F468089

General Info

Members Datasets Scaffolds Average Seq Length
601 372 1202 265

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0004905|Ga0495580_0004905_6487_7422
Length 303
Sequence MSEETMTTTKITIRRSAPAGARKWSDPGPVRSGTGPERKKWGYTILAIFFLAIMLFPVYWMINASLQPNGTTLETSWLPLKPDFTGYATAISEQGGNLATSLVISLGSVVLSLAIAAPAAYALAYFKVKGAGVVLFAILISQMIPGIVVANALYTAYNDLGLLNSIPGLILADSAHGIPFAILIIRAFMNGMPASVIEAARVDGAGHVRAFWSIVVPLSRNSLITAGLFTFLFTWSDFLFALTLTTTEAVRPVTLGIFQYIGAYVNDWSSVMATAVLASVPAIILLVAAQKYIAAGTTGGAVK

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
172 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
193 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
194 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
195 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
196 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
203 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
214 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
215 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
216 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
217 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
218 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
219 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
222 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
223 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
224 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
225 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
226 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
227 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
238 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
258 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
259 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
260 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
261 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
262 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
267 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
268 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
271 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
272 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
273 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
277 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
278 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
279 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
303 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
320 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
321 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
322 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
323 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
324 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
325 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
326 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
327 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
328 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
329 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
330 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
332 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
333 2558860280 Kutzneria sp. 744 Isolate Unclassified
334 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
335 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
336 2643221548 Streptomyces sp. Root55 Isolate Unclassified
337 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
338 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
339 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
340 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
341 2808606448 Streptomyces sp. 193411 Isolate Unclassified
342 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
343 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
344 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
345 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
346 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
347 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
348 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
349 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
350 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
351 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
352 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
353 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
354 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
355 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
356 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
357 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
358 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
359 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
360 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
361 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
362 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
363 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
364 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
365 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
366 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
367 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
368 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
369 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
370 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
371 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
372 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.01
Metatranscriptomes 0.83
Isolates 7.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0
Rhizoplane 7.32
Rhizosphere 81.2
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0004905 3300046472 Bacteria 11188
2 JGI24739J22299_10021153 3300001989 Bacteria 2318
3 JGI24748J21848_1012473 3300002074 Bacteria 1002
4 JGI25152J39213_1000095 3300002773 Bacteria 62377
5 JGI25406J46586_10002625 3300003203 Bacteria 8479
6 rootH2_10051450 3300003320 Bacteria 2397
7 rootL2_10237258 3300003322 Bacteria 1718
8 Ga0070658_10059668 3300005327 Bacteria 3106
9 Ga0070658_10319210 3300005327 Bacteria 1326
10 Ga0070676_10094451 3300005328 Bacteria 1837
11 Ga0070683_100041638 3300005329 Bacteria 4227
12 Ga0070690_100056164 3300005330 Bacteria 2523
13 Ga0068869_100027386 3300005334 Bacteria 3973
14 Ga0070682_100221311 3300005337 Bacteria 1347
15 Ga0068868_100278493 3300005338 Bacteria 1415
16 Ga0070660_100103359 3300005339 Bacteria 2259
17 Ga0070687_100208212 3300005343 Bacteria 1190
18 Ga0070661_100020925 3300005344 Bacteria 4668
19 Ga0070692_10035795 3300005345 Bacteria 2515
20 Ga0070668_100024871 3300005347 Bacteria 4539
21 Ga0070669_100088882 3300005353 Bacteria 2313
22 Ga0070675_100062755 3300005354 Bacteria 3070
23 Ga0070671_100050665 3300005355 Bacteria 3453
24 Ga0070674_100182525 3300005356 Bacteria 1608
25 Ga0070673_100110137 3300005364 Bacteria 2282
26 Ga0070673_100229619 3300005364 Bacteria 1610
27 Ga0070688_100043034 3300005365 Bacteria 2781
28 Ga0070659_100014189 3300005366 Bacteria 5949
29 Ga0070703_10010387 3300005406 Bacteria 2624
30 Ga0070709_10012270 3300005434 Bacteria 4793
31 Ga0070709_10075674 3300005434 Bacteria 2184
32 Ga0070709_10103627 3300005434 Bacteria 1900
33 Ga0070709_10226203 3300005434 Bacteria 1336
34 Ga0070709_10297728 3300005434 Bacteria 1177
35 Ga0070714_100002910 3300005435 Bacteria 12661
36 Ga0070714_100004514 3300005435 Bacteria 10491
37 Ga0070714_100245372 3300005435 Bacteria 1654
38 Ga0070714_100328168 3300005435 Bacteria 1432
39 Ga0070714_100443410 3300005435 Bacteria 1232
40 Ga0070713_100017976 3300005436 Bacteria 5366
41 Ga0070713_100144465 3300005436 Bacteria 2110
42 Ga0070713_100174414 3300005436 Bacteria 1928
43 Ga0070710_10068296 3300005437 Bacteria 2042
44 Ga0070710_10205628 3300005437 Bacteria 1245
45 Ga0070710_10231665 3300005437 Bacteria 1179
46 Ga0070711_100019009 3300005439 Bacteria 4398
47 Ga0070711_100045418 3300005439 Bacteria 2988
48 Ga0070705_100096053 3300005440 Bacteria 1859
49 Ga0070700_100069339 3300005441 Bacteria 2245
50 Ga0070694_100182387 3300005444 Bacteria 1553
51 Ga0070708_100012775 3300005445 Bacteria 6860
52 Ga0070708_100450963 3300005445 Bacteria 1213
53 Ga0070663_100004385 3300005455 Bacteria 8285
54 Ga0070678_100013320 3300005456 Bacteria 5151
55 Ga0070681_10179709 3300005458 Bacteria 2037
56 Ga0068867_100139952 3300005459 Bacteria 1890
57 Ga0070685_10084513 3300005466 Bacteria 1909
58 Ga0070706_100001932 3300005467 Bacteria 21357
59 Ga0070706_100407604 3300005467 Bacteria 1266
60 Ga0070707_100049426 3300005468 Bacteria 4031
61 Ga0070707_100314794 3300005468 Unclassified 1521
62 Ga0070699_100005235 3300005518 Bacteria 11395
63 Ga0070679_100260437 3300005530 Bacteria 1690
64 Ga0070684_100274956 3300005535 Bacteria 1542
65 Ga0070697_100001458 3300005536 Bacteria 18012
66 Ga0068853_100015092 3300005539 Bacteria 6351
67 Ga0070672_100020195 3300005543 Bacteria 4854
68 Ga0070686_100029101 3300005544 Bacteria 3356
69 Ga0070695_100092876 3300005545 Bacteria 2018
70 Ga0070696_100118182 3300005546 Bacteria 1916
71 Ga0070693_100169664 3300005547 Bacteria 1396
72 Ga0070665_100023984 3300005548 Bacteria 6143
73 Ga0070665_100191654 3300005548 Unclassified 2045
74 Ga0070704_100017245 3300005549 Bacteria 4587
75 Ga0068855_100233794 3300005563 Bacteria 2056
76 Ga0070664_100004731 3300005564 Bacteria 10915
77 Ga0070664_100465010 3300005564 Bacteria 1163
78 Ga0068857_100021269 3300005577 Bacteria 5710
79 Ga0068854_100235116 3300005578 Bacteria 1456
80 Ga0068856_100040174 3300005614 Bacteria 4594
81 Ga0068856_100162810 3300005614 Bacteria 2242
82 Ga0068856_100835198 3300005614 Bacteria 940
83 Ga0070702_100058693 3300005615 Bacteria 2230
84 Ga0068852_100798938 3300005616 Bacteria 957
85 Ga0068859_100041605 3300005617 Bacteria 4615
86 Ga0068864_100128161 3300005618 Bacteria 2276
87 Ga0068861_100112906 3300005719 Bacteria 2179
88 Ga0068851_10065019 3300005834 Bacteria 1876
89 Ga0068870_10050522 3300005840 Bacteria 2197
90 Ga0068863_100027297 3300005841 Bacteria 5445
91 Ga0068862_100246677 3300005844 Bacteria 1626
92 Ga0081539_10001965 3300005985 Bacteria 31305
93 Ga0070717_10020002 3300006028 Bacteria 5258
94 Ga0070717_10027725 3300006028 Bacteria 4528
95 Ga0070717_10046707 3300006028 Bacteria 3544
96 Ga0070717_10047896 3300006028 Bacteria 3504
97 Ga0075432_10003992 3300006058 Bacteria 5035
98 Ga0070715_10004053 3300006163 Bacteria 4756
99 Ga0070715_10015635 3300006163 Bacteria 2835
100 Ga0070716_100001905 3300006173 Bacteria 9470
101 Ga0070712_100009049 3300006175 Bacteria 6273
102 Ga0070712_100202480 3300006175 Bacteria 1560
103 Ga0070712_100308334 3300006175 Bacteria 1283
104 Ga0068871_100217173 3300006358 Bacteria 1655
105 Ga0075434_100165490 3300006871 Bacteria 2231
106 Ga0075434_100228355 3300006871 Bacteria 1881
107 Ga0068865_100035525 3300006881 Bacteria 3353
108 Ga0075436_100116731 3300006914 Bacteria 1865
109 Ga0097620_100041610 3300006931 Bacteria 4615
110 Ga0099795_10116135 3300007788 Bacteria 1065
111 Ga0105251_10040117 3300009011 Bacteria 2283
112 Ga0105244_10012358 3300009036 Bacteria 5047
113 Ga0105244_10091140 3300009036 Bacteria 1499
114 Ga0105244_10133015 3300009036 Bacteria 1200
115 Ga0105240_10040646 3300009093 Bacteria 5945
116 Ga0105240_10069993 3300009093 Bacteria 4342
117 Ga0105245_10177129 3300009098 Bacteria 2034
118 Ga0105245_10433505 3300009098 Bacteria 1320
119 Ga0105247_10237078 3300009101 Bacteria 1241
120 Ga0105243_10004167 3300009148 Bacteria 11466
121 Ga0105243_10031695 3300009148 Bacteria 4077
122 Ga0105241_10018793 3300009174 Bacteria 5092
123 Ga0105241_10114588 3300009174 Bacteria 2163
124 Ga0105242_10038612 3300009176 Bacteria 3841
125 Ga0105242_10747303 3300009176 Bacteria 962
126 Ga0105237_10000174 3300009545 Bacteria 90431
127 Ga0105237_10001307 3300009545 Bacteria 33118
128 Ga0105238_10015722 3300009551 Bacteria 7662
129 Ga0105238_10261075 3300009551 Bacteria 1711
130 Ga0105249_10088188 3300009553 Bacteria 2897
131 Ga0105239_10001557 3300010375 Bacteria 30331
132 Ga0105246_10003722 3300011119 Bacteria 9232
133 Ga0105246_10012370 3300011119 Bacteria 5322
134 Ga0105246_10083779 3300011119 Bacteria 2279
135 Ga0105246_10094933 3300011119 Bacteria 2158
136 Ga0157373_10019625 3300013100 Bacteria 4917
137 Ga0157371_10005287 3300013102 Bacteria 10937
138 Ga0157371_10061921 3300013102 Bacteria 2653
139 Ga0157370_10011249 3300013104 Bacteria 9381
140 Ga0157370_10147172 3300013104 Bacteria 2193
141 Ga0157369_10017546 3300013105 Bacteria 8043
142 Ga0157369_10757126 3300013105 Bacteria 999
143 Ga0157374_10007271 3300013296 Bacteria 9435
144 Ga0157374_10799284 3300013296 Bacteria 959
145 Ga0157378_10063114 3300013297 Bacteria 3309
146 Ga0157378_10440128 3300013297 Bacteria 1292
147 Ga0163163_10124453 3300014325 Bacteria 2615
148 Ga0157377_10011527 3300014745 Bacteria 4416
149 Ga0157376_10324094 3300014969 Bacteria 1465
150 Ga0163161_10057952 3300017792 Bacteria 2815
151 Ga0197907_10720153 3300020069 Bacteria 1836
152 Ga0206356_11279835 3300020070 Bacteria 2264
153 Ga0206350_11546322 3300020080 Bacteria 1371
154 Ga0206353_10015909 3300020082 Bacteria 1866
155 Ga0213875_10000239 3300021388 Bacteria 55108
156 Ga0213875_10002504 3300021388 Bacteria 10982
157 Ga0209129_1000060 3300025258 Bacteria 248262
158 Ga0209025_1000308 3300025294 Bacteria 108660
159 Ga0209051_1007288 3300025303 Bacteria 6069
160 Ga0207697_10011369 3300025315 Bacteria 3765
161 Ga0207655_1036035 3300025728 Bacteria 2200
162 Ga0207653_10006682 3300025885 Bacteria 3603
163 Ga0207692_10023771 3300025898 Bacteria 2839
164 Ga0207692_10028185 3300025898 Bacteria 2653
165 Ga0207692_10036132 3300025898 Bacteria 2406
166 Ga0207642_10034248 3300025899 Bacteria 2158
167 Ga0207710_10188950 3300025900 Unclassified 1013
168 Ga0207688_10007308 3300025901 Bacteria 6010
169 Ga0207680_10136044 3300025903 Bacteria 1624
170 Ga0207647_10038187 3300025904 Bacteria 3037
171 Ga0207699_10007182 3300025906 Bacteria 5437
172 Ga0207699_10018818 3300025906 Bacteria 3668
173 Ga0207699_10021936 3300025906 Bacteria 3451
174 Ga0207699_10029336 3300025906 Bacteria 3067
175 Ga0207699_10038325 3300025906 Bacteria 2746
176 Ga0207699_10088770 3300025906 Bacteria 1936
177 Ga0207645_10067277 3300025907 Bacteria 2290
178 Ga0207705_10096845 3300025909 Bacteria 2166
179 Ga0207684_10003279 3300025910 Bacteria 15873
180 Ga0207684_10045484 3300025910 Bacteria 3723
181 Ga0207654_10096187 3300025911 Bacteria 1816
182 Ga0207654_10171412 3300025911 Bacteria 1409
183 Ga0207707_10496477 3300025912 Bacteria 1041
184 Ga0207695_10264265 3300025913 Bacteria 1618
185 Ga0207671_10000101 3300025914 Bacteria 130999
186 Ga0207671_10000733 3300025914 Bacteria 41619
187 Ga0207671_10221115 3300025914 Bacteria 1484
188 Ga0207693_10019725 3300025915 Bacteria 5361
189 Ga0207693_10056997 3300025915 Bacteria 3063
190 Ga0207663_10152786 3300025916 Bacteria 1621
191 Ga0207663_10254724 3300025916 Bacteria 1293
192 Ga0207663_10257492 3300025916 Bacteria 1287
193 Ga0207662_10005579 3300025918 Bacteria 6724
194 Ga0207657_10002573 3300025919 Bacteria 19626
195 Ga0207652_10091874 3300025921 Bacteria 2669
196 Ga0207646_10019647 3300025922 Bacteria 6273
197 Ga0207646_10178716 3300025922 Bacteria 1916
198 Ga0207646_10264177 3300025922 Bacteria 1555
199 Ga0207681_10235396 3300025923 Bacteria 1423
200 Ga0207694_10025797 3300025924 Bacteria 4468
201 Ga0207694_10105809 3300025924 Bacteria 2234
202 Ga0207687_10224919 3300025927 Bacteria 1480
203 Ga0207687_10285515 3300025927 Bacteria 1324
204 Ga0207700_10015163 3300025928 Bacteria 5071
205 Ga0207700_10018060 3300025928 Bacteria 4728
206 Ga0207700_10022960 3300025928 Bacteria 4289
207 Ga0207700_10065162 3300025928 Bacteria 2779
208 Ga0207700_10263662 3300025928 Bacteria 1476
209 Ga0207664_10000752 3300025929 Bacteria 22041
210 Ga0207664_10007114 3300025929 Bacteria 7755
211 Ga0207664_10013106 3300025929 Bacteria 5943
212 Ga0207664_10031605 3300025929 Bacteria 4051
213 Ga0207664_10036032 3300025929 Bacteria 3822
214 Ga0207706_10012225 3300025933 Bacteria 7822
215 Ga0207709_10037042 3300025935 Bacteria 2896
216 Ga0207709_10131800 3300025935 Bacteria 1705
217 Ga0207670_10027353 3300025936 Bacteria 3604
218 Ga0207665_10002850 3300025939 Bacteria 11611
219 Ga0207665_10033681 3300025939 Bacteria 3397
220 Ga0207691_10047746 3300025940 Bacteria 3928
221 Ga0207711_10115362 3300025941 Bacteria 2393
222 Ga0207689_10001334 3300025942 Bacteria 23807
223 Ga0207661_10402480 3300025944 Bacteria 1241
224 Ga0207679_10471258 3300025945 Bacteria 1116
225 Ga0207667_10581784 3300025949 Bacteria 1130
226 Ga0207712_10262755 3300025961 Bacteria 1401
227 Ga0207668_10064518 3300025972 Bacteria 2589
228 Ga0207640_10187529 3300025981 Bacteria 1556
229 Ga0207658_10137305 3300025986 Bacteria 1974
230 Ga0207677_10083603 3300026023 Bacteria 2298
231 Ga0207703_10439915 3300026035 Bacteria 1216
232 Ga0207639_10444328 3300026041 Bacteria 1176
233 Ga0207678_10014568 3300026067 Bacteria 6918
234 Ga0207708_10210789 3300026075 Bacteria 1553
235 Ga0207702_10031771 3300026078 Bacteria 4402
236 Ga0207702_10051230 3300026078 Bacteria 3488
237 Ga0207702_10068225 3300026078 Bacteria 3055
238 Ga0207702_10308695 3300026078 Bacteria 1503
239 Ga0207641_10388770 3300026088 Bacteria 1337
240 Ga0207648_10062773 3300026089 Bacteria 3238
241 Ga0207674_10002042 3300026116 Bacteria 25622
242 Ga0207675_100082270 3300026118 Bacteria 3019
243 Ga0207683_10011031 3300026121 Bacteria 7703
244 Ga0207698_10068803 3300026142 Bacteria 2797
245 Ga0207428_10077892 3300027907 Bacteria 2595
246 Ga0268266_10001847 3300028379 Bacteria 23894
247 Ga0268266_10062622 3300028379 Bacteria 3212
248 Ga0268266_10169728 3300028379 Bacteria 1979
249 Ga0268266_10679164 3300028379 Unclassified 992
250 Ga0268265_10118191 3300028380 Bacteria 2179
251 Ga0307515_10002303 3300028794 Bacteria 41725
252 Ga0307515_10132274 3300028794 Bacteria 2738
253 Ga0307511_10000041 3300030521 Bacteria 102249
254 Ga0307512_10002759 3300030522 Bacteria 21458
255 Ga0307512_10006379 3300030522 Bacteria 11954
256 Ga0307513_10003403 3300031456 Bacteria 21607
257 Ga0307513_10020028 3300031456 Bacteria 7943
258 Ga0307513_10066625 3300031456 Bacteria 3782
259 Ga0307513_10185370 3300031456 Bacteria 1939
260 Ga0307509_10026537 3300031507 Bacteria 6455
261 Ga0307408_100034010 3300031548 Bacteria 3566
262 Ga0307408_100165252 3300031548 Bacteria 1762
263 Ga0307408_100189540 3300031548 Bacteria 1656
264 Ga0307408_100346128 3300031548 Bacteria 1260
265 Ga0307508_10031236 3300031616 Bacteria 4814
266 Ga0307508_10146585 3300031616 Bacteria 1964
267 Ga0307516_10031814 3300031730 Bacteria 5317
268 Ga0307405_10003861 3300031731 Bacteria 6984
269 Ga0307405_10004508 3300031731 Bacteria 6592
270 Ga0307405_10211986 3300031731 Bacteria 1415
271 Ga0307413_10001131 3300031824 Bacteria 9779
272 Ga0307413_10062362 3300031824 Bacteria 2305
273 Ga0307518_10020579 3300031838 Bacteria 4741
274 Ga0307518_10032749 3300031838 Bacteria 3769
275 Ga0307410_10001562 3300031852 Bacteria 10460
276 Ga0307410_10028419 3300031852 Bacteria 3547
277 Ga0307410_10490435 3300031852 Bacteria 1009
278 Ga0307410_10494422 3300031852 Bacteria 1005
279 Ga0307406_10002686 3300031901 Bacteria 9690
280 Ga0307406_10012735 3300031901 Bacteria 4799
281 Ga0307406_10044607 3300031901 Bacteria 2780
282 Ga0307407_10003579 3300031903 Bacteria 6417
283 Ga0307407_10030795 3300031903 Bacteria 2898
284 Ga0307407_10070438 3300031903 Bacteria 2079
285 Ga0307412_10001277 3300031911 Bacteria 14105
286 Ga0307412_10114188 3300031911 Bacteria 1933
287 Ga0307412_10300012 3300031911 Bacteria 1269
288 Ga0307409_100000879 3300031995 Bacteria 13895
289 Ga0307409_100012280 3300031995 Bacteria 5451
290 Ga0307409_100022848 3300031995 Bacteria 4318
291 Ga0307409_100155803 3300031995 Bacteria 1990
292 Ga0307416_100074131 3300032002 Bacteria 2841
293 Ga0307416_100157850 3300032002 Bacteria 2091
294 Ga0307416_100198803 3300032002 Bacteria 1900
295 Ga0307416_100235692 3300032002 Bacteria 1768
296 Ga0307414_10002404 3300032004 Bacteria 9797
297 Ga0307414_10080014 3300032004 Bacteria 2388
298 Ga0307411_10000395 3300032005 Bacteria 14912
299 Ga0307411_10026842 3300032005 Bacteria 3473
300 Ga0307415_100026053 3300032126 Bacteria 3681
301 Ga0307415_100099092 3300032126 Bacteria 2132
302 Ga0307415_100261938 3300032126 Bacteria 1411
303 Ga0307415_100293803 3300032126 Bacteria 1343
304 Ga0307507_10005275 3300033179 Bacteria 21424
305 Ga0307507_10013188 3300033179 Bacteria 10077
306 Ga0307507_10014936 3300033179 Bacteria 9196
307 Ga0307507_10194528 3300033179 Bacteria 1418
308 Ga0307507_10225472 3300033179 Bacteria 1252
309 Ga0307510_10215572 3300033180 Bacteria 1437
310 Ga0373959_0019522 3300034820 Bacteria 1285
311 Ga0373928_0015308 3300035084 Bacteria 1560
312 Ga0373940_0013308 3300035088 Bacteria 1987
313 Ga0373944_0039932 3300035089 Bacteria 1447
314 Ga0373951_0013785 3300035091 Bacteria 1817
315 Ga0373923_0092851 3300035111 Unclassified 1322
316 Ga0373932_0004761 3300035112 Bacteria 3201
317 Ga0373936_0063350 3300035113 Bacteria 1514
318 Ga0373936_0176902 3300035113 Bacteria 935
319 Ga0373956_0050898 3300035119 Bacteria 1861
320 Ga0373946_0106561 3300035171 Unclassified 1263
321 Ga0373961_0003847 3300035241 Bacteria 3665
322 Ga0373962_0012636 3300035242 Bacteria 2131
323 Ga0373931_0012595 3300035691 Bacteria 4100
324 Ga0373935_0031545 3300035692 Bacteria 3290
325 Ga0373935_0241160 3300035692 Bacteria 1262
326 Ga0373947_0062382 3300035725 Bacteria 2268
327 Ga0373925_0013665 3300037068 Bacteria 5879
328 Ga0373925_0146467 3300037068 Bacteria 1851
329 Ga0373925_0350120 3300037068 Bacteria 1199
330 Ga0395900_0275499 3300037418 Bacteria 1676
331 Ga0395898_0015087 3300037466 Bacteria 7932
332 Ga0395898_0015796 3300037466 Bacteria 7737
333 Ga0395898_0041068 3300037466 Bacteria 4571
334 Ga0395905_0485273 3300037471 Bacteria 1135
335 Ga0436364_0239215 3300037853 Bacteria 66848
336 Ga0436364_0635330 3300037853 Bacteria 60935
337 Ga0436364_1499164 3300037853 Bacteria 1030
338 Ga0395901_0042320 3300038443 Bacteria 4722
339 Ga0395901_0202153 3300038443 Bacteria 2082
340 Ga0395901_0255291 3300038443 Bacteria 1826
341 Ga0395901_0508247 3300038443 Bacteria 1226
342 Ga0439438_018515 3300041405 Bacteria 1982
343 Ga0439465_0022788 3300041413 Bacteria 1968
344 Ga0451793_0083442 3300041452 Bacteria 3499
345 Ga0451793_0307109 3300041452 Bacteria 3502
346 Ga0451802_0040410 3300041460 Bacteria 1762
347 Ga0451806_003905 3300041462 Bacteria 1954
348 Ga0451806_688341 3300041462 Bacteria 1126
349 Ga0439433_0000256 3300041999 Bacteria 8968
350 Ga0439433_0003717 3300041999 Bacteria 3278
351 Ga0439442_000491 3300042002 Bacteria 8931
352 Ga0439442_002467 3300042002 Bacteria 3633
353 Ga0439442_003295 3300042002 Bacteria 3191
354 Ga0439449_0001260 3300042007 Bacteria 9915
355 Ga0439449_0013747 3300042007 Bacteria 3046
356 Ga0439462_0015073 3300042015 Bacteria 1989
357 Ga0450920_000102 3300042122 Bacteria 11247
358 Ga0450907_001224 3300042146 Bacteria 5797
359 Ga0439459_0018956 3300042438 Bacteria 1299
360 Ga0450918_000755 3300042531 Bacteria 6856
361 Ga0466969_0007587 3300044656 Bacteria 5765
362 Ga0466969_0045529 3300044656 Bacteria 2178
363 Ga0466972_0010023 3300044658 Bacteria 4758
364 Ga0466966_0001086 3300044684 Bacteria 17392
365 Ga0466961_0008551 3300044693 Bacteria 6522
366 Ga0466961_0123891 3300044693 Bacteria 1622
367 Ga0466963_0058545 3300044694 Bacteria 2569
368 Ga0466959_0021193 3300045049 Bacteria 4792
369 Ga0466967_0080754 3300045976 Bacteria 2935
370 Ga0466967_0124673 3300045976 Bacteria 2385
371 Ga0495592_0013589 3300046454 Bacteria 6194
372 Ga0495592_0057983 3300046454 Bacteria 2857
373 Ga0495603_0005091 3300046455 Bacteria 7854
374 Ga0495603_0005361 3300046455 Bacteria 7647
375 Ga0495603_0005532 3300046455 Bacteria 7539
376 Ga0495603_0282255 3300046455 Bacteria 954
377 Ga0495629_0000729 3300046459 Bacteria 26703
378 Ga0495629_0002297 3300046459 Bacteria 14747
379 Ga0495629_0008266 3300046459 Bacteria 7652
380 Ga0495629_0128687 3300046459 Bacteria 1764
381 Ga0495629_0195547 3300046459 Bacteria 1399
382 Ga0495651_0000401 3300046462 Bacteria 33487
383 Ga0495651_0009874 3300046462 Bacteria 7340
384 Ga0495651_0101268 3300046462 Bacteria 2144
385 Ga0495651_0363144 3300046462 Bacteria 954
386 Ga0495580_0052897 3300046472 Bacteria 2867
387 Ga0495662_0000999 3300046476 Bacteria 13845
388 Ga0495662_0020282 3300046476 Bacteria 3215
389 Ga0495664_0014358 3300046477 Bacteria 4489
390 Ga0495664_0032815 3300046477 Bacteria 3049
391 Ga0495585_0033648 3300046492 Bacteria 2901
392 Ga0495585_0037699 3300046492 Bacteria 2722
393 Ga0495594_0002830 3300046499 Bacteria 9020
394 Ga0495594_0004386 3300046499 Bacteria 7262
395 Ga0495594_0004443 3300046499 Bacteria 7209
396 Ga0495594_0069038 3300046499 Bacteria 1963
397 Ga0495607_0095408 3300046501 Bacteria 1603
398 Ga0495583_0014134 3300046506 Bacteria 4418
399 Ga0495618_0147481 3300046514 Bacteria 1504
400 Ga0495620_0048848 3300046515 Bacteria 1814
401 Ga0495628_0020841 3300046516 Bacteria 5401
402 Ga0495628_0156478 3300046516 Bacteria 1733
403 Ga0495632_0065050 3300046519 Bacteria 1762
404 Ga0495632_0163326 3300046519 Bacteria 1025
405 Ga0495666_0000483 3300046526 Bacteria 17719
406 Ga0495652_0001086 3300046529 Bacteria 30784
407 Ga0495652_0020270 3300046529 Bacteria 5911
408 Ga0495665_0162971 3300046531 Unclassified 1162
409 Ga0495640_0008418 3300046533 Bacteria 8091
410 Ga0495640_0118548 3300046533 Bacteria 1722
411 Ga0495586_0177339 3300046535 Bacteria 1205
412 Ga0495586_0239644 3300046535 Bacteria 1034
413 Ga0495587_0010945 3300046536 Bacteria 5754
414 Ga0495645_0026049 3300046543 Bacteria 4244
415 Ga0495622_0040202 3300046557 Bacteria 2177
416 Ga0495667_0169788 3300046559 Bacteria 1402
417 Ga0495634_0011459 3300046642 Bacteria 6450
418 Ga0495634_0012013 3300046642 Bacteria 6277
419 Ga0495634_0078364 3300046642 Bacteria 2165
420 Ga0495634_0293422 3300046642 Bacteria 985
421 Ga0495625_0020588 3300046660 Bacteria 5089
422 Ga0495635_0001548 3300046663 Bacteria 15426
423 Ga0495588_0015593 3300046674 Bacteria 3662
424 Ga0495588_0029166 3300046674 Bacteria 2766
425 Ga0495588_0121476 3300046674 Bacteria 1377
426 Ga0495657_0003978 3300046675 Bacteria 11858
427 Ga0495657_0005184 3300046675 Bacteria 10320
428 Ga0495657_0035808 3300046675 Bacteria 3437
429 Ga0495623_0042992 3300046679 Bacteria 2876
430 Ga0495646_0011114 3300046680 Bacteria 5716
431 Ga0495658_0034035 3300046683 Bacteria 2794
432 Ga0495613_0001371 3300046689 Bacteria 18559
433 Ga0495613_0001714 3300046689 Bacteria 16694
434 Ga0495613_0014649 3300046689 Bacteria 5818
435 Ga0495613_0017061 3300046689 Bacteria 5406
436 Ga0495613_0130248 3300046689 Bacteria 1801
437 Ga0495624_0011159 3300046690 Bacteria 6180
438 Ga0495624_0091337 3300046690 Bacteria 1878
439 Ga0495624_0107392 3300046690 Bacteria 1717
440 Ga0495671_0003906 3300046692 Bacteria 9041
441 Ga0495649_0058287 3300046694 Bacteria 2081
442 Ga0495589_0029792 3300046794 Bacteria 2752
443 Ga0495589_0035509 3300046794 Bacteria 2499
444 Ga0495589_0094901 3300046794 Bacteria 1447
445 Ga0495589_0193045 3300046794 Bacteria 963
446 Ga0495600_0009833 3300046809 Bacteria 5915
447 Ga0495600_0021770 3300046809 Bacteria 4110
448 Ga0495660_0056254 3300046810 Bacteria 2126
449 Ga0495581_0013326 3300047315 Bacteria 4766
450 Ga0495604_0001279 3300047317 Bacteria 20576
451 Ga0495604_0070044 3300047317 Bacteria 2657
452 Ga0495604_0077232 3300047317 Bacteria 2503
453 Ga0495604_0101502 3300047317 Bacteria 2113
454 Ga0495636_0002859 3300047318 Bacteria 6667
455 Ga0495676_0000768 3300047321 Bacteria 26771
456 Ga0495676_0002861 3300047321 Bacteria 15565
457 Ga0495676_0008081 3300047321 Bacteria 9654
458 Ga0495676_0015474 3300047321 Bacteria 6791
459 Ga0495676_0016072 3300047321 Bacteria 6648
460 Ga0495676_0086262 3300047321 Bacteria 2363
461 Ga0495676_0104192 3300047321 Bacteria 2094
462 Ga0495676_0127683 3300047321 Bacteria 1840
463 Ga0495680_0098171 3300047322 Bacteria 2186
464 Ga0495683_0044202 3300047323 Bacteria 2240
465 Ga0495687_001374 3300047443 Bacteria 22503
466 Ga0495687_001499 3300047443 Bacteria 21279
467 Ga0495687_006343 3300047443 Bacteria 7275
468 Ga0495687_040252 3300047443 Bacteria 2060
469 Ga0495685_005346 3300047447 Bacteria 4190
470 Ga0495685_016313 3300047447 Bacteria 2536
471 Ga0495685_042691 3300047447 Bacteria 1547
472 Ga0495681_0003896 3300047470 Bacteria 10288
473 Ga0495684_0071468 3300047471 Bacteria 2637
474 Ga0495593_0012775 3300047673 Bacteria 4794
475 Ga0495593_0044498 3300047673 Bacteria 2374
476 Ga0495593_0047388 3300047673 Bacteria 2287
477 Ga0495602_0048532 3300048088 Bacteria 3814
478 Ga0495602_0379304 3300048088 Bacteria 1013
479 Ga0495614_0012512 3300048089 Bacteria 3722
480 Ga0495614_0017647 3300048089 Bacteria 3099
481 Ga0495614_0041597 3300048089 Bacteria 1971
482 Ga0496100_0010393 3300048903 Bacteria 5265
483 Ga0496100_0071790 3300048903 Bacteria 2312
484 Ga0496100_0257335 3300048903 Bacteria 1293
485 Ga0496101_0001632 3300048904 Bacteria 13484
486 Ga0496101_0123138 3300048904 Bacteria 1962
487 Ga0496102_0003313 3300048905 Bacteria 13652
488 Ga0496102_0065896 3300048905 Bacteria 3320
489 Ga0496102_0322420 3300048905 Bacteria 1455
490 Ga0496103_0060816 3300048906 Bacteria 2348
491 Ga0496103_0088897 3300048906 Bacteria 1948
492 Ga0496104_0003036 3300048907 Bacteria 14460
493 Ga0496104_0014954 3300048907 Bacteria 7018
494 Ga0496104_0034918 3300048907 Bacteria 4691
495 Ga0496105_0001860 3300048908 Bacteria 15128
496 Ga0496105_0024147 3300048908 Bacteria 4937
497 Ga0496106_0021050 3300048909 Bacteria 4841
498 Ga0496106_0232019 3300048909 Bacteria 1474
499 Ga0496106_0368276 3300048909 Bacteria 1154
500 Ga0496107_0014898 3300048910 Bacteria 5444
501 Ga0496107_0032620 3300048910 Bacteria 3722
502 Ga0496107_0065364 3300048910 Bacteria 2637
503 Ga0496108_0024195 3300048911 Bacteria 5000
504 Ga0496108_0092030 3300048911 Bacteria 2578
505 Ga0496108_0343848 3300048911 Bacteria 1301
506 Ga0496109_0041126 3300048912 Bacteria 4188
507 Ga0496109_0073174 3300048912 Bacteria 3149
508 Ga0496110_0046070 3300048913 Bacteria 3814
509 Ga0496110_0512363 3300048913 Bacteria 1092
510 Ga0496111_0008973 3300048914 Bacteria 6651
511 Ga0496112_0002994 3300048915 Bacteria 13799
512 Ga0496112_0151514 3300048915 Bacteria 2286
513 Ga0496112_0205411 3300048915 Bacteria 1928
514 Ga0496112_0266024 3300048915 Bacteria 1663
515 Ga0496113_0033289 3300048916 Bacteria 3752
516 Ga0496113_0109338 3300048916 Bacteria 2149
517 Ga0496114_0000788 3300048917 Bacteria 23678
518 Ga0496115_0002562 3300048918 Bacteria 13057
519 Ga0496115_0005797 3300048918 Bacteria 8994
520 Ga0496115_0010552 3300048918 Bacteria 6908
521 Ga0496117_0005393 3300048920 Bacteria 13463
522 Ga0496118_0009413 3300048921 Bacteria 9867
523 Ga0496119_0047603 3300048922 Bacteria 2666
524 Ga0496120_0087974 3300048923 Bacteria 1666
525 Ga0496124_0000234 3300048927 Bacteria 108472
526 Ga0496126_0009248 3300048929 Bacteria 10503
527 Ga0496126_0107970 3300048929 Bacteria 2427
528 Ga0496126_0338041 3300048929 Bacteria 1234
529 Ga0501033_0001492 3300049570 Bacteria 20722
530 Ga0501034_0011855 3300049571 Bacteria 9024
531 Ga0501036_0000277 3300049572 Bacteria 35238
532 Ga0501036_0013005 3300049572 Bacteria 6910
533 Ga0501038_0048435 3300049574 Bacteria 3678
534 Ga0501039_0326777 3300049575 Bacteria 1205
535 Ga0501043_0001903 3300049579 Bacteria 17889
536 Ga0501043_0037804 3300049579 Bacteria 3797
537 Ga0501070_0006784 3300049586 Bacteria 9742
538 Ga0501074_0000276 3300049590 Bacteria 29509
539 Ga0501235_007660 3300049669 Bacteria 2354
540 Ga0501035_0002082 3300049822 Bacteria 19908
541 nmdc:mga0n895_428722_c1 3300050512 Bacteria 1336
542 nmdc:mga0n895_47041_c1 3300050512 Bacteria 4217
543 nmdc:mga0rr50_404435_c1 3300050513 Bacteria 1153
544 nmdc:mga0a205_84985_c1 3300050515 Bacteria 3056
545 Ga0495619_0246945 3300053085 Bacteria 1237
546 Ga0500644_0002973 3300053088 Bacteria 4206
547 Ga0500640_046489 3300053095 Bacteria 1902
548 Ga0500641_0109742 3300053096 Bacteria 1187
549 Ga0500650_0200721 3300053098 Bacteria 908
550 Ga0500652_017772 3300053131 Bacteria 2612
551 Ga0500561_0107971 3300053137 Bacteria 840
552 Ga0500573_0000842 3300053140 Bacteria 13888
553 Ga0500573_0163269 3300053140 Bacteria 1211
554 Ga0500579_055787 3300053143 Bacteria 2383
555 Ga0500600_0057158 3300053149 Bacteria 2189
556 Ga0500633_0091272 3300053160 Bacteria 1113
557 Ga0587067_002113 3300059640 Bacteria 2295
558 Ga0466962_0061011 3300061719 Bacteria 1800
559 2547408669 2547132111 Bacteria 8013147
560 2559422859 2558860280 Bacteria 11429938
561 2585319847 2582581314 Bacteria 11452267
562 2616696271 2616644814 Bacteria 11555299
563 2616703456 2616644814 Bacteria 11555299
564 2643761752 2643221548 Bacteria 8053412
565 2644460820 2643221682 Bacteria 6743283
566 2753300980 2751185788 Bacteria 4541048
567 2784586311 2784132148 Bacteria 8627943
568 2808893679 2808606370 Bacteria 4942454
569 2809229810 2808606448 Bacteria 8656184
570 2812483200 2811994917 Bacteria 7761064
571 2816508810 2816332139 Bacteria 9138787
572 2819697488 2818991463 Bacteria 7948711
573 2857731064 2857729791 Bacteria 4040535
574 2857742346 2857740372 Bacteria 4782044
575 2862994793 2862993130 Bacteria 3860849
576 2868089449 2868088558 Bacteria 7609351
577 2887444686 2887443736 Bacteria 4426037
578 2904500600 2904497146 Bacteria 4731781
579 2904777719 2904776348 Bacteria 4658726
580 2906801297 2906799679 Bacteria 4031749
581 2912727473 2912723979 Bacteria 8557534
582 2919059243 2919059106 Bacteria 4991624
583 2919541151 2919538618 Bacteria 4677069
584 2928106463 2928104781 Bacteria 3877447
585 2928122377 2928121344 Bacteria 3972376
586 2933420939 2933418574 Bacteria 4476724
587 2939650479 2939647034 Bacteria 4681660
588 2945941442 2945941187 Bacteria 4682474
589 2947232960 2947224130 Bacteria 9938529
590 2954008489 2954002825 Bacteria 9173742
591 2964327770 2964326757 Bacteria 3290868
592 2966600192 2966598605 Bacteria 7676064
593 2995463820 2995463766 Bacteria 8577691
594 3006494642 3006493962 Bacteria 8825450
595 8008575315 8008574985 Bacteria 7815457
596 8008575640 8008574985 Bacteria 7815457
597 8023630665 8023623736 Bacteria 8593882
598 8047713942 8047710418 Bacteria 11023148
599 8054109533 8054107350 Bacteria 5022511
600 8054162370 8054160619 Bacteria 7783213
601 8056060349 8056060235 Bacteria 7259403
602 Ga0495580_0004905
603 JGI24739J22299_10021153
604 JGI24748J21848_1012473
605 JGI25152J39213_1000095
606 JGI25406J46586_10002625
607 rootH2_10051450
608 rootL2_10237258
609 Ga0070658_10059668
610 Ga0070658_10319210
611 Ga0070676_10094451
612 Ga0070683_100041638
613 Ga0070690_100056164
614 Ga0068869_100027386
615 Ga0070682_100221311
616 Ga0068868_100278493
617 Ga0070660_100103359
618 Ga0070687_100208212
619 Ga0070661_100020925
620 Ga0070692_10035795
621 Ga0070668_100024871
622 Ga0070669_100088882
623 Ga0070675_100062755
624 Ga0070671_100050665
625 Ga0070674_100182525
626 Ga0070673_100110137
627 Ga0070673_100229619
628 Ga0070688_100043034
629 Ga0070659_100014189
630 Ga0070703_10010387
631 Ga0070709_10012270
632 Ga0070709_10075674
633 Ga0070709_10103627
634 Ga0070709_10226203
635 Ga0070709_10297728
636 Ga0070714_100002910
637 Ga0070714_100004514
638 Ga0070714_100245372
639 Ga0070714_100328168
640 Ga0070714_100443410
641 Ga0070713_100017976
642 Ga0070713_100144465
643 Ga0070713_100174414
644 Ga0070710_10068296
645 Ga0070710_10205628
646 Ga0070710_10231665
647 Ga0070711_100019009
648 Ga0070711_100045418
649 Ga0070705_100096053
650 Ga0070700_100069339
651 Ga0070694_100182387
652 Ga0070708_100012775
653 Ga0070708_100450963
654 Ga0070663_100004385
655 Ga0070678_100013320
656 Ga0070681_10179709
657 Ga0068867_100139952
658 Ga0070685_10084513
659 Ga0070706_100001932
660 Ga0070706_100407604
661 Ga0070707_100049426
662 Ga0070707_100314794
663 Ga0070699_100005235
664 Ga0070679_100260437
665 Ga0070684_100274956
666 Ga0070697_100001458
667 Ga0068853_100015092
668 Ga0070672_100020195
669 Ga0070686_100029101
670 Ga0070695_100092876
671 Ga0070696_100118182
672 Ga0070693_100169664
673 Ga0070665_100023984
674 Ga0070665_100191654
675 Ga0070704_100017245
676 Ga0068855_100233794
677 Ga0070664_100004731
678 Ga0070664_100465010
679 Ga0068857_100021269
680 Ga0068854_100235116
681 Ga0068856_100040174
682 Ga0068856_100162810
683 Ga0068856_100835198
684 Ga0070702_100058693
685 Ga0068852_100798938
686 Ga0068859_100041605
687 Ga0068864_100128161
688 Ga0068861_100112906
689 Ga0068851_10065019
690 Ga0068870_10050522
691 Ga0068863_100027297
692 Ga0068862_100246677
693 Ga0081539_10001965
694 Ga0070717_10020002
695 Ga0070717_10027725
696 Ga0070717_10046707
697 Ga0070717_10047896
698 Ga0075432_10003992
699 Ga0070715_10004053
700 Ga0070715_10015635
701 Ga0070716_100001905
702 Ga0070712_100009049
703 Ga0070712_100202480
704 Ga0070712_100308334
705 Ga0068871_100217173
706 Ga0075434_100165490
707 Ga0075434_100228355
708 Ga0068865_100035525
709 Ga0075436_100116731
710 Ga0097620_100041610
711 Ga0099795_10116135
712 Ga0105251_10040117
713 Ga0105244_10012358
714 Ga0105244_10091140
715 Ga0105244_10133015
716 Ga0105240_10040646
717 Ga0105240_10069993
718 Ga0105245_10177129
719 Ga0105245_10433505
720 Ga0105247_10237078
721 Ga0105243_10004167
722 Ga0105243_10031695
723 Ga0105241_10018793
724 Ga0105241_10114588
725 Ga0105242_10038612
726 Ga0105242_10747303
727 Ga0105237_10000174
728 Ga0105237_10001307
729 Ga0105238_10015722
730 Ga0105238_10261075
731 Ga0105249_10088188
732 Ga0105239_10001557
733 Ga0105246_10003722
734 Ga0105246_10012370
735 Ga0105246_10083779
736 Ga0105246_10094933
737 Ga0157373_10019625
738 Ga0157371_10005287
739 Ga0157371_10061921
740 Ga0157370_10011249
741 Ga0157370_10147172
742 Ga0157369_10017546
743 Ga0157369_10757126
744 Ga0157374_10007271
745 Ga0157374_10799284
746 Ga0157378_10063114
747 Ga0157378_10440128
748 Ga0163163_10124453
749 Ga0157377_10011527
750 Ga0157376_10324094
751 Ga0163161_10057952
752 Ga0197907_10720153
753 Ga0206356_11279835
754 Ga0206350_11546322
755 Ga0206353_10015909
756 Ga0213875_10000239
757 Ga0213875_10002504
758 Ga0209129_1000060
759 Ga0209025_1000308
760 Ga0209051_1007288
761 Ga0207697_10011369
762 Ga0207655_1036035
763 Ga0207653_10006682
764 Ga0207692_10023771
765 Ga0207692_10028185
766 Ga0207692_10036132
767 Ga0207642_10034248
768 Ga0207710_10188950
769 Ga0207688_10007308
770 Ga0207680_10136044
771 Ga0207647_10038187
772 Ga0207699_10007182
773 Ga0207699_10018818
774 Ga0207699_10021936
775 Ga0207699_10029336
776 Ga0207699_10038325
777 Ga0207699_10088770
778 Ga0207645_10067277
779 Ga0207705_10096845
780 Ga0207684_10003279
781 Ga0207684_10045484
782 Ga0207654_10096187
783 Ga0207654_10171412
784 Ga0207707_10496477
785 Ga0207695_10264265
786 Ga0207671_10000101
787 Ga0207671_10000733
788 Ga0207671_10221115
789 Ga0207693_10019725
790 Ga0207693_10056997
791 Ga0207663_10152786
792 Ga0207663_10254724
793 Ga0207663_10257492
794 Ga0207662_10005579
795 Ga0207657_10002573
796 Ga0207652_10091874
797 Ga0207646_10019647
798 Ga0207646_10178716
799 Ga0207646_10264177
800 Ga0207681_10235396
801 Ga0207694_10025797
802 Ga0207694_10105809
803 Ga0207687_10224919
804 Ga0207687_10285515
805 Ga0207700_10015163
806 Ga0207700_10018060
807 Ga0207700_10022960
808 Ga0207700_10065162
809 Ga0207700_10263662
810 Ga0207664_10000752
811 Ga0207664_10007114
812 Ga0207664_10013106
813 Ga0207664_10031605
814 Ga0207664_10036032
815 Ga0207706_10012225
816 Ga0207709_10037042
817 Ga0207709_10131800
818 Ga0207670_10027353
819 Ga0207665_10002850
820 Ga0207665_10033681
821 Ga0207691_10047746
822 Ga0207711_10115362
823 Ga0207689_10001334
824 Ga0207661_10402480
825 Ga0207679_10471258
826 Ga0207667_10581784
827 Ga0207712_10262755
828 Ga0207668_10064518
829 Ga0207640_10187529
830 Ga0207658_10137305
831 Ga0207677_10083603
832 Ga0207703_10439915
833 Ga0207639_10444328
834 Ga0207678_10014568
835 Ga0207708_10210789
836 Ga0207702_10031771
837 Ga0207702_10051230
838 Ga0207702_10068225
839 Ga0207702_10308695
840 Ga0207641_10388770
841 Ga0207648_10062773
842 Ga0207674_10002042
843 Ga0207675_100082270
844 Ga0207683_10011031
845 Ga0207698_10068803
846 Ga0207428_10077892
847 Ga0268266_10001847
848 Ga0268266_10062622
849 Ga0268266_10169728
850 Ga0268266_10679164
851 Ga0268265_10118191
852 Ga0307515_10002303
853 Ga0307515_10132274
854 Ga0307511_10000041
855 Ga0307512_10002759
856 Ga0307512_10006379
857 Ga0307513_10003403
858 Ga0307513_10020028
859 Ga0307513_10066625
860 Ga0307513_10185370
861 Ga0307509_10026537
862 Ga0307408_100034010
863 Ga0307408_100165252
864 Ga0307408_100189540
865 Ga0307408_100346128
866 Ga0307508_10031236
867 Ga0307508_10146585
868 Ga0307516_10031814
869 Ga0307405_10003861
870 Ga0307405_10004508
871 Ga0307405_10211986
872 Ga0307413_10001131
873 Ga0307413_10062362
874 Ga0307518_10020579
875 Ga0307518_10032749
876 Ga0307410_10001562
877 Ga0307410_10028419
878 Ga0307410_10490435
879 Ga0307410_10494422
880 Ga0307406_10002686
881 Ga0307406_10012735
882 Ga0307406_10044607
883 Ga0307407_10003579
884 Ga0307407_10030795
885 Ga0307407_10070438
886 Ga0307412_10001277
887 Ga0307412_10114188
888 Ga0307412_10300012
889 Ga0307409_100000879
890 Ga0307409_100012280
891 Ga0307409_100022848
892 Ga0307409_100155803
893 Ga0307416_100074131
894 Ga0307416_100157850
895 Ga0307416_100198803
896 Ga0307416_100235692
897 Ga0307414_10002404
898 Ga0307414_10080014
899 Ga0307411_10000395
900 Ga0307411_10026842
901 Ga0307415_100026053
902 Ga0307415_100099092
903 Ga0307415_100261938
904 Ga0307415_100293803
905 Ga0307507_10005275
906 Ga0307507_10013188
907 Ga0307507_10014936
908 Ga0307507_10194528
909 Ga0307507_10225472
910 Ga0307510_10215572
911 Ga0373959_0019522
912 Ga0373928_0015308
913 Ga0373940_0013308
914 Ga0373944_0039932
915 Ga0373951_0013785
916 Ga0373923_0092851
917 Ga0373932_0004761
918 Ga0373936_0063350
919 Ga0373936_0176902
920 Ga0373956_0050898
921 Ga0373946_0106561
922 Ga0373961_0003847
923 Ga0373962_0012636
924 Ga0373931_0012595
925 Ga0373935_0031545
926 Ga0373935_0241160
927 Ga0373947_0062382
928 Ga0373925_0013665
929 Ga0373925_0146467
930 Ga0373925_0350120
931 Ga0395900_0275499
932 Ga0395898_0015087
933 Ga0395898_0015796
934 Ga0395898_0041068
935 Ga0395905_0485273
936 Ga0436364_0239215
937 Ga0436364_0635330
938 Ga0436364_1499164
939 Ga0395901_0042320
940 Ga0395901_0202153
941 Ga0395901_0255291
942 Ga0395901_0508247
943 Ga0439438_018515
944 Ga0439465_0022788
945 Ga0451793_0083442
946 Ga0451793_0307109
947 Ga0451802_0040410
948 Ga0451806_003905
949 Ga0451806_688341
950 Ga0439433_0000256
951 Ga0439433_0003717
952 Ga0439442_000491
953 Ga0439442_002467
954 Ga0439442_003295
955 Ga0439449_0001260
956 Ga0439449_0013747
957 Ga0439462_0015073
958 Ga0450920_000102
959 Ga0450907_001224
960 Ga0439459_0018956
961 Ga0450918_000755
962 Ga0466969_0007587
963 Ga0466969_0045529
964 Ga0466972_0010023
965 Ga0466966_0001086
966 Ga0466961_0008551
967 Ga0466961_0123891
968 Ga0466963_0058545
969 Ga0466959_0021193
970 Ga0466967_0080754
971 Ga0466967_0124673
972 Ga0495592_0013589
973 Ga0495592_0057983
974 Ga0495603_0005091
975 Ga0495603_0005361
976 Ga0495603_0005532
977 Ga0495603_0282255
978 Ga0495629_0000729
979 Ga0495629_0002297
980 Ga0495629_0008266
981 Ga0495629_0128687
982 Ga0495629_0195547
983 Ga0495651_0000401
984 Ga0495651_0009874
985 Ga0495651_0101268
986 Ga0495651_0363144
987 Ga0495580_0052897
988 Ga0495662_0000999
989 Ga0495662_0020282
990 Ga0495664_0014358
991 Ga0495664_0032815
992 Ga0495585_0033648
993 Ga0495585_0037699
994 Ga0495594_0002830
995 Ga0495594_0004386
996 Ga0495594_0004443
997 Ga0495594_0069038
998 Ga0495607_0095408
999 Ga0495583_0014134
1000 Ga0495618_0147481
1001 Ga0495620_0048848
1002 Ga0495628_0020841
1003 Ga0495628_0156478
1004 Ga0495632_0065050
1005 Ga0495632_0163326
1006 Ga0495666_0000483
1007 Ga0495652_0001086
1008 Ga0495652_0020270
1009 Ga0495665_0162971
1010 Ga0495640_0008418
1011 Ga0495640_0118548
1012 Ga0495586_0177339
1013 Ga0495586_0239644
1014 Ga0495587_0010945
1015 Ga0495645_0026049
1016 Ga0495622_0040202
1017 Ga0495667_0169788
1018 Ga0495634_0011459
1019 Ga0495634_0012013
1020 Ga0495634_0078364
1021 Ga0495634_0293422
1022 Ga0495625_0020588
1023 Ga0495635_0001548
1024 Ga0495588_0015593
1025 Ga0495588_0029166
1026 Ga0495588_0121476
1027 Ga0495657_0003978
1028 Ga0495657_0005184
1029 Ga0495657_0035808
1030 Ga0495623_0042992
1031 Ga0495646_0011114
1032 Ga0495658_0034035
1033 Ga0495613_0001371
1034 Ga0495613_0001714
1035 Ga0495613_0014649
1036 Ga0495613_0017061
1037 Ga0495613_0130248
1038 Ga0495624_0011159
1039 Ga0495624_0091337
1040 Ga0495624_0107392
1041 Ga0495671_0003906
1042 Ga0495649_0058287
1043 Ga0495589_0029792
1044 Ga0495589_0035509
1045 Ga0495589_0094901
1046 Ga0495589_0193045
1047 Ga0495600_0009833
1048 Ga0495600_0021770
1049 Ga0495660_0056254
1050 Ga0495581_0013326
1051 Ga0495604_0001279
1052 Ga0495604_0070044
1053 Ga0495604_0077232
1054 Ga0495604_0101502
1055 Ga0495636_0002859
1056 Ga0495676_0000768
1057 Ga0495676_0002861
1058 Ga0495676_0008081
1059 Ga0495676_0015474
1060 Ga0495676_0016072
1061 Ga0495676_0086262
1062 Ga0495676_0104192
1063 Ga0495676_0127683
1064 Ga0495680_0098171
1065 Ga0495683_0044202
1066 Ga0495687_001374
1067 Ga0495687_001499
1068 Ga0495687_006343
1069 Ga0495687_040252
1070 Ga0495685_005346
1071 Ga0495685_016313
1072 Ga0495685_042691
1073 Ga0495681_0003896
1074 Ga0495684_0071468
1075 Ga0495593_0012775
1076 Ga0495593_0044498
1077 Ga0495593_0047388
1078 Ga0495602_0048532
1079 Ga0495602_0379304
1080 Ga0495614_0012512
1081 Ga0495614_0017647
1082 Ga0495614_0041597
1083 Ga0496100_0010393
1084 Ga0496100_0071790
1085 Ga0496100_0257335
1086 Ga0496101_0001632
1087 Ga0496101_0123138
1088 Ga0496102_0003313
1089 Ga0496102_0065896
1090 Ga0496102_0322420
1091 Ga0496103_0060816
1092 Ga0496103_0088897
1093 Ga0496104_0003036
1094 Ga0496104_0014954
1095 Ga0496104_0034918
1096 Ga0496105_0001860
1097 Ga0496105_0024147
1098 Ga0496106_0021050
1099 Ga0496106_0232019
1100 Ga0496106_0368276
1101 Ga0496107_0014898
1102 Ga0496107_0032620
1103 Ga0496107_0065364
1104 Ga0496108_0024195
1105 Ga0496108_0092030
1106 Ga0496108_0343848
1107 Ga0496109_0041126
1108 Ga0496109_0073174
1109 Ga0496110_0046070
1110 Ga0496110_0512363
1111 Ga0496111_0008973
1112 Ga0496112_0002994
1113 Ga0496112_0151514
1114 Ga0496112_0205411
1115 Ga0496112_0266024
1116 Ga0496113_0033289
1117 Ga0496113_0109338
1118 Ga0496114_0000788
1119 Ga0496115_0002562
1120 Ga0496115_0005797
1121 Ga0496115_0010552
1122 Ga0496117_0005393
1123 Ga0496118_0009413
1124 Ga0496119_0047603
1125 Ga0496120_0087974
1126 Ga0496124_0000234
1127 Ga0496126_0009248
1128 Ga0496126_0107970
1129 Ga0496126_0338041
1130 Ga0501033_0001492
1131 Ga0501034_0011855
1132 Ga0501036_0000277
1133 Ga0501036_0013005
1134 Ga0501038_0048435
1135 Ga0501039_0326777
1136 Ga0501043_0001903
1137 Ga0501043_0037804
1138 Ga0501070_0006784
1139 Ga0501074_0000276
1140 Ga0501235_007660
1141 Ga0501035_0002082
1142 nmdc:mga0n895_428722_c1
1143 nmdc:mga0n895_47041_c1
1144 nmdc:mga0rr50_404435_c1
1145 nmdc:mga0a205_84985_c1
1146 Ga0495619_0246945
1147 Ga0500644_0002973
1148 Ga0500640_046489
1149 Ga0500641_0109742
1150 Ga0500650_0200721
1151 Ga0500652_017772
1152 Ga0500561_0107971
1153 Ga0500573_0000842
1154 Ga0500573_0163269
1155 Ga0500579_055787
1156 Ga0500600_0057158
1157 Ga0500633_0091272
1158 Ga0587067_002113
1159 Ga0466962_0061011
1160 2547408669
1161 2559422859
1162 2585319847
1163 2616696271
1164 2616703456
1165 2643761752
1166 2644460820
1167 2753300980
1168 2784586311
1169 2808893679
1170 2809229810
1171 2812483200
1172 2816508810
1173 2819697488
1174 2857731064
1175 2857742346
1176 2862994793
1177 2868089449
1178 2887444686
1179 2904500600
1180 2904777719
1181 2906801297
1182 2912727473
1183 2919059243
1184 2919541151
1185 2928106463
1186 2928122377
1187 2933420939
1188 2939650479
1189 2945941442
1190 2947232960
1191 2954008489
1192 2964327770
1193 2966600192
1194 2995463820
1195 3006494642
1196 8008575315
1197 8008575640
1198 8023630665
1199 8047713942
1200 8054109533
1201 8054162370
1202 8056060349

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

108

299

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8884 3 256
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.8749 2 267
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.8689 2 267
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.8525 2 259
8ja7-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8494 2 265
ID Description Score Start End Superfamily
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.929 3 255 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9129 4 258 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8984 3 255 1.10.3720.10
af_Q2G1E7_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8971 3 255 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8899 4 258 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A5P9YV24-F1-model_v4 deleted 0.9704 3 267
AF-A0A7X0L5C9-F1-model_v4 Multiple sugar transport system permease protein 0.9699 2 267 GO:0005886
GO:0055085
AF-A0A3N1HUF7-F1-model_v4 Multiple sugar transport system permease protein 0.9683 2 267 GO:0005886
GO:0055085
AF-A0A7X6I0M4-F1-model_v4 Carbohydrate ABC transporter permease 0.9677 19 267 GO:0005886
GO:0055085
AF-A0A1C9WMM0-F1-model_v4 ABC transporter permease 0.9645 4 267 GO:0005886
GO:0055085

Map