F468090

General Info

Members Datasets Scaffolds Average Seq Length
601 224 1202 427

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0033949|Ga0495580_0033949_737_2080
Length 447
Sequence MRAKTLAAVAITLGLGAAAACRSAGPATPERKPAENRELNPIAESYVKLVLALGQHDADYVDAYYGPPEWKPDPSAPRRPLPDIQAEAVSLLERLTSASPGGDEMAHLRFQYLFRQISALRARAQMVSGRKLSFDEESRALYDATAPVNSEEHFRELSERLSRLLPGDPGDSLGSRYEAFRAAFVIPPDRLDRVFQAAVSAARERTRKHLKLPDAESFKVEYVTGKSWSGYNWYQGGYRSLIQVNTDLPIYIDRAVDLAAHEGYPGHHVYNVLLEKNLVRDRGWVEFSVYPLFSPQSLIAEGSANFGIDVAFPGDERLAFERDVLYPLAGLDPSLAAKYTEVRELTEGLSYAGNEAARRYLNGEIDAKAAADWLERYALMARPRAEQRVRFIDQYRSYVINYNLGKDLVRGYIESRGGTADHPEKRWEEFGMLLSSPRLPGDLKPAR

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
158 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
159 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
160 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.16
Nodule 0
Rhizoplane 4.33
Rhizosphere 93.18
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0033949 3300046472 Bacteria 3674
2 Ga0065714_10075646 3300005288 Bacteria 2882
3 Ga0065704_10002562 3300005289 Bacteria 6136
4 Ga0065712_10000173 3300005290 Bacteria 30975
5 Ga0065712_10002276 3300005290 Bacteria 8803
6 Ga0065712_10075446 3300005290 Bacteria 3861
7 Ga0065712_10124079 3300005290 Bacteria 1629
8 Ga0065715_10000280 3300005293 Bacteria 16864
9 Ga0065715_10002535 3300005293 Bacteria 6357
10 Ga0065715_10106275 3300005293 Bacteria 2839
11 Ga0065715_10115291 3300005293 Bacteria 2420
12 Ga0065707_10009182 3300005295 Bacteria 4824
13 Ga0070676_10002232 3300005328 Bacteria 9885
14 Ga0070676_10164251 3300005328 Bacteria 1431
15 Ga0070683_100000698 3300005329 Bacteria 24394
16 Ga0070683_100004931 3300005329 Bacteria 11066
17 Ga0070683_100022034 3300005329 Bacteria 5688
18 Ga0070690_100037875 3300005330 Bacteria 3040
19 Ga0070690_100090228 3300005330 Bacteria 2017
20 Ga0070690_100133411 3300005330 Unclassified 1679
21 Ga0070670_100001817 3300005331 Bacteria 17382
22 Ga0070670_100002545 3300005331 Bacteria 15044
23 Ga0070670_100006347 3300005331 Bacteria 10006
24 Ga0070670_100008954 3300005331 Bacteria 8551
25 Ga0070670_100033332 3300005331 Bacteria 4435
26 Ga0070677_10014276 3300005333 Bacteria 2794
27 Ga0070677_10046460 3300005333 Bacteria 1736
28 Ga0070677_10092860 3300005333 Bacteria 1316
29 Ga0068869_100002035 3300005334 Bacteria 12146
30 Ga0068869_100043834 3300005334 Bacteria 3215
31 Ga0068869_100066190 3300005334 Bacteria 2662
32 Ga0068869_100189104 3300005334 Bacteria 1618
33 Ga0070666_10030359 3300005335 Bacteria 3560
34 Ga0070680_100176757 3300005336 Bacteria 1797
35 Ga0068868_100025104 3300005338 Bacteria 4527
36 Ga0070660_100128094 3300005339 Bacteria 2030
37 Ga0070689_100028948 3300005340 Bacteria 4189
38 Ga0070689_100037218 3300005340 Bacteria 3721
39 Ga0070689_100156730 3300005340 Bacteria 1839
40 Ga0070691_10017381 3300005341 Bacteria 3309
41 Ga0070687_100013994 3300005343 Bacteria 3593
42 Ga0070687_100029638 3300005343 Bacteria 2666
43 Ga0070687_100065050 3300005343 Bacteria 1939
44 Ga0070661_100003066 3300005344 Bacteria 11492
45 Ga0070692_10013314 3300005345 Bacteria 3830
46 Ga0070668_100097518 3300005347 Bacteria 2325
47 Ga0070669_100005634 3300005353 Bacteria 9043
48 Ga0070669_100019769 3300005353 Bacteria 4812
49 Ga0070669_100020190 3300005353 Bacteria 4758
50 Ga0070669_100027985 3300005353 Bacteria 4058
51 Ga0070669_100039685 3300005353 Bacteria 3421
52 Ga0070669_100058100 3300005353 Bacteria 2839
53 Ga0070675_100000001 3300005354 Bacteria 448137
54 Ga0070675_100002958 3300005354 Bacteria 12818
55 Ga0070675_100003568 3300005354 Bacteria 11825
56 Ga0070675_100006135 3300005354 Bacteria 9213
57 Ga0070675_100018904 3300005354 Bacteria 5488
58 Ga0070675_100027617 3300005354 Bacteria 4561
59 Ga0070675_100041389 3300005354 Bacteria 3764
60 Ga0070675_100065653 3300005354 Bacteria 3001
61 Ga0070675_100078776 3300005354 Bacteria 2745
62 Ga0070675_100104078 3300005354 Bacteria 2394
63 Ga0070675_100104997 3300005354 Bacteria 2384
64 Ga0070671_100019646 3300005355 Bacteria 5501
65 Ga0070671_100040520 3300005355 Bacteria 3869
66 Ga0070674_100000032 3300005356 Bacteria 64311
67 Ga0070674_100001783 3300005356 Bacteria 11675
68 Ga0070674_100036881 3300005356 Bacteria 3285
69 Ga0070674_100048258 3300005356 Bacteria 2922
70 Ga0070673_100004841 3300005364 Bacteria 8564
71 Ga0070673_100005045 3300005364 Bacteria 8421
72 Ga0070673_100038252 3300005364 Bacteria 3662
73 Ga0070673_100038577 3300005364 Bacteria 3648
74 Ga0070673_100062164 3300005364 Bacteria 2966
75 Ga0070673_100099603 3300005364 Bacteria 2391
76 Ga0070673_100210012 3300005364 Bacteria 1681
77 Ga0070688_100003806 3300005365 Bacteria 7823
78 Ga0070688_100017782 3300005365 Bacteria 4087
79 Ga0070688_100024876 3300005365 Bacteria 3539
80 Ga0070667_100008279 3300005367 Bacteria 8618
81 Ga0070667_100040961 3300005367 Bacteria 3885
82 Ga0070667_100073842 3300005367 Bacteria 2909
83 Ga0070667_100213713 3300005367 Bacteria 1715
84 Ga0070701_10016676 3300005438 Bacteria 3419
85 Ga0070701_10020202 3300005438 Bacteria 3159
86 Ga0070701_10111233 3300005438 Bacteria 1530
87 Ga0070705_100000775 3300005440 Bacteria 18053
88 Ga0070705_100010537 3300005440 Bacteria 4631
89 Ga0070694_100007561 3300005444 Bacteria 6633
90 Ga0070694_100016356 3300005444 Bacteria 4669
91 Ga0070694_100060398 3300005444 Bacteria 2585
92 Ga0070694_100167163 3300005444 Bacteria 1618
93 Ga0070708_100025381 3300005445 Bacteria 5066
94 Ga0070708_100081846 3300005445 Bacteria 2924
95 Ga0070678_100020222 3300005456 Bacteria 4363
96 Ga0070678_100052387 3300005456 Bacteria 2963
97 Ga0070678_100078415 3300005456 Bacteria 2495
98 Ga0070678_100180529 3300005456 Bacteria 1727
99 Ga0070662_100007770 3300005457 Bacteria 6968
100 Ga0070662_100047662 3300005457 Bacteria 3084
101 Ga0070681_10331273 3300005458 Bacteria 1432
102 Ga0068867_100000578 3300005459 Bacteria 24270
103 Ga0068867_100033134 3300005459 Bacteria 3739
104 Ga0068867_100041702 3300005459 Bacteria 3354
105 Ga0070685_10023632 3300005466 Bacteria 3368
106 Ga0070685_10159560 3300005466 Unclassified 1436
107 Ga0070707_100146731 3300005468 Bacteria 2296
108 Ga0070698_100001133 3300005471 Bacteria 29490
109 Ga0070698_100017547 3300005471 Bacteria 7543
110 Ga0070698_100197733 3300005471 Bacteria 1946
111 Ga0070699_100000125 3300005518 Bacteria 70893
112 Ga0070699_100029178 3300005518 Bacteria 4757
113 Ga0070699_100037796 3300005518 Bacteria 4179
114 Ga0070684_100002600 3300005535 Bacteria 13326
115 Ga0070697_100082466 3300005536 Bacteria 2650
116 Ga0070672_100015081 3300005543 Bacteria 5493
117 Ga0070672_100106820 3300005543 Bacteria 2277
118 Ga0070686_100027132 3300005544 Bacteria 3464
119 Ga0070695_100000040 3300005545 Bacteria 49538
120 Ga0070695_100037605 3300005545 Bacteria 3051
121 Ga0070696_100006647 3300005546 Bacteria 7724
122 Ga0070696_100016747 3300005546 Bacteria 4943
123 Ga0070696_100029867 3300005546 Bacteria 3728
124 Ga0070696_100075987 3300005546 Bacteria 2371
125 Ga0070696_100216999 3300005546 Unclassified 1434
126 Ga0070693_100026339 3300005547 Bacteria 3139
127 Ga0070693_100033923 3300005547 Unclassified 2821
128 Ga0070665_100000192 3300005548 Bacteria 108722
129 Ga0070665_100108499 3300005548 Bacteria 2778
130 Ga0070665_100297512 3300005548 Unclassified 1616
131 Ga0070704_100014038 3300005549 Bacteria 4992
132 Ga0070704_100043081 3300005549 Bacteria 3126
133 Ga0070664_100004110 3300005564 Bacteria 11692
134 Ga0070664_100007452 3300005564 Bacteria 8835
135 Ga0070664_100039831 3300005564 Bacteria 3961
136 Ga0068857_100016879 3300005577 Bacteria 6396
137 Ga0068857_100031138 3300005577 Bacteria 4714
138 Ga0070702_100098578 3300005615 Bacteria 1788
139 Ga0068852_100023772 3300005616 Bacteria 4940
140 Ga0068852_100057813 3300005616 Bacteria 3357
141 Ga0068859_100006708 3300005617 Bacteria 11694
142 Ga0068859_100009529 3300005617 Bacteria 9805
143 Ga0068859_100040701 3300005617 Bacteria 4666
144 Ga0068859_100125648 3300005617 Bacteria 2634
145 Ga0068859_100314843 3300005617 Bacteria 1659
146 Ga0068864_100037806 3300005618 Bacteria 4121
147 Ga0068864_100145680 3300005618 Unclassified 2141
148 Ga0068864_100158522 3300005618 Bacteria 2056
149 Ga0068864_100273119 3300005618 Bacteria 1576
150 Ga0068866_10048849 3300005718 Bacteria 2141
151 Ga0068861_100017626 3300005719 Bacteria 5075
152 Ga0068861_100019579 3300005719 Bacteria 4834
153 Ga0068861_100036701 3300005719 Bacteria 3640
154 Ga0068861_100075521 3300005719 Bacteria 2624
155 Ga0068861_100254252 3300005719 Bacteria 1501
156 Ga0068870_10002885 3300005840 Bacteria 7243
157 Ga0068870_10018405 3300005840 Bacteria 3373
158 Ga0068863_100006263 3300005841 Bacteria 11688
159 Ga0068863_100054102 3300005841 Bacteria 3804
160 Ga0068863_100176016 3300005841 Bacteria 2053
161 Ga0068863_100232070 3300005841 Unclassified 1780
162 Ga0068858_100009371 3300005842 Bacteria 9342
163 Ga0068858_100073175 3300005842 Bacteria 3181
164 Ga0068860_100015767 3300005843 Bacteria 7377
165 Ga0068860_100041735 3300005843 Bacteria 4382
166 Ga0068860_100042097 3300005843 Bacteria 4364
167 Ga0068862_100022008 3300005844 Bacteria 5332
168 Ga0068862_100026042 3300005844 Bacteria 4916
169 Ga0068862_100054051 3300005844 Bacteria 3438
170 Ga0068862_100108746 3300005844 Bacteria 2432
171 Ga0070717_10081617 3300006028 Bacteria 2715
172 Ga0075363_100050703 3300006048 Bacteria 2212
173 Ga0075364_10004069 3300006051 Bacteria 8391
174 Ga0075364_10015143 3300006051 Bacteria 4775
175 Ga0075364_10043289 3300006051 Bacteria 2927
176 Ga0075367_10012355 3300006178 Bacteria 4550
177 Ga0075366_10018398 3300006195 Bacteria 4032
178 Ga0068871_100192167 3300006358 Bacteria 1759
179 Ga0075428_100000166 3300006844 Bacteria 60871
180 Ga0075428_100000712 3300006844 Bacteria 34383
181 Ga0075428_100003413 3300006844 Bacteria 17374
182 Ga0075428_100004770 3300006844 Bacteria 15012
183 Ga0075428_100005989 3300006844 Bacteria 13502
184 Ga0075428_100013108 3300006844 Bacteria 9219
185 Ga0075428_100028630 3300006844 Bacteria 6164
186 Ga0075428_100125333 3300006844 Bacteria 2795
187 Ga0075430_100000691 3300006846 Bacteria 25696
188 Ga0075430_100001481 3300006846 Bacteria 19138
189 Ga0075430_100006691 3300006846 Bacteria 9724
190 Ga0075430_100011371 3300006846 Bacteria 7553
191 Ga0075430_100035134 3300006846 Bacteria 4254
192 Ga0075430_100129671 3300006846 Bacteria 2102
193 Ga0075431_100001885 3300006847 Bacteria 19887
194 Ga0075431_100021127 3300006847 Bacteria 6651
195 Ga0075431_100021230 3300006847 Bacteria 6637
196 Ga0075431_100035531 3300006847 Bacteria 5131
197 Ga0075431_100063640 3300006847 Bacteria 3807
198 Ga0075431_100109646 3300006847 Bacteria 2849
199 Ga0075433_10001456 3300006852 Bacteria 17484
200 Ga0075433_10003206 3300006852 Bacteria 12616
201 Ga0075433_10005012 3300006852 Bacteria 10372
202 Ga0075433_10035761 3300006852 Bacteria 4275
203 Ga0075433_10056365 3300006852 Bacteria 3432
204 Ga0075434_100003306 3300006871 Bacteria 14407
205 Ga0075434_100027168 3300006871 Bacteria 5616
206 Ga0075434_100111278 3300006871 Bacteria 2749
207 Ga0075429_100007109 3300006880 Bacteria 9720
208 Ga0075429_100024850 3300006880 Bacteria 5200
209 Ga0075429_100028011 3300006880 Bacteria 4890
210 Ga0075429_100028295 3300006880 Bacteria 4867
211 Ga0075429_100028828 3300006880 Bacteria 4821
212 Ga0075429_100045912 3300006880 Bacteria 3801
213 Ga0068865_100001886 3300006881 Bacteria 12325
214 Ga0068865_100023056 3300006881 Bacteria 4070
215 Ga0068865_100048854 3300006881 Unclassified 2914
216 Ga0097620_100006708 3300006931 Bacteria 11694
217 Ga0097620_100009529 3300006931 Bacteria 9805
218 Ga0097620_100040704 3300006931 Bacteria 4666
219 Ga0097620_100125647 3300006931 Bacteria 2634
220 Ga0097620_100314855 3300006931 Bacteria 1659
221 Ga0075435_100001599 3300007076 Bacteria 14624
222 Ga0075435_100010023 3300007076 Bacteria 6908
223 Ga0075435_100039348 3300007076 Bacteria 3772
224 Ga0075435_100106039 3300007076 Bacteria 2333
225 Ga0075435_100137373 3300007076 Bacteria 2049
226 Ga0075435_100257905 3300007076 Unclassified 1485
227 Ga0105244_10029742 3300009036 Bacteria 2914
228 Ga0111539_10000118 3300009094 Bacteria 88106
229 Ga0111539_10007840 3300009094 Bacteria 13638
230 Ga0111539_10015750 3300009094 Bacteria 9394
231 Ga0111539_10033958 3300009094 Bacteria 6190
232 Ga0111539_10033990 3300009094 Bacteria 6186
233 Ga0111539_10042125 3300009094 Bacteria 5486
234 Ga0111539_10057023 3300009094 Bacteria 4641
235 Ga0111539_10075129 3300009094 Bacteria 3981
236 Ga0111539_10196510 3300009094 Bacteria 2353
237 Ga0111539_10215981 3300009094 Unclassified 2234
238 Ga0105245_10076674 3300009098 Bacteria 3046
239 Ga0114129_10000324 3300009147 Bacteria 56067
240 Ga0114129_10000833 3300009147 Bacteria 39896
241 Ga0114129_10003679 3300009147 Bacteria 21574
242 Ga0114129_10016193 3300009147 Bacteria 10610
243 Ga0114129_10021996 3300009147 Bacteria 9050
244 Ga0114129_10034123 3300009147 Bacteria 7187
245 Ga0114129_10052656 3300009147 Bacteria 5713
246 Ga0114129_10069644 3300009147 Bacteria 4903
247 Ga0114129_10076433 3300009147 Bacteria 4662
248 Ga0114129_10083928 3300009147 Bacteria 4423
249 Ga0114129_10122367 3300009147 Bacteria 3581
250 Ga0114129_10218355 3300009147 Bacteria 2574
251 Ga0114129_10254252 3300009147 Bacteria 2357
252 Ga0105243_10014270 3300009148 Bacteria 6011
253 Ga0105243_10015475 3300009148 Bacteria 5765
254 Ga0105243_10104398 3300009148 Bacteria 2359
255 Ga0105241_10053819 3300009174 Bacteria 3079
256 Ga0105242_10017434 3300009176 Bacteria 5597
257 Ga0105242_10019296 3300009176 Bacteria 5341
258 Ga0105242_10107146 3300009176 Bacteria 2377
259 Ga0105242_10242750 3300009176 Bacteria 1620
260 Ga0105248_10049547 3300009177 Bacteria 4711
261 Ga0105248_10055240 3300009177 Bacteria 4453
262 Ga0105248_10238807 3300009177 Bacteria 2046
263 Ga0105238_10019308 3300009551 Bacteria 6943
264 Ga0105249_10007783 3300009553 Bacteria 9337
265 Ga0105249_10219084 3300009553 Bacteria 1872
266 Ga0105246_10021530 3300011119 Bacteria 4149
267 Ga0157374_10143867 3300013296 Bacteria 2316
268 Ga0157378_10014960 3300013297 Bacteria 6793
269 Ga0157378_10126030 3300013297 Bacteria 2365
270 Ga0163162_10010498 3300013306 Bacteria 9007
271 Ga0163162_10019877 3300013306 Bacteria 6595
272 Ga0163162_10041884 3300013306 Bacteria 4582
273 Ga0157372_10608759 3300013307 Unclassified 1273
274 Ga0157375_10008200 3300013308 Bacteria 9147
275 Ga0157375_10105312 3300013308 Bacteria 2910
276 Ga0157375_10231171 3300013308 Bacteria 2008
277 Ga0163163_10006898 3300014325 Bacteria 9969
278 Ga0163163_10042464 3300014325 Unclassified 4454
279 Ga0163163_10082987 3300014325 Bacteria 3209
280 Ga0157380_10000799 3300014326 Bacteria 19789
281 Ga0157380_10037009 3300014326 Bacteria 3780
282 Ga0157380_10060407 3300014326 Bacteria 3029
283 Ga0157380_10272980 3300014326 Bacteria 1543
284 Ga0157377_10038989 3300014745 Bacteria 2626
285 Ga0157377_10052576 3300014745 Bacteria 2300
286 Ga0157377_10075774 3300014745 Bacteria 1955
287 Ga0157377_10090086 3300014745 Bacteria 1809
288 Ga0157379_10083078 3300014968 Bacteria 2871
289 Ga0157376_10031563 3300014969 Bacteria 4244
290 Ga0157376_10036029 3300014969 Bacteria 4005
291 Ga0163161_10095417 3300017792 Bacteria 2206
292 Ga0213876_10019093 3300021384 Bacteria 3620
293 Ga0207697_10023261 3300025315 Bacteria 2537
294 Ga0207682_10004881 3300025893 Bacteria 5531
295 Ga0207682_10019869 3300025893 Bacteria 2634
296 Ga0207645_10000611 3300025907 Bacteria 29564
297 Ga0207645_10005408 3300025907 Bacteria 9262
298 Ga0207645_10007025 3300025907 Bacteria 8015
299 Ga0207645_10035702 3300025907 Bacteria 3191
300 Ga0207645_10089849 3300025907 Bacteria 1975
301 Ga0207643_10000068 3300025908 Bacteria 69282
302 Ga0207643_10024226 3300025908 Bacteria 3349
303 Ga0207643_10043513 3300025908 Bacteria 2534
304 Ga0207705_10158958 3300025909 Bacteria 1697
305 Ga0207707_10074606 3300025912 Bacteria 2959
306 Ga0207695_10255746 3300025913 Bacteria 1650
307 Ga0207662_10006169 3300025918 Bacteria 6450
308 Ga0207662_10021244 3300025918 Bacteria 3708
309 Ga0207662_10098175 3300025918 Bacteria 1812
310 Ga0207649_10101100 3300025920 Bacteria 1908
311 Ga0207681_10004748 3300025923 Bacteria 8360
312 Ga0207681_10008076 3300025923 Bacteria 6440
313 Ga0207681_10012428 3300025923 Bacteria 5255
314 Ga0207681_10023640 3300025923 Bacteria 3934
315 Ga0207681_10037398 3300025923 Bacteria 3208
316 Ga0207681_10119390 3300025923 Bacteria 1931
317 Ga0207694_10061573 3300025924 Bacteria 2921
318 Ga0207650_10100574 3300025925 Unclassified 2225
319 Ga0207650_10174502 3300025925 Unclassified 1710
320 Ga0207659_10000004 3300025926 Bacteria 476977
321 Ga0207659_10001166 3300025926 Bacteria 15673
322 Ga0207659_10001597 3300025926 Bacteria 13448
323 Ga0207659_10002915 3300025926 Bacteria 10188
324 Ga0207659_10003941 3300025926 Bacteria 8960
325 Ga0207659_10024361 3300025926 Bacteria 4054
326 Ga0207659_10027165 3300025926 Bacteria 3871
327 Ga0207659_10084945 3300025926 Bacteria 2350
328 Ga0207659_10097547 3300025926 Bacteria 2208
329 Ga0207687_10001731 3300025927 Bacteria 15029
330 Ga0207706_10024638 3300025933 Bacteria 5393
331 Ga0207706_10052666 3300025933 Bacteria 3593
332 Ga0207706_10063424 3300025933 Bacteria 3253
333 Ga0207706_10074505 3300025933 Bacteria 2985
334 Ga0207686_10004977 3300025934 Bacteria 7155
335 Ga0207709_10004516 3300025935 Bacteria 8024
336 Ga0207670_10072279 3300025936 Bacteria 2388
337 Ga0207670_10116883 3300025936 Bacteria 1932
338 Ga0207669_10038374 3300025937 Bacteria 2757
339 Ga0207704_10003884 3300025938 Bacteria 6792
340 Ga0207704_10085049 3300025938 Bacteria 2058
341 Ga0207691_10003313 3300025940 Bacteria 15693
342 Ga0207691_10007779 3300025940 Bacteria 10321
343 Ga0207691_10011105 3300025940 Bacteria 8646
344 Ga0207691_10014455 3300025940 Bacteria 7527
345 Ga0207691_10033132 3300025940 Bacteria 4812
346 Ga0207691_10125348 3300025940 Bacteria 2273
347 Ga0207691_10213633 3300025940 Bacteria 1675
348 Ga0207711_10138131 3300025941 Bacteria 2191
349 Ga0207689_10000219 3300025942 Bacteria 50693
350 Ga0207689_10002433 3300025942 Bacteria 17334
351 Ga0207689_10035829 3300025942 Bacteria 4120
352 Ga0207689_10220038 3300025942 Bacteria 1569
353 Ga0207661_10003578 3300025944 Bacteria 10808
354 Ga0207679_10017428 3300025945 Bacteria 4791
355 Ga0207679_10199719 3300025945 Bacteria 1669
356 Ga0207651_10000813 3300025960 Bacteria 13454
357 Ga0207651_10005227 3300025960 Bacteria 6634
358 Ga0207651_10040819 3300025960 Bacteria 3074
359 Ga0207712_10057685 3300025961 Bacteria 2740
360 Ga0207668_10136328 3300025972 Unclassified 1881
361 Ga0207658_10056418 3300025986 Bacteria 2915
362 Ga0207658_10132617 3300025986 Bacteria 2004
363 Ga0207677_10088764 3300026023 Bacteria 2243
364 Ga0207677_10090352 3300026023 Bacteria 2225
365 Ga0207703_10023860 3300026035 Bacteria 4810
366 Ga0207703_10026979 3300026035 Bacteria 4524
367 Ga0207639_10000003 3300026041 Bacteria 806887
368 Ga0207678_10032344 3300026067 Bacteria 4558
369 Ga0207678_10156071 3300026067 Unclassified 1948
370 Ga0207708_10000831 3300026075 Bacteria 23303
371 Ga0207708_10015853 3300026075 Bacteria 5657
372 Ga0207708_10024085 3300026075 Bacteria 4603
373 Ga0207708_10027304 3300026075 Bacteria 4321
374 Ga0207708_10049384 3300026075 Bacteria 3203
375 Ga0207708_10093326 3300026075 Bacteria 2323
376 Ga0207641_10038176 3300026088 Bacteria 4014
377 Ga0207641_10041274 3300026088 Bacteria 3866
378 Ga0207641_10116122 3300026088 Bacteria 2381
379 Ga0207641_10197885 3300026088 Unclassified 1851
380 Ga0207648_10001252 3300026089 Bacteria 28387
381 Ga0207648_10001542 3300026089 Bacteria 25362
382 Ga0207648_10013802 3300026089 Bacteria 7494
383 Ga0207648_10044752 3300026089 Bacteria 3884
384 Ga0207648_10067817 3300026089 Bacteria 3109
385 Ga0207676_10024559 3300026095 Bacteria 4461
386 Ga0207676_10047741 3300026095 Bacteria 3320
387 Ga0207676_10059160 3300026095 Bacteria 3025
388 Ga0207676_10164233 3300026095 Bacteria 1927
389 Ga0207674_10012643 3300026116 Bacteria 9436
390 Ga0207674_10029631 3300026116 Bacteria 5761
391 Ga0207674_10285819 3300026116 Bacteria 1598
392 Ga0207675_100017435 3300026118 Bacteria 6704
393 Ga0207675_100019206 3300026118 Bacteria 6377
394 Ga0207675_100028322 3300026118 Bacteria 5216
395 Ga0207675_100047723 3300026118 Bacteria 3997
396 Ga0207675_100059346 3300026118 Bacteria 3570
397 Ga0207675_100061892 3300026118 Bacteria 3494
398 Ga0207675_100062479 3300026118 Bacteria 3478
399 Ga0207683_10018323 3300026121 Bacteria 5973
400 Ga0207683_10028333 3300026121 Bacteria 4842
401 Ga0207683_10038335 3300026121 Bacteria 4176
402 Ga0207683_10043518 3300026121 Bacteria 3924
403 Ga0207683_10044843 3300026121 Bacteria 3866
404 Ga0207683_10098491 3300026121 Bacteria 2609
405 Ga0207428_10000020 3300027907 Bacteria 276713
406 Ga0207428_10001886 3300027907 Bacteria 21325
407 Ga0207428_10010619 3300027907 Bacteria 8214
408 Ga0207428_10019347 3300027907 Bacteria 5806
409 Ga0207428_10022164 3300027907 Bacteria 5363
410 Ga0207428_10063354 3300027907 Bacteria 2921
411 Ga0268266_10000298 3300028379 Bacteria 79989
412 Ga0268266_10013999 3300028379 Bacteria 6905
413 Ga0268265_10006601 3300028380 Bacteria 7853
414 Ga0268265_10043975 3300028380 Bacteria 3323
415 Ga0268265_10092745 3300028380 Bacteria 2418
416 Ga0268265_10194635 3300028380 Bacteria 1754
417 Ga0268264_10019905 3300028381 Bacteria 5483
418 Ga0268264_10041798 3300028381 Bacteria 3793
419 Ga0268264_10118343 3300028381 Bacteria 2331
420 Ga0265322_10000639 3300028654 Bacteria 13189
421 Ga0307408_100026245 3300031548 Bacteria 3999
422 Ga0307408_100035117 3300031548 Bacteria 3516
423 Ga0307408_100172186 3300031548 Bacteria 1729
424 Ga0307410_10065761 3300031852 Bacteria 2495
425 Ga0307410_10169692 3300031852 Bacteria 1643
426 Ga0307412_10024430 3300031911 Bacteria 3730
427 Ga0307412_10051844 3300031911 Bacteria 2714
428 Ga0307414_10019710 3300032004 Bacteria 4187
429 Ga0307414_10155021 3300032004 Bacteria 1812
430 Ga0307411_10032503 3300032005 Bacteria 3224
431 Ga0373962_0011384 3300035242 Bacteria 2230
432 Ga0373931_0082431 3300035691 Bacteria 1778
433 Ga0373925_0143143 3300037068 Bacteria 1873
434 Ga0436365_0342535 3300039437 Bacteria 9232
435 Ga0451807_1409687 3300041486 Bacteria 3972
436 Ga0439450_005388 3300042008 Bacteria 2247
437 Ga0439446_0016449 3300042156 Unclassified 2060
438 Ga0439435_0000832 3300042436 Bacteria 5263
439 Ga0439435_0001042 3300042436 Bacteria 4883
440 Ga0439464_0001219 3300042439 Bacteria 5980
441 Ga0439464_0043222 3300042439 Bacteria 1288
442 Ga0451577_0001886 3300042876 Bacteria 26682
443 Ga0451577_0018663 3300042876 Bacteria 6386
444 Ga0453684_0048467 3300044712 Bacteria 5617
445 Ga0453684_0122372 3300044712 Bacteria 3139
446 Ga0451576_0075730 3300045051 Bacteria 3502
447 Ga0451576_0119145 3300045051 Bacteria 2748
448 Ga0495603_0023454 3300046455 Bacteria 3733
449 Ga0495580_0000238 3300046472 Bacteria 43561
450 Ga0495594_0017685 3300046499 Bacteria 3769
451 Ga0495594_0045760 3300046499 Bacteria 2403
452 Ga0495620_0002828 3300046515 Bacteria 9974
453 Ga0495643_0056426 3300046522 Bacteria 2096
454 Ga0495642_0012598 3300046528 Bacteria 3260
455 Ga0495621_0010739 3300046539 Bacteria 2812
456 Ga0495633_0039990 3300046558 Bacteria 2236
457 Ga0495659_0003162 3300046664 Bacteria 5282
458 Ga0495659_0007707 3300046664 Bacteria 3413
459 Ga0495588_0017613 3300046674 Bacteria 3474
460 Ga0495658_0030637 3300046683 Bacteria 2923
461 Ga0495636_0011354 3300047318 Bacteria 3525
462 Ga0496101_0148416 3300048904 Bacteria 1792
463 Ga0496102_0127333 3300048905 Bacteria 2381
464 Ga0496104_0004276 3300048907 Bacteria 12412
465 Ga0496104_0012209 3300048907 Bacteria 7719
466 Ga0496106_0065422 3300048909 Bacteria 2768
467 Ga0496106_0065669 3300048909 Unclassified 2762
468 Ga0496108_0021366 3300048911 Bacteria 5319
469 Ga0496108_0044331 3300048911 Bacteria 3713
470 Ga0496109_0003251 3300048912 Bacteria 13544
471 Ga0496109_0046351 3300048912 Bacteria 3949
472 Ga0496109_0349419 3300048912 Bacteria 1397
473 Ga0496109_0390920 3300048912 Bacteria 1314
474 Ga0496110_0005783 3300048913 Bacteria 9718
475 Ga0496110_0222179 3300048913 Bacteria 1718
476 Ga0496111_0037789 3300048914 Bacteria 3456
477 Ga0496111_0121058 3300048914 Bacteria 1933
478 Ga0496112_0002553 3300048915 Bacteria 14706
479 Ga0496112_0005550 3300048915 Bacteria 10933
480 Ga0496112_0020671 3300048915 Bacteria 6244
481 Ga0496112_0056377 3300048915 Bacteria 3867
482 Ga0496112_0203238 3300048915 Bacteria 1940
483 Ga0496113_0028592 3300048916 Bacteria 4012
484 Ga0496113_0043730 3300048916 Bacteria 3316
485 Ga0496113_0093334 3300048916 Bacteria 2323
486 Ga0496113_0291467 3300048916 Bacteria 1306
487 Ga0501298_007062 3300049521 Bacteria 1855
488 Ga0501031_0031041 3300049568 Bacteria 3487
489 Ga0501031_0202008 3300049568 Unclassified 1297
490 Ga0501033_0090233 3300049570 Bacteria 2242
491 Ga0501034_0006898 3300049571 Bacteria 12139
492 Ga0501036_0010973 3300049572 Bacteria 7491
493 Ga0501036_0032522 3300049572 Bacteria 4408
494 Ga0501036_0060610 3300049572 Bacteria 3206
495 Ga0501036_0256283 3300049572 Bacteria 1466
496 Ga0501039_0195151 3300049575 Bacteria 1592
497 Ga0501039_0279501 3300049575 Bacteria 1312
498 Ga0501040_0007772 3300049576 Bacteria 6941
499 Ga0501040_0108464 3300049576 Bacteria 1941
500 Ga0501040_0203735 3300049576 Bacteria 1405
501 Ga0501041_0016156 3300049577 Bacteria 4435
502 Ga0501041_0073736 3300049577 Bacteria 2097
503 Ga0501041_0088922 3300049577 Bacteria 1907
504 Ga0501042_0013763 3300049578 Bacteria 5511
505 Ga0501042_0029340 3300049578 Bacteria 3879
506 Ga0501042_0072879 3300049578 Unclassified 2457
507 Ga0501048_0204120 3300049582 Bacteria 1401
508 Ga0501067_0115710 3300049583 Bacteria 1491
509 Ga0501069_0034817 3300049585 Bacteria 2773
510 Ga0501072_0003442 3300049588 Bacteria 11922
511 Ga0501072_0045916 3300049588 Bacteria 3436
512 Ga0501072_0060066 3300049588 Bacteria 2998
513 Ga0501072_0229166 3300049588 Bacteria 1480
514 Ga0501075_0005648 3300049591 Bacteria 8560
515 Ga0501075_0006007 3300049591 Bacteria 8320
516 Ga0501076_0007938 3300049592 Bacteria 7743
517 Ga0501076_0109408 3300049592 Bacteria 2233
518 Ga0501076_0132692 3300049592 Unclassified 2020
519 Ga0501077_0066959 3300049593 Bacteria 2278
520 Ga0501248_000264 3300049678 Bacteria 2682
521 Ga0501079_0012293 3300049741 Bacteria 6532
522 Ga0501079_0016364 3300049741 Bacteria 5666
523 Ga0501079_0188449 3300049741 Bacteria 1610
524 Ga0501080_0072635 3300049742 Bacteria 3201
525 Ga0501080_0351159 3300049742 Bacteria 1332
526 Ga0501081_0004648 3300049743 Bacteria 8828
527 Ga0501081_0029395 3300049743 Bacteria 3714
528 Ga0501081_0037449 3300049743 Bacteria 3309
529 Ga0501083_0103992 3300049744 Bacteria 1871
530 Ga0501045_0058227 3300049824 Bacteria 2829
531 Ga0501045_0068050 3300049824 Bacteria 2616
532 Ga0501045_0097303 3300049824 Bacteria 2177
533 nmdc:mga00v17_20975_c1 3300050491 Bacteria 3751
534 nmdc:mga00v17_39966_c1 3300050491 Bacteria 2811
535 nmdc:mga00v17_9552_c1 3300050491 Bacteria 5255
536 nmdc:mga0yw44_11869_c1 3300050492 Bacteria 4519
537 nmdc:mga0yw44_29928_c1 3300050492 Bacteria 3149
538 nmdc:mga06z11_24140_c1 3300050494 Bacteria 2865
539 nmdc:mga07m45_42159_c1 3300050496 Bacteria 2558
540 nmdc:mga05p37_133328_c1 3300050507 Bacteria 3047
541 nmdc:mga05p37_1896_c1 3300050507 Bacteria 24360
542 nmdc:mga05p37_2154_c1 3300050507 Bacteria 22954
543 nmdc:mga05p37_26140_c1 3300050507 Bacteria 7098
544 nmdc:mga05p37_3758_c1 3300050507 Bacteria 17772
545 nmdc:mga05p37_39178_c1 3300050507 Bacteria 5816
546 nmdc:mga05p37_39349_c1 3300050507 Bacteria 5805
547 nmdc:mga05p37_5747_c1 3300050507 Bacteria 14590
548 nmdc:mga05p37_81426_c1 3300050507 Bacteria 3988
549 nmdc:mga09592_137294_c1 3300050508 Bacteria 2106
550 nmdc:mga09592_260253_c1 3300050508 Bacteria 1504
551 nmdc:mga09592_5395_c1 3300050508 Bacteria 10399
552 nmdc:mga09592_73952_c1 3300050508 Bacteria 2896
553 nmdc:mga0qj67_191287_c1 3300050509 Bacteria 1663
554 nmdc:mga0qj67_20201_c1 3300050509 Bacteria 5098
555 nmdc:mga0qj67_43388_c1 3300050509 Unclassified 3541
556 nmdc:mga0qj67_57090_c1 3300050509 Bacteria 3095
557 nmdc:mga06r32_102054_c1 3300050510 Bacteria 2816
558 nmdc:mga06r32_50460_c1 3300050510 Bacteria 3980
559 nmdc:mga06r32_52227_c1 3300050510 Bacteria 3915
560 nmdc:mga06r32_5275_c1 3300050510 Bacteria 11624
561 nmdc:mga08y16_105253_c1 3300050511 Bacteria 2938
562 nmdc:mga08y16_131_c1 3300050511 Bacteria 64623
563 nmdc:mga08y16_14551_c1 3300050511 Bacteria 8274
564 nmdc:mga08y16_152316_c1 3300050511 Bacteria 2403
565 nmdc:mga08y16_20_c1 3300050511 Bacteria 276739
566 nmdc:mga08y16_26915_c1 3300050511 Bacteria 6060
567 nmdc:mga08y16_310439_c1 3300050511 Bacteria 1624
568 nmdc:mga08y16_78864_c1 3300050511 Bacteria 3433
569 nmdc:mga08y16_870_c1 3300050511 Bacteria 29078
570 nmdc:mga0n895_112051_c1 3300050512 Bacteria 2745
571 nmdc:mga0n895_12672_c1 3300050512 Bacteria 7570
572 nmdc:mga0n895_16759_c1 3300050512 Bacteria 6733
573 nmdc:mga0n895_222479_c1 3300050512 Bacteria 1916
574 nmdc:mga0n895_36489_c1 3300050512 Bacteria 4747
575 nmdc:mga0n895_57073_c1 3300050512 Bacteria 3848
576 nmdc:mga0n895_72713_c1 3300050512 Bacteria 3412
577 nmdc:mga0n895_9942_c1 3300050512 Bacteria 8368
578 nmdc:mga0rr50_10388_c1 3300050513 Bacteria 5904
579 nmdc:mga0rr50_23321_c1 3300050513 Bacteria 4265
580 nmdc:mga0rr50_63219_c1 3300050513 Bacteria 2795
581 nmdc:mga0a205_13094_c1 3300050515 Bacteria 7704
582 nmdc:mga0a205_215911_c1 3300050515 Bacteria 1805
583 nmdc:mga0a205_27213_c1 3300050515 Bacteria 5461
584 nmdc:mga0a205_45457_c1 3300050515 Bacteria 4233
585 nmdc:mga0a205_46889_c1 3300050515 Bacteria 4168
586 nmdc:mga0a205_6319_c1 3300050515 Bacteria 10697
587 nmdc:mga0a205_7991_c1 3300050515 Bacteria 9611
588 nmdc:mga0a205_82090_c1 3300050515 Bacteria 3114
589 nmdc:mga0a205_84_c1 3300050515 Bacteria 51647
590 Ga0501084_0023287 3300054114 Bacteria 5171
591 Ga0501084_0144690 3300054114 Archaea 2002
592 Ga0590071_000063 3300059421 Bacteria 28610
593 Ga0590071_000099 3300059421 Bacteria 24341
594 Ga0590074_000652 3300059423 Bacteria 5231
595 Ga0590074_006103 3300059423 Bacteria 2000
596 Ga0590075_000007 3300059424 Bacteria 63273
597 Ga0590075_000144 3300059424 Bacteria 18953
598 Ga0590075_001801 3300059424 Bacteria 5232
599 Ga0590077_000417 3300059426 Bacteria 11932
600 Ga0590077_000973 3300059426 Bacteria 7295
601 Ga0530510_0061610 3300061734 Bacteria 2716
602 Ga0495580_0033949
603 Ga0065714_10075646
604 Ga0065704_10002562
605 Ga0065712_10000173
606 Ga0065712_10002276
607 Ga0065712_10075446
608 Ga0065712_10124079
609 Ga0065715_10000280
610 Ga0065715_10002535
611 Ga0065715_10106275
612 Ga0065715_10115291
613 Ga0065707_10009182
614 Ga0070676_10002232
615 Ga0070676_10164251
616 Ga0070683_100000698
617 Ga0070683_100004931
618 Ga0070683_100022034
619 Ga0070690_100037875
620 Ga0070690_100090228
621 Ga0070690_100133411
622 Ga0070670_100001817
623 Ga0070670_100002545
624 Ga0070670_100006347
625 Ga0070670_100008954
626 Ga0070670_100033332
627 Ga0070677_10014276
628 Ga0070677_10046460
629 Ga0070677_10092860
630 Ga0068869_100002035
631 Ga0068869_100043834
632 Ga0068869_100066190
633 Ga0068869_100189104
634 Ga0070666_10030359
635 Ga0070680_100176757
636 Ga0068868_100025104
637 Ga0070660_100128094
638 Ga0070689_100028948
639 Ga0070689_100037218
640 Ga0070689_100156730
641 Ga0070691_10017381
642 Ga0070687_100013994
643 Ga0070687_100029638
644 Ga0070687_100065050
645 Ga0070661_100003066
646 Ga0070692_10013314
647 Ga0070668_100097518
648 Ga0070669_100005634
649 Ga0070669_100019769
650 Ga0070669_100020190
651 Ga0070669_100027985
652 Ga0070669_100039685
653 Ga0070669_100058100
654 Ga0070675_100000001
655 Ga0070675_100002958
656 Ga0070675_100003568
657 Ga0070675_100006135
658 Ga0070675_100018904
659 Ga0070675_100027617
660 Ga0070675_100041389
661 Ga0070675_100065653
662 Ga0070675_100078776
663 Ga0070675_100104078
664 Ga0070675_100104997
665 Ga0070671_100019646
666 Ga0070671_100040520
667 Ga0070674_100000032
668 Ga0070674_100001783
669 Ga0070674_100036881
670 Ga0070674_100048258
671 Ga0070673_100004841
672 Ga0070673_100005045
673 Ga0070673_100038252
674 Ga0070673_100038577
675 Ga0070673_100062164
676 Ga0070673_100099603
677 Ga0070673_100210012
678 Ga0070688_100003806
679 Ga0070688_100017782
680 Ga0070688_100024876
681 Ga0070667_100008279
682 Ga0070667_100040961
683 Ga0070667_100073842
684 Ga0070667_100213713
685 Ga0070701_10016676
686 Ga0070701_10020202
687 Ga0070701_10111233
688 Ga0070705_100000775
689 Ga0070705_100010537
690 Ga0070694_100007561
691 Ga0070694_100016356
692 Ga0070694_100060398
693 Ga0070694_100167163
694 Ga0070708_100025381
695 Ga0070708_100081846
696 Ga0070678_100020222
697 Ga0070678_100052387
698 Ga0070678_100078415
699 Ga0070678_100180529
700 Ga0070662_100007770
701 Ga0070662_100047662
702 Ga0070681_10331273
703 Ga0068867_100000578
704 Ga0068867_100033134
705 Ga0068867_100041702
706 Ga0070685_10023632
707 Ga0070685_10159560
708 Ga0070707_100146731
709 Ga0070698_100001133
710 Ga0070698_100017547
711 Ga0070698_100197733
712 Ga0070699_100000125
713 Ga0070699_100029178
714 Ga0070699_100037796
715 Ga0070684_100002600
716 Ga0070697_100082466
717 Ga0070672_100015081
718 Ga0070672_100106820
719 Ga0070686_100027132
720 Ga0070695_100000040
721 Ga0070695_100037605
722 Ga0070696_100006647
723 Ga0070696_100016747
724 Ga0070696_100029867
725 Ga0070696_100075987
726 Ga0070696_100216999
727 Ga0070693_100026339
728 Ga0070693_100033923
729 Ga0070665_100000192
730 Ga0070665_100108499
731 Ga0070665_100297512
732 Ga0070704_100014038
733 Ga0070704_100043081
734 Ga0070664_100004110
735 Ga0070664_100007452
736 Ga0070664_100039831
737 Ga0068857_100016879
738 Ga0068857_100031138
739 Ga0070702_100098578
740 Ga0068852_100023772
741 Ga0068852_100057813
742 Ga0068859_100006708
743 Ga0068859_100009529
744 Ga0068859_100040701
745 Ga0068859_100125648
746 Ga0068859_100314843
747 Ga0068864_100037806
748 Ga0068864_100145680
749 Ga0068864_100158522
750 Ga0068864_100273119
751 Ga0068866_10048849
752 Ga0068861_100017626
753 Ga0068861_100019579
754 Ga0068861_100036701
755 Ga0068861_100075521
756 Ga0068861_100254252
757 Ga0068870_10002885
758 Ga0068870_10018405
759 Ga0068863_100006263
760 Ga0068863_100054102
761 Ga0068863_100176016
762 Ga0068863_100232070
763 Ga0068858_100009371
764 Ga0068858_100073175
765 Ga0068860_100015767
766 Ga0068860_100041735
767 Ga0068860_100042097
768 Ga0068862_100022008
769 Ga0068862_100026042
770 Ga0068862_100054051
771 Ga0068862_100108746
772 Ga0070717_10081617
773 Ga0075363_100050703
774 Ga0075364_10004069
775 Ga0075364_10015143
776 Ga0075364_10043289
777 Ga0075367_10012355
778 Ga0075366_10018398
779 Ga0068871_100192167
780 Ga0075428_100000166
781 Ga0075428_100000712
782 Ga0075428_100003413
783 Ga0075428_100004770
784 Ga0075428_100005989
785 Ga0075428_100013108
786 Ga0075428_100028630
787 Ga0075428_100125333
788 Ga0075430_100000691
789 Ga0075430_100001481
790 Ga0075430_100006691
791 Ga0075430_100011371
792 Ga0075430_100035134
793 Ga0075430_100129671
794 Ga0075431_100001885
795 Ga0075431_100021127
796 Ga0075431_100021230
797 Ga0075431_100035531
798 Ga0075431_100063640
799 Ga0075431_100109646
800 Ga0075433_10001456
801 Ga0075433_10003206
802 Ga0075433_10005012
803 Ga0075433_10035761
804 Ga0075433_10056365
805 Ga0075434_100003306
806 Ga0075434_100027168
807 Ga0075434_100111278
808 Ga0075429_100007109
809 Ga0075429_100024850
810 Ga0075429_100028011
811 Ga0075429_100028295
812 Ga0075429_100028828
813 Ga0075429_100045912
814 Ga0068865_100001886
815 Ga0068865_100023056
816 Ga0068865_100048854
817 Ga0097620_100006708
818 Ga0097620_100009529
819 Ga0097620_100040704
820 Ga0097620_100125647
821 Ga0097620_100314855
822 Ga0075435_100001599
823 Ga0075435_100010023
824 Ga0075435_100039348
825 Ga0075435_100106039
826 Ga0075435_100137373
827 Ga0075435_100257905
828 Ga0105244_10029742
829 Ga0111539_10000118
830 Ga0111539_10007840
831 Ga0111539_10015750
832 Ga0111539_10033958
833 Ga0111539_10033990
834 Ga0111539_10042125
835 Ga0111539_10057023
836 Ga0111539_10075129
837 Ga0111539_10196510
838 Ga0111539_10215981
839 Ga0105245_10076674
840 Ga0114129_10000324
841 Ga0114129_10000833
842 Ga0114129_10003679
843 Ga0114129_10016193
844 Ga0114129_10021996
845 Ga0114129_10034123
846 Ga0114129_10052656
847 Ga0114129_10069644
848 Ga0114129_10076433
849 Ga0114129_10083928
850 Ga0114129_10122367
851 Ga0114129_10218355
852 Ga0114129_10254252
853 Ga0105243_10014270
854 Ga0105243_10015475
855 Ga0105243_10104398
856 Ga0105241_10053819
857 Ga0105242_10017434
858 Ga0105242_10019296
859 Ga0105242_10107146
860 Ga0105242_10242750
861 Ga0105248_10049547
862 Ga0105248_10055240
863 Ga0105248_10238807
864 Ga0105238_10019308
865 Ga0105249_10007783
866 Ga0105249_10219084
867 Ga0105246_10021530
868 Ga0157374_10143867
869 Ga0157378_10014960
870 Ga0157378_10126030
871 Ga0163162_10010498
872 Ga0163162_10019877
873 Ga0163162_10041884
874 Ga0157372_10608759
875 Ga0157375_10008200
876 Ga0157375_10105312
877 Ga0157375_10231171
878 Ga0163163_10006898
879 Ga0163163_10042464
880 Ga0163163_10082987
881 Ga0157380_10000799
882 Ga0157380_10037009
883 Ga0157380_10060407
884 Ga0157380_10272980
885 Ga0157377_10038989
886 Ga0157377_10052576
887 Ga0157377_10075774
888 Ga0157377_10090086
889 Ga0157379_10083078
890 Ga0157376_10031563
891 Ga0157376_10036029
892 Ga0163161_10095417
893 Ga0213876_10019093
894 Ga0207697_10023261
895 Ga0207682_10004881
896 Ga0207682_10019869
897 Ga0207645_10000611
898 Ga0207645_10005408
899 Ga0207645_10007025
900 Ga0207645_10035702
901 Ga0207645_10089849
902 Ga0207643_10000068
903 Ga0207643_10024226
904 Ga0207643_10043513
905 Ga0207705_10158958
906 Ga0207707_10074606
907 Ga0207695_10255746
908 Ga0207662_10006169
909 Ga0207662_10021244
910 Ga0207662_10098175
911 Ga0207649_10101100
912 Ga0207681_10004748
913 Ga0207681_10008076
914 Ga0207681_10012428
915 Ga0207681_10023640
916 Ga0207681_10037398
917 Ga0207681_10119390
918 Ga0207694_10061573
919 Ga0207650_10100574
920 Ga0207650_10174502
921 Ga0207659_10000004
922 Ga0207659_10001166
923 Ga0207659_10001597
924 Ga0207659_10002915
925 Ga0207659_10003941
926 Ga0207659_10024361
927 Ga0207659_10027165
928 Ga0207659_10084945
929 Ga0207659_10097547
930 Ga0207687_10001731
931 Ga0207706_10024638
932 Ga0207706_10052666
933 Ga0207706_10063424
934 Ga0207706_10074505
935 Ga0207686_10004977
936 Ga0207709_10004516
937 Ga0207670_10072279
938 Ga0207670_10116883
939 Ga0207669_10038374
940 Ga0207704_10003884
941 Ga0207704_10085049
942 Ga0207691_10003313
943 Ga0207691_10007779
944 Ga0207691_10011105
945 Ga0207691_10014455
946 Ga0207691_10033132
947 Ga0207691_10125348
948 Ga0207691_10213633
949 Ga0207711_10138131
950 Ga0207689_10000219
951 Ga0207689_10002433
952 Ga0207689_10035829
953 Ga0207689_10220038
954 Ga0207661_10003578
955 Ga0207679_10017428
956 Ga0207679_10199719
957 Ga0207651_10000813
958 Ga0207651_10005227
959 Ga0207651_10040819
960 Ga0207712_10057685
961 Ga0207668_10136328
962 Ga0207658_10056418
963 Ga0207658_10132617
964 Ga0207677_10088764
965 Ga0207677_10090352
966 Ga0207703_10023860
967 Ga0207703_10026979
968 Ga0207639_10000003
969 Ga0207678_10032344
970 Ga0207678_10156071
971 Ga0207708_10000831
972 Ga0207708_10015853
973 Ga0207708_10024085
974 Ga0207708_10027304
975 Ga0207708_10049384
976 Ga0207708_10093326
977 Ga0207641_10038176
978 Ga0207641_10041274
979 Ga0207641_10116122
980 Ga0207641_10197885
981 Ga0207648_10001252
982 Ga0207648_10001542
983 Ga0207648_10013802
984 Ga0207648_10044752
985 Ga0207648_10067817
986 Ga0207676_10024559
987 Ga0207676_10047741
988 Ga0207676_10059160
989 Ga0207676_10164233
990 Ga0207674_10012643
991 Ga0207674_10029631
992 Ga0207674_10285819
993 Ga0207675_100017435
994 Ga0207675_100019206
995 Ga0207675_100028322
996 Ga0207675_100047723
997 Ga0207675_100059346
998 Ga0207675_100061892
999 Ga0207675_100062479
1000 Ga0207683_10018323
1001 Ga0207683_10028333
1002 Ga0207683_10038335
1003 Ga0207683_10043518
1004 Ga0207683_10044843
1005 Ga0207683_10098491
1006 Ga0207428_10000020
1007 Ga0207428_10001886
1008 Ga0207428_10010619
1009 Ga0207428_10019347
1010 Ga0207428_10022164
1011 Ga0207428_10063354
1012 Ga0268266_10000298
1013 Ga0268266_10013999
1014 Ga0268265_10006601
1015 Ga0268265_10043975
1016 Ga0268265_10092745
1017 Ga0268265_10194635
1018 Ga0268264_10019905
1019 Ga0268264_10041798
1020 Ga0268264_10118343
1021 Ga0265322_10000639
1022 Ga0307408_100026245
1023 Ga0307408_100035117
1024 Ga0307408_100172186
1025 Ga0307410_10065761
1026 Ga0307410_10169692
1027 Ga0307412_10024430
1028 Ga0307412_10051844
1029 Ga0307414_10019710
1030 Ga0307414_10155021
1031 Ga0307411_10032503
1032 Ga0373962_0011384
1033 Ga0373931_0082431
1034 Ga0373925_0143143
1035 Ga0436365_0342535
1036 Ga0451807_1409687
1037 Ga0439450_005388
1038 Ga0439446_0016449
1039 Ga0439435_0000832
1040 Ga0439435_0001042
1041 Ga0439464_0001219
1042 Ga0439464_0043222
1043 Ga0451577_0001886
1044 Ga0451577_0018663
1045 Ga0453684_0048467
1046 Ga0453684_0122372
1047 Ga0451576_0075730
1048 Ga0451576_0119145
1049 Ga0495603_0023454
1050 Ga0495580_0000238
1051 Ga0495594_0017685
1052 Ga0495594_0045760
1053 Ga0495620_0002828
1054 Ga0495643_0056426
1055 Ga0495642_0012598
1056 Ga0495621_0010739
1057 Ga0495633_0039990
1058 Ga0495659_0003162
1059 Ga0495659_0007707
1060 Ga0495588_0017613
1061 Ga0495658_0030637
1062 Ga0495636_0011354
1063 Ga0496101_0148416
1064 Ga0496102_0127333
1065 Ga0496104_0004276
1066 Ga0496104_0012209
1067 Ga0496106_0065422
1068 Ga0496106_0065669
1069 Ga0496108_0021366
1070 Ga0496108_0044331
1071 Ga0496109_0003251
1072 Ga0496109_0046351
1073 Ga0496109_0349419
1074 Ga0496109_0390920
1075 Ga0496110_0005783
1076 Ga0496110_0222179
1077 Ga0496111_0037789
1078 Ga0496111_0121058
1079 Ga0496112_0002553
1080 Ga0496112_0005550
1081 Ga0496112_0020671
1082 Ga0496112_0056377
1083 Ga0496112_0203238
1084 Ga0496113_0028592
1085 Ga0496113_0043730
1086 Ga0496113_0093334
1087 Ga0496113_0291467
1088 Ga0501298_007062
1089 Ga0501031_0031041
1090 Ga0501031_0202008
1091 Ga0501033_0090233
1092 Ga0501034_0006898
1093 Ga0501036_0010973
1094 Ga0501036_0032522
1095 Ga0501036_0060610
1096 Ga0501036_0256283
1097 Ga0501039_0195151
1098 Ga0501039_0279501
1099 Ga0501040_0007772
1100 Ga0501040_0108464
1101 Ga0501040_0203735
1102 Ga0501041_0016156
1103 Ga0501041_0073736
1104 Ga0501041_0088922
1105 Ga0501042_0013763
1106 Ga0501042_0029340
1107 Ga0501042_0072879
1108 Ga0501048_0204120
1109 Ga0501067_0115710
1110 Ga0501069_0034817
1111 Ga0501072_0003442
1112 Ga0501072_0045916
1113 Ga0501072_0060066
1114 Ga0501072_0229166
1115 Ga0501075_0005648
1116 Ga0501075_0006007
1117 Ga0501076_0007938
1118 Ga0501076_0109408
1119 Ga0501076_0132692
1120 Ga0501077_0066959
1121 Ga0501248_000264
1122 Ga0501079_0012293
1123 Ga0501079_0016364
1124 Ga0501079_0188449
1125 Ga0501080_0072635
1126 Ga0501080_0351159
1127 Ga0501081_0004648
1128 Ga0501081_0029395
1129 Ga0501081_0037449
1130 Ga0501083_0103992
1131 Ga0501045_0058227
1132 Ga0501045_0068050
1133 Ga0501045_0097303
1134 nmdc:mga00v17_20975_c1
1135 nmdc:mga00v17_39966_c1
1136 nmdc:mga00v17_9552_c1
1137 nmdc:mga0yw44_11869_c1
1138 nmdc:mga0yw44_29928_c1
1139 nmdc:mga06z11_24140_c1
1140 nmdc:mga07m45_42159_c1
1141 nmdc:mga05p37_133328_c1
1142 nmdc:mga05p37_1896_c1
1143 nmdc:mga05p37_2154_c1
1144 nmdc:mga05p37_26140_c1
1145 nmdc:mga05p37_3758_c1
1146 nmdc:mga05p37_39178_c1
1147 nmdc:mga05p37_39349_c1
1148 nmdc:mga05p37_5747_c1
1149 nmdc:mga05p37_81426_c1
1150 nmdc:mga09592_137294_c1
1151 nmdc:mga09592_260253_c1
1152 nmdc:mga09592_5395_c1
1153 nmdc:mga09592_73952_c1
1154 nmdc:mga0qj67_191287_c1
1155 nmdc:mga0qj67_20201_c1
1156 nmdc:mga0qj67_43388_c1
1157 nmdc:mga0qj67_57090_c1
1158 nmdc:mga06r32_102054_c1
1159 nmdc:mga06r32_50460_c1
1160 nmdc:mga06r32_52227_c1
1161 nmdc:mga06r32_5275_c1
1162 nmdc:mga08y16_105253_c1
1163 nmdc:mga08y16_131_c1
1164 nmdc:mga08y16_14551_c1
1165 nmdc:mga08y16_152316_c1
1166 nmdc:mga08y16_20_c1
1167 nmdc:mga08y16_26915_c1
1168 nmdc:mga08y16_310439_c1
1169 nmdc:mga08y16_78864_c1
1170 nmdc:mga08y16_870_c1
1171 nmdc:mga0n895_112051_c1
1172 nmdc:mga0n895_12672_c1
1173 nmdc:mga0n895_16759_c1
1174 nmdc:mga0n895_222479_c1
1175 nmdc:mga0n895_36489_c1
1176 nmdc:mga0n895_57073_c1
1177 nmdc:mga0n895_72713_c1
1178 nmdc:mga0n895_9942_c1
1179 nmdc:mga0rr50_10388_c1
1180 nmdc:mga0rr50_23321_c1
1181 nmdc:mga0rr50_63219_c1
1182 nmdc:mga0a205_13094_c1
1183 nmdc:mga0a205_215911_c1
1184 nmdc:mga0a205_27213_c1
1185 nmdc:mga0a205_45457_c1
1186 nmdc:mga0a205_46889_c1
1187 nmdc:mga0a205_6319_c1
1188 nmdc:mga0a205_7991_c1
1189 nmdc:mga0a205_82090_c1
1190 nmdc:mga0a205_84_c1
1191 Ga0501084_0023287
1192 Ga0501084_0144690
1193 Ga0590071_000063
1194 Ga0590071_000099
1195 Ga0590074_000652
1196 Ga0590074_006103
1197 Ga0590075_000007
1198 Ga0590075_000144
1199 Ga0590075_001801
1200 Ga0590077_000417
1201 Ga0590077_000973
1202 Ga0530510_0061610

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o0y-assembly4.cif.gz_A the crystal structure of the putative lipoprotein from colwellia psychrerythraea 0.5426 47 420
3o0y-assembly4.cif.gz_A the crystal structure of the putative lipoprotein from colwellia psychrerythraea 0.4854 47 420
3u24-assembly1.cif.gz_A the structure of a putative lipoprotein of unknown function from shewanella oneidensis. 0.4833 43 411
3u24-assembly1.cif.gz_A the structure of a putative lipoprotein of unknown function from shewanella oneidensis. 0.4318 43 411
7c8k-assembly1.cif.gz_A structural basis for cross-species recognition of covid-19 virus spike receptor binding domain to bat ace2 0.4086 15 420
ID Description Score Start End Superfamily
af_O60125_78_194_1.20.58.120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;BAG domain 0.6629 15 106 1.20.58.120
af_F1QGM6_424_509_1.20.58.120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;BAG domain 0.6493 10 106 1.20.58.120
af_P23894_64_157_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.6243 164 239 3.30.2010.10
af_F1QGM6_424_509_1.20.58.120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;BAG domain 0.6096 10 106 1.20.58.120
af_A8JNS4_461_549_1.20.58.120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;BAG domain 0.6086 15 109 1.20.58.120
ID Description Score Start End GO Terms
AF-A0A3N5QWJ9-F1-model_v4 DUF885 domain-containing protein 0.9781 18 380
AF-A0A2V5QUP7-F1-model_v4 DUF885 domain-containing protein 0.973 32 420
AF-A0A3C1YQW9-F1-model_v4 DUF885 domain-containing protein 0.9728 18 289
AF-A0A847SIM1-F1-model_v4 DUF885 domain-containing protein 0.9727 18 420
AF-A0A434AGZ9-F1-model_v4 DUF885 domain-containing protein 0.9704 18 420

Map