207 Ga0451577_0000207_76225_77001 227
577 3300044712 Ga0453684_0000791 Ga0453684_0000791_42668_43444 227
578 3300046616 Ga0495668_0021334 Ga0495668_0021334_2917_3603 227
579 3300053118 Ga0500594_0030131 Ga0500594_0030131_430_1116 227
580 3300053151 Ga0500604_0041980 Ga0500604_0041980_347_1033 227
581 2162886007 SwRhRL2b_contig_1761633 SwRhRL2b_0391.00005570 228
582 3300003320 rootH2_10065440 rootH2_100654401 228
583 3300003323 rootH1_10066422 rootH1_100664223 228
584 3300005289 Ga0065704_10000195 Ga0065704_1000019528 228
585 3300009093 Ga0105240_10000101 Ga0105240_10000101137 228
586 3300010375 Ga0105239_10001340 Ga0105239_1000134030 228
587 3300013104 Ga0157370_10724093 Ga0157370_107240931 228
588 3300025913 Ga0207695_10000020 Ga0207695_10000020562 228
589 3300031251 Ga0265327_10000026 Ga0265327_1000002667 228
590 3300031251 Ga0265327_10000137 Ga0265327_1000013719 228
591 3300046616 Ga0495668_0000358 Ga0495668_0000358_55516_56202 228
592 3300047318 Ga0495636_0000025 Ga0495636_0000025_9959_10645 228
593 3300047472 Ga0495686_0000268 Ga0495686_0000268_20720_21406 228
594 3300048918 Ga0496115_0008451 Ga0496115_0008451_5595_6281 228
595 3300049766 Ga0501269_005323 Ga0501269_005323_579_1265 228
596 3300049822 Ga0501035_0154645 Ga0501035_0154645_517_1203 228
597 3300053104 Ga0500556_0046080 Ga0500556_0046080_203_889 228
598 3300053116 Ga0500592_018961 Ga0500592_018961_284_970 228
599 3300053118 Ga0500594_0119522 Ga0500594_0119522_57_743 228
600 3300053136 Ga0500559_0040682 Ga0500559_0040682_321_1043 228
601 3300053153 Ga0500616_0000850 Ga0500616_0000850_8568_9254 228
602 3300053158 Ga0500627_0006122 Ga0500627_0006122_1794_2480 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

26

138

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

170

241

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9728 6 125
4jav-assembly1.cif.gz_D structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v) 0.9706 6 123
6ifh-assembly1.cif.gz_A unphosphorylated spo0f from paenisporosarcina sp. tg-14 0.9701 6 124
2ftk-assembly2.cif.gz_H berylloflouride spo0f complex with spo0b 0.968 6 122
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9678 6 127
ID Description Score Start End Superfamily
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.978 6 86 3.40.50.2300
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9735 7 91 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9735 7 90 3.40.50.2300
4ja2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9708 6 124 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.969 5 86 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A4P6X3Q8-F1-model_v4 Hybrid sensor histidine kinase/response regulator 0.9818 6 125 GO:0000160
GO:0004672
AF-A0A7C1FPA7-F1-model_v4 Response regulator 0.9774 5 127 GO:0000160
AF-A0A496UPR2-F1-model_v4 Diguanylate cyclase response regulator 0.9769 3 128 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A849SFK7-F1-model_v4 Response regulator 0.9745 4 129 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0K8MXI4-F1-model_v4 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain 0.974 6 128 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
87.62 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map