F468076

General Info

Members Datasets Scaffolds Average Seq Length
601 276 570 529

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0000062|Ga0395899_0000062_103310_105136
Length 608
Sequence MVDTSRRNAFKLLAAGAAAAPFALKAMPSNACTEKPPAWAHGPESQRKADLGNGTYLNPIVAGDHPDPTILKDGSDYYMTFTSFDAYPGIVIWHSTDLLNWSPIAAALSKPIGTVFAVDLCKHNGRYFIYIPAAPQGQPWSIYVIWADDIHGPWSDPIDLKIPGCIDPGHVVGEDGKRYLFVNGIRKIRLADNGLATDGALEPAYSPWRYPDDWVVEDFAPEGPKLLRHGEWFYLITAVGGTAGPPTSHMVIAARSKSIHGPWEHCPHNPLVRTTSAAEPWWSRGHASLVEGPAGDWWMVYHGYENGFRTLGRQTLLEPIEWTADGWFRAKGGDLSRPLPAPKDGKRSASGFALSDDFTRNKFGVQWSLFQPAPGDMQRVQHEKGALLLAAKGQSPADSSPLTCLVGDRSYVAEVTLDLLDDAEGGVLLFYNHKAFVGVGFTPQHMKTFEYADELAWMQQAMPTSSVRIRLTNDNNVVTWHYSHDGGKTWVLHGLRMEVSGMHHNVFGGFLSLKVGIYSANKGSIRIRDFTYRAISYRRLGCKPQHRHLEADHDVGVCTPTYAFCISPNSWPIPTVCWTTLALLTSRIKPYLFTSSSTPDKSWIEECK

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
4 2643221556 Massilia sp. Root1485 Isolate Unclassified
5 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
6 2643221584 Caulobacter sp. Root656 Isolate Unclassified
7 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
8 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
9 2643221684 Massilia sp. Root133 Isolate Unclassified
10 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
11 2738541297 Duganella sp. GV083 Isolate Unclassified
12 2738541337 Pelomonas sp. BT06 Isolate Unclassified
13 2738541357 Duganella sp. GV053 Isolate Unclassified
14 2738543003 Duganella sp. GV066 Isolate Unclassified
15 2738543026 Duganella sp. GV089 Isolate Unclassified
16 2738543029 Duganella sp. GV039 Isolate Unclassified
17 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
18 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
19 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
20 2849560528 Caulobacter zeae 410 Isolate Unclassified
21 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
22 2851153111 Caulobacter radicis 736 Isolate Unclassified
23 2857553236 Duganella sp. R-74557 Isolate Unclassified
24 2857564685 Duganella sp. R-74599 Isolate Unclassified
25 2884411467 Dyella sp. AD56 Isolate Rhizosphere
26 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
27 2904424332 Duganella sp. 1411 Isolate Rhizosphere
28 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
29 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
30 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
31 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
32 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
33 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
34 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
35 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
36 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
37 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
38 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
39 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
40 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
41 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
42 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
43 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
44 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
45 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
46 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
47 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
48 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
49 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
50 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
51 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
52 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
53 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
54 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
55 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
56 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
57 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
58 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
59 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
60 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
61 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
62 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
63 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
64 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
69 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
111 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
112 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
167 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
168 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
169 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
170 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
171 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
172 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
190 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
191 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
199 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
203 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
204 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
205 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
206 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
207 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
226 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
227 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
228 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
229 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
230 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
231 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
232 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
233 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
234 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
237 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
249 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
257 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
258 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
261 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
262 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
263 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
266 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
267 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
268 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
269 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
270 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
271 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
272 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
273 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
274 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
275 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
276 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.84
Metatranscriptomes 0
Isolates 5.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.14
Nodule 0.17
Rhizoplane 1.5
Rhizosphere 66.56
Stem 0
Stem Tuber 0
Unclassified 15.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1005228 3300001904 Bacteria 2195
2 JGI24740J21852_10006551 3300001979 Bacteria 4809
3 JGI24739J22299_10000764 3300001989 Bacteria 11711
4 JGI24739J22299_10010483 3300001989 Bacteria 3442
5 JGI24737J22298_10000146 3300001990 Bacteria 21962
6 JGI24737J22298_10001103 3300001990 Bacteria 9494
7 JGI24737J22298_10012744 3300001990 Bacteria 2741
8 JGI24735J21928_10001534 3300002067 Bacteria 8186
9 JGI24735J21928_10002142 3300002067 Bacteria 6951
10 JGI24735J21928_10024486 3300002067 Bacteria 1826
11 JGI24738J21930_10000047 3300002075 Bacteria 24272
12 JGI24738J21930_10007731 3300002075 Bacteria 2468
13 JGI25156J39149_1000026 3300002705 Bacteria 132099
14 JGI25156J39149_1004036 3300002705 Bacteria 4606
15 JGI25162J39368_1000625 3300002737 Bacteria 25160
16 JGI25157J39369_1000008 3300002741 Bacteria 211083
17 JGI25157J39369_1000967 3300002741 Bacteria 13425
18 JGI25157J39369_1001103 3300002741 Bacteria 12041
19 JGI25157J39369_1001587 3300002741 Bacteria 8009
20 JGI25164J39214_1000048 3300002772 Bacteria 124152
21 JGI25152J39213_1000004 3300002773 Bacteria 191383
22 JGI25152J39213_1000188 3300002773 Bacteria 41653
23 JGI25150J39212_1000438 3300002774 Bacteria 18640
24 JGI25151J46595_10000010 3300003187 Bacteria 277507
25 JGI25165J46597_1000096 3300003214 Bacteria 161294
26 JGI25165J46597_1000566 3300003214 Bacteria 33479
27 JGI25153J46596_10000013 3300003215 Bacteria 303690
28 rootH1_10001460 3300003316 Bacteria 3532
29 rootH1_10006701 3300003316 Bacteria 17835
30 rootH1_10022300 3300003316 Bacteria 6866
31 rootH2_10005870 3300003320 Bacteria 8032
32 rootL2_10006538 3300003322 Bacteria 28705
33 rootL2_10049842 3300003322 Bacteria 8128
34 rootL2_10061224 3300003322 Bacteria 2913
35 rootH1_10006711 3300003323 Bacteria 14816
36 rootH1_10031104 3300003323 Bacteria 3036
37 rootH1_10039315 3300003323 Bacteria 11336
38 rootH1_10044261 3300003323 Bacteria 2599
39 rootH1_10044262 3300003323 Bacteria 6958
40 rootH1_10180860 3300003323 Bacteria 1889
41 rootH1_10293050 3300003323 Bacteria 2273
42 Ga0055539_1000042 3300003752 Bacteria 199725
43 Ga0055539_1000855 3300003752 Bacteria 7110
44 Ga0055533_1000006 3300003756 Bacteria 635559
45 Ga0055533_1001601 3300003756 Bacteria 5849
46 Ga0055525_1000001 3300003759 Bacteria 1016948
47 Ga0055525_1000120 3300003759 Bacteria 119424
48 Ga0055525_1000940 3300003759 Bacteria 8143
49 Ga0055527_1000058 3300003760 Bacteria 95779
50 Ga0055527_1000107 3300003760 Bacteria 59466
51 Ga0055535_1000325 3300003761 Bacteria 48256
52 Ga0055535_1000823 3300003761 Bacteria 22266
53 Ga0055535_1000983 3300003761 Bacteria 18526
54 Ga0055542_1000149 3300003762 Bacteria 88186
55 Ga0055542_1000260 3300003762 Bacteria 59466
56 Ga0055542_1000384 3300003762 Bacteria 45090
57 Ga0055542_1000486 3300003762 Bacteria 36933
58 Ga0055529_1000049 3300003763 Bacteria 208413
59 Ga0055529_1000289 3300003763 Bacteria 59423
60 Ga0055529_1000374 3300003763 Bacteria 48348
61 Ga0055526_1000095 3300003771 Bacteria 80903
62 Ga0055524_1000157 3300003775 Bacteria 79002
63 Ga0055531_10000025 3300003794 Bacteria 161475
64 Ga0055531_10005331 3300003794 Bacteria 7545
65 Ga0055531_10006800 3300003794 Bacteria 6384
66 Ga0065704_10070370 3300005289 Bacteria 28970
67 Ga0070658_10003827 3300005327 Bacteria 12334
68 Ga0070658_10019464 3300005327 Bacteria 5435
69 Ga0070690_100000894 3300005330 Bacteria 15204
70 Ga0070670_100061379 3300005331 Bacteria 3227
71 Ga0068869_100049393 3300005334 Bacteria 3045
72 Ga0070666_10000008 3300005335 Bacteria 293415
73 Ga0070682_100023656 3300005337 Bacteria 3649
74 Ga0070673_100081336 3300005364 Bacteria 2627
75 Ga0070659_100008751 3300005366 Bacteria 7409
76 Ga0070659_100122196 3300005366 Bacteria 2110
77 Ga0070667_100020773 3300005367 Bacteria 5454
78 Ga0070714_100002914 3300005435 Bacteria 12654
79 Ga0070713_100003831 3300005436 Bacteria 9962
80 Ga0070663_100001297 3300005455 Bacteria 13684
81 Ga0070663_100005219 3300005455 Bacteria 7693
82 Ga0070662_100035349 3300005457 Bacteria 3528
83 Ga0068853_100005512 3300005539 Bacteria 9922
84 Ga0068853_100049139 3300005539 Bacteria 3624
85 Ga0068853_100157940 3300005539 Bacteria 2044
86 Ga0070665_100033848 3300005548 Bacteria 5140
87 Ga0070665_100143704 3300005548 Bacteria 2389
88 Ga0068855_100002022 3300005563 Bacteria 25159
89 Ga0068855_100003008 3300005563 Bacteria 20620
90 Ga0068855_100008710 3300005563 Bacteria 12265
91 Ga0068855_100062580 3300005563 Bacteria 4344
92 Ga0068857_100004277 3300005577 Bacteria 12041
93 Ga0068857_100010583 3300005577 Bacteria 8020
94 Ga0068854_100000144 3300005578 Bacteria 49698
95 Ga0068854_100001017 3300005578 Bacteria 16836
96 Ga0068854_100009849 3300005578 Bacteria 6181
97 Ga0068854_100087744 3300005578 Bacteria 2308
98 Ga0068856_100000012 3300005614 Bacteria 166032
99 Ga0068856_100003732 3300005614 Bacteria 15269
100 Ga0068856_100003862 3300005614 Bacteria 15037
101 Ga0068858_100000499 3300005842 Bacteria 41087
102 Ga0075364_10000300 3300006051 Bacteria 24079
103 Ga0075366_10034839 3300006195 Bacteria 2967
104 Ga0097621_100019160 3300006237 Bacteria 5246
105 Ga0105244_10000158 3300009036 Bacteria 70253
106 Ga0105244_10001449 3300009036 Bacteria 19209
107 Ga0105240_10000049 3300009093 Bacteria 236718
108 Ga0105240_10003394 3300009093 Bacteria 24772
109 Ga0105240_10004407 3300009093 Bacteria 21472
110 Ga0105240_10018464 3300009093 Bacteria 9364
111 Ga0105240_10072508 3300009093 Bacteria 4256
112 Ga0105240_10123731 3300009093 Bacteria 3111
113 Ga0105242_10004609 3300009176 Bacteria 10686
114 Ga0105237_10000630 3300009545 Bacteria 49242
115 Ga0105237_10010419 3300009545 Bacteria 9890
116 Ga0105238_10000335 3300009551 Bacteria 51399
117 Ga0105238_10034728 3300009551 Bacteria 5129
118 Ga0105238_10037554 3300009551 Bacteria 4923
119 Ga0105239_10000070 3300010375 Bacteria 144044
120 Ga0105239_10036352 3300010375 Bacteria 5408
121 Ga0157319_1000005 3300012497 Bacteria 372810
122 Ga0157373_10003230 3300013100 Bacteria 12323
123 Ga0157371_10000856 3300013102 Bacteria 34784
124 Ga0157370_10000140 3300013104 Bacteria 87498
125 Ga0157370_10036932 3300013104 Bacteria 4738
126 Ga0157369_10007582 3300013105 Bacteria 12488
127 Ga0157369_10020993 3300013105 Bacteria 7302
128 Ga0157369_10048674 3300013105 Bacteria 4599
129 Ga0157369_10097340 3300013105 Bacteria 3139
130 Ga0157374_10027500 3300013296 Bacteria 5133
131 Ga0163162_10012837 3300013306 Bacteria 8182
132 Ga0182008_10000798 3300014497 Bacteria 22043
133 Ga0182008_10020044 3300014497 Bacteria 3446
134 Ga0182006_1000040 3300015261 Bacteria 209209
135 Ga0182006_1001734 3300015261 Bacteria 12660
136 Ga0182005_1000051 3300015265 Bacteria 114808
137 Ga0213872_10000083 3300021361 Bacteria 87967
138 Ga0209674_100003 3300025226 Bacteria 2196646
139 Ga0209674_100394 3300025226 Bacteria 22429
140 Ga0209672_100009 3300025228 Bacteria 883623
141 Ga0209672_100024 3300025228 Bacteria 367869
142 Ga0209672_100133 3300025228 Bacteria 73558
143 Ga0209672_101393 3300025228 Bacteria 8938
144 Ga0209563_100007 3300025230 Bacteria 1579402
145 Ga0209563_100010 3300025230 Bacteria 1337457
146 Ga0209563_100067 3300025230 Bacteria 256096
147 Ga0207427_100040 3300025231 Bacteria 265135
148 Ga0207427_100220 3300025231 Bacteria 49507
149 Ga0207427_101385 3300025231 Bacteria 8885
150 Ga0209437_100189 3300025233 Bacteria 125144
151 Ga0209258_100011 3300025242 Bacteria 867542
152 Ga0209258_100047 3300025242 Bacteria 367869
153 Ga0209258_100118 3300025242 Bacteria 183558
154 Ga0209258_100474 3300025242 Bacteria 42679
155 Ga0209258_100521 3300025242 Bacteria 36985
156 Ga0207425_1000015 3300025245 Bacteria 466368
157 Ga0207425_1000427 3300025245 Bacteria 27968
158 Ga0209646_1000039 3300025246 Bacteria 349637
159 Ga0209646_1000741 3300025246 Bacteria 11464
160 Ga0209646_1005796 3300025246 Bacteria 2123
161 Ga0209026_1000006 3300025250 Bacteria 677225
162 Ga0209026_1000044 3300025250 Bacteria 266550
163 Ga0209026_1000077 3300025250 Bacteria 200561
164 Ga0209026_1000237 3300025250 Bacteria 73153
165 Ga0209026_1001111 3300025250 Bacteria 12781
166 Ga0209026_1002186 3300025250 Bacteria 7576
167 Ga0209677_100026 3300025253 Bacteria 382520
168 Ga0209677_103649 3300025253 Bacteria 4855
169 Ga0209148_1000013 3300025254 Bacteria 956684
170 Ga0209148_1000024 3300025254 Bacteria 669890
171 Ga0209148_1000054 3300025254 Bacteria 367869
172 Ga0209148_1000280 3300025254 Bacteria 78989
173 Ga0209148_1000385 3300025254 Bacteria 53107
174 Ga0209759_1000020 3300025256 Bacteria 344904
175 Ga0209759_1000291 3300025256 Bacteria 69357
176 Ga0209759_1000759 3300025256 Bacteria 27737
177 Ga0209759_1001513 3300025256 Bacteria 12812
178 Ga0209759_1005083 3300025256 Bacteria 4702
179 Ga0209759_1007145 3300025256 Bacteria 3640
180 Ga0209129_1000074 3300025258 Bacteria 205648
181 Ga0209129_1000987 3300025258 Bacteria 17036
182 Ga0209233_1000108 3300025261 Bacteria 265137
183 Ga0209233_1000143 3300025261 Bacteria 191568
184 Ga0209455_1000012 3300025272 Bacteria 867234
185 Ga0209455_1000025 3300025272 Bacteria 670673
186 Ga0209455_1000052 3300025272 Bacteria 367804
187 Ga0209455_1000440 3300025272 Bacteria 32006
188 Ga0209673_1007488 3300025273 Bacteria 5016
189 Ga0209676_1000063 3300025292 Bacteria 322025
190 Ga0209025_1000002 3300025294 Bacteria 1393142
191 Ga0209025_1001943 3300025294 Bacteria 23849
192 Ga0209564_1000026 3300025295 Bacteria 519154
193 Ga0209758_1000003 3300025297 Bacteria 1398533
194 Ga0209758_1000270 3300025297 Bacteria 102973
195 Ga0209758_1000916 3300025297 Bacteria 39954
196 Ga0209050_1003834 3300025298 Bacteria 10719
197 Ga0209050_1009532 3300025298 Bacteria 4950
198 Ga0209256_1000177 3300025299 Bacteria 125603
199 Ga0209256_1001512 3300025299 Bacteria 23519
200 Ga0209256_1008909 3300025299 Bacteria 4524
201 Ga0209051_1001521 3300025303 Bacteria 19295
202 Ga0209051_1016276 3300025303 Bacteria 3376
203 Ga0209257_1000032 3300025304 Bacteria 680354
204 Ga0209257_1000347 3300025304 Bacteria 95122
205 Ga0209257_1007715 3300025304 Bacteria 6414
206 Ga0207655_1000710 3300025728 Bacteria 38274
207 Ga0207655_1004970 3300025728 Bacteria 9215
208 Ga0207680_10000005 3300025903 Bacteria 660983
209 Ga0207647_10000829 3300025904 Bacteria 24013
210 Ga0207647_10002960 3300025904 Bacteria 12781
211 Ga0207647_10037171 3300025904 Bacteria 3089
212 Ga0207705_10006342 3300025909 Bacteria 8774
213 Ga0207705_10014504 3300025909 Bacteria 5672
214 Ga0207695_10000114 3300025913 Bacteria 242465
215 Ga0207695_10000543 3300025913 Bacteria 78567
216 Ga0207695_10003952 3300025913 Bacteria 20497
217 Ga0207695_10009701 3300025913 Bacteria 11854
218 Ga0207695_10029533 3300025913 Bacteria 6053
219 Ga0207695_10036830 3300025913 Bacteria 5284
220 Ga0207695_10068371 3300025913 Bacteria 3640
221 Ga0207695_10128193 3300025913 Bacteria 2497
222 Ga0207671_10000031 3300025914 Bacteria 247030
223 Ga0207671_10000484 3300025914 Bacteria 54081
224 Ga0207657_10034868 3300025919 Bacteria 4518
225 Ga0207657_10050389 3300025919 Bacteria 3624
226 Ga0207700_10013158 3300025928 Bacteria 5371
227 Ga0207690_10008661 3300025932 Bacteria 6035
228 Ga0207690_10033212 3300025932 Bacteria 3316
229 Ga0207706_10031715 3300025933 Bacteria 4706
230 Ga0207686_10001705 3300025934 Bacteria 12241
231 Ga0207689_10066303 3300025942 Bacteria 2969
232 Ga0207667_10000082 3300025949 Bacteria 157749
233 Ga0207667_10000806 3300025949 Bacteria 40715
234 Ga0207667_10002830 3300025949 Bacteria 21534
235 Ga0207667_10024867 3300025949 Bacteria 6566
236 Ga0207667_10174406 3300025949 Bacteria 2209
237 Ga0207651_10003738 3300025960 Bacteria 7528
238 Ga0207640_10000014 3300025981 Bacteria 219683
239 Ga0207640_10000016 3300025981 Bacteria 208390
240 Ga0207640_10000018 3300025981 Bacteria 193664
241 Ga0207640_10000357 3300025981 Bacteria 29919
242 Ga0207640_10000552 3300025981 Bacteria 22446
243 Ga0207658_10035076 3300025986 Bacteria 3591
244 Ga0207703_10001993 3300026035 Bacteria 18012
245 Ga0207639_10004023 3300026041 Bacteria 9922
246 Ga0207678_10004112 3300026067 Bacteria 13085
247 Ga0207678_10009362 3300026067 Bacteria 8622
248 Ga0207702_10000108 3300026078 Bacteria 95976
249 Ga0207702_10001065 3300026078 Bacteria 28079
250 Ga0207702_10002612 3300026078 Bacteria 16920
251 Ga0207702_10006080 3300026078 Bacteria 10470
252 Ga0207702_10091948 3300026078 Bacteria 2658
253 Ga0207674_10012597 3300026116 Bacteria 9452
254 Ga0207674_10052187 3300026116 Bacteria 4170
255 Ga0209281_1004926 3300027111 Bacteria 3843
256 Ga0268266_10000051 3300028379 Bacteria 296231
257 Ga0265336_10000057 3300028666 Bacteria 105485
258 Ga0307515_10000026 3300028794 Bacteria 382411
259 Ga0307515_10000132 3300028794 Bacteria 176547
260 Ga0307515_10001291 3300028794 Bacteria 56882
261 Ga0265324_10002428 3300029957 Bacteria 9563
262 Ga0307513_10016752 3300031456 Bacteria 8818
263 Ga0307408_100000044 3300031548 Bacteria 169498
264 Ga0307408_100000087 3300031548 Bacteria 101616
265 Ga0307408_100000089 3300031548 Bacteria 100712
266 Ga0307408_100000279 3300031548 Bacteria 51312
267 Ga0307408_100067759 3300031548 Bacteria 2626
268 Ga0307516_10001414 3300031730 Bacteria 33201
269 Ga0307516_10008045 3300031730 Bacteria 11991
270 Ga0307406_10000460 3300031901 Bacteria 23579
271 Ga0307414_10001626 3300032004 Bacteria 11693
272 Ga0307414_10017121 3300032004 Bacteria 4428
273 Ga0307411_10000073 3300032005 Bacteria 30792
274 Ga0307510_10000038 3300033180 Bacteria 106256
275 Ga0307510_10001244 3300033180 Bacteria 27679
276 Ga0373931_0002933 3300035691 Bacteria 7608
277 Ga0395899_0000062 3300037312 Bacteria 211388
278 Ga0395899_0000183 3300037312 Bacteria 91818
279 Ga0395899_0016811 3300037312 Bacteria 5577
280 Ga0395899_0025782 3300037312 Bacteria 4437
281 Ga0395899_0026990 3300037312 Bacteria 4331
282 Ga0395899_0044456 3300037312 Bacteria 3309
283 Ga0395899_0060294 3300037312 Bacteria 2795
284 Ga0395900_0000039 3300037418 Bacteria 248722
285 Ga0395900_0000297 3300037418 Bacteria 74817
286 Ga0395900_0000875 3300037418 Bacteria 39483
287 Ga0395900_0009197 3300037418 Bacteria 10128
288 Ga0395900_0015294 3300037418 Bacteria 7824
289 Ga0395898_0000069 3300037466 Bacteria 254587
290 Ga0395898_0000140 3300037466 Bacteria 190587
291 Ga0395898_0002834 3300037466 Bacteria 19837
292 Ga0395898_0010944 3300037466 Bacteria 9460
293 Ga0395905_0000091 3300037471 Bacteria 151747
294 Ga0395905_0003461 3300037471 Bacteria 16880
295 Ga0395905_0007479 3300037471 Bacteria 10866
296 Ga0395905_0012497 3300037471 Bacteria 8172
297 Ga0395905_0026323 3300037471 Bacteria 5485
298 Ga0395905_0031140 3300037471 Bacteria 5023
299 Ga0395905_0034558 3300037471 Bacteria 4747
300 Ga0395905_0062826 3300037471 Bacteria 3473
301 Ga0395905_0064772 3300037471 Bacteria 3421
302 Ga0395905_0070117 3300037471 Bacteria 3284
303 Ga0395905_0165113 3300037471 Bacteria 2080
304 Ga0395905_0199860 3300037471 Bacteria 1874
305 Ga0395901_0000182 3300038443 Bacteria 81583
306 Ga0395901_0002267 3300038443 Bacteria 19632
307 Ga0395901_0003168 3300038443 Bacteria 16548
308 Ga0395901_0007644 3300038443 Bacteria 10908
309 Ga0395901_0197947 3300038443 Bacteria 2106
310 Ga0395901_0245928 3300038443 Bacteria 1864
311 Ga0451793_0647515 3300041452 Bacteria 2295
312 Ga0439445_0000017 3300042004 Bacteria 22138
313 Ga0439448_0001498 3300042005 Bacteria 6075
314 Ga0439448_0002529 3300042005 Bacteria 4984
315 Ga0439448_0009318 3300042005 Bacteria 2892
316 Ga0439449_0000148 3300042007 Bacteria 23780
317 Ga0439449_0036880 3300042007 Bacteria 1818
318 Ga0450890_000748 3300042127 Bacteria 4721
319 Ga0450891_000030 3300042129 Bacteria 10041
320 Ga0450898_006302 3300042134 Bacteria 1816
321 Ga0450899_001924 3300042135 Bacteria 2299
322 Ga0450889_000154 3300042144 Bacteria 7035
323 Ga0439458_0003400 3300042157 Bacteria 3729
324 Ga0450893_0003065 3300042532 Bacteria 2628
325 Ga0451577_0001100 3300042876 Bacteria 38617
326 Ga0466969_0001829 3300044656 Bacteria 11356
327 Ga0466969_0030475 3300044656 Bacteria 2748
328 Ga0466972_0006972 3300044658 Bacteria 5667
329 Ga0466972_0009228 3300044658 Bacteria 4954
330 Ga0466975_0142054 3300044661 Bacteria 1680
331 Ga0453683_0000388 3300044673 Bacteria 52402
332 Ga0466966_0000185 3300044684 Bacteria 41391
333 Ga0466966_0000893 3300044684 Bacteria 19055
334 Ga0466961_0000838 3300044693 Bacteria 19180
335 Ga0466961_0002054 3300044693 Bacteria 12538
336 Ga0466961_0009691 3300044693 Bacteria 6130
337 Ga0466961_0021300 3300044693 Bacteria 4173
338 Ga0466961_0034991 3300044693 Bacteria 3225
339 Ga0466964_0000235 3300044706 Bacteria 15877
340 Ga0466964_0013264 3300044706 Bacteria 3126
341 Ga0466971_0000321 3300044719 Bacteria 18474
342 Ga0466971_0006747 3300044719 Bacteria 4995
343 Ga0466971_0024553 3300044719 Bacteria 2690
344 Ga0466968_0000415 3300044735 Bacteria 14183
345 Ga0466970_0000676 3300044765 Bacteria 16664
346 Ga0466970_0014806 3300044765 Bacteria 4009
347 Ga0466970_0032087 3300044765 Bacteria 2775
348 Ga0466970_0053522 3300044765 Bacteria 2155
349 Ga0466957_0000301 3300044842 Bacteria 24184
350 Ga0466957_0008884 3300044842 Bacteria 5725
351 Ga0466957_0079680 3300044842 Bacteria 2038
352 Ga0466957_0098628 3300044842 Bacteria 1839
353 Ga0466959_0000324 3300045049 Bacteria 28181
354 Ga0466959_0004379 3300045049 Bacteria 9450
355 Ga0466959_0005917 3300045049 Bacteria 8424
356 Ga0466959_0011694 3300045049 Bacteria 6313
357 Ga0466959_0050430 3300045049 Bacteria 3055
358 Ga0466959_0051365 3300045049 Bacteria 3024
359 Ga0466959_0060055 3300045049 Bacteria 2766
360 Ga0451576_0001377 3300045051 Bacteria 41774
361 Ga0451576_0072490 3300045051 Bacteria 3584
362 Ga0466958_0000079 3300045836 Bacteria 29664
363 Ga0466958_0001861 3300045836 Bacteria 10298
364 Ga0466958_0023991 3300045836 Bacteria 3586
365 Ga0466958_0035388 3300045836 Bacteria 2983
366 Ga0466967_0004988 3300045976 Bacteria 9087
367 Ga0466967_0112882 3300045976 Bacteria 2499
368 Ga0495617_000048 3300046452 Bacteria 113357
369 Ga0495627_000008 3300046453 Bacteria 572150
370 Ga0495627_022856 3300046453 Bacteria 2054
371 Ga0495590_0000030 3300046457 Bacteria 146237
372 Ga0495638_0000502 3300046460 Bacteria 46450
373 Ga0495638_0000577 3300046460 Bacteria 41426
374 Ga0495638_0001521 3300046460 Bacteria 20879
375 Ga0495653_0000094 3300046463 Bacteria 74354
376 Ga0495650_0000212 3300046471 Bacteria 124622
377 Ga0495650_0000227 3300046471 Bacteria 114662
378 Ga0495650_0003980 3300046471 Bacteria 10387
379 Ga0495650_0008312 3300046471 Bacteria 6076
380 Ga0495650_0015103 3300046471 Bacteria 3978
381 Ga0495605_0000684 3300046474 Bacteria 25383
382 Ga0495605_0007359 3300046474 Bacteria 6251
383 Ga0495605_0008715 3300046474 Bacteria 5726
384 Ga0495605_0022554 3300046474 Bacteria 3323
385 Ga0495584_0004029 3300046491 Bacteria 7924
386 Ga0495585_0003347 3300046492 Bacteria 10861
387 Ga0495585_0056931 3300046492 Bacteria 2158
388 Ga0495596_0000522 3300046500 Bacteria 24144
389 Ga0495607_0000791 3300046501 Bacteria 29998
390 Ga0495607_0001184 3300046501 Bacteria 23557
391 Ga0495607_0003449 3300046501 Bacteria 12108
392 Ga0495583_0000002 3300046506 Bacteria 782521
393 Ga0495583_0000034 3300046506 Bacteria 246856
394 Ga0495583_0000202 3300046506 Bacteria 100020
395 Ga0495583_0000480 3300046506 Bacteria 58370
396 Ga0495583_0000655 3300046506 Bacteria 45614
397 Ga0495606_0000316 3300046507 Bacteria 83307
398 Ga0495606_0000392 3300046507 Bacteria 74042
399 Ga0495606_0001466 3300046507 Bacteria 31509
400 Ga0495606_0005479 3300046507 Bacteria 12151
401 Ga0495606_0011434 3300046507 Bacteria 7239
402 Ga0495606_0074046 3300046507 Bacteria 2134
403 Ga0495610_0000021 3300046512 Bacteria 336300
404 Ga0495610_0004696 3300046512 Bacteria 9976
405 Ga0495610_0004761 3300046512 Bacteria 9899
406 Ga0495610_0018050 3300046512 Bacteria 3997
407 Ga0495610_0020020 3300046512 Bacteria 3727
408 Ga0495616_0000008 3300046513 Bacteria 226291
409 Ga0495616_0000195 3300046513 Bacteria 50559
410 Ga0495616_0010746 3300046513 Bacteria 5280
411 Ga0495616_0053010 3300046513 Bacteria 2017
412 Ga0495631_0016898 3300046518 Bacteria 3464
413 Ga0495632_0000864 3300046519 Bacteria 26623
414 Ga0495632_0008099 3300046519 Bacteria 6507
415 Ga0495637_0000517 3300046520 Bacteria 28019
416 Ga0495643_0000639 3300046522 Bacteria 41499
417 Ga0495643_0001431 3300046522 Bacteria 22049
418 Ga0495643_0041750 3300046522 Bacteria 2500
419 Ga0495643_0060304 3300046522 Bacteria 2014
420 Ga0495644_0003909 3300046523 Bacteria 5868
421 Ga0495644_0008286 3300046523 Bacteria 4003
422 Ga0495648_0000192 3300046524 Bacteria 70428
423 Ga0495648_0005053 3300046524 Bacteria 11073
424 Ga0495648_0007457 3300046524 Bacteria 8747
425 Ga0495648_0010461 3300046524 Bacteria 7064
426 Ga0495648_0021530 3300046524 Bacteria 4461
427 Ga0495663_0000512 3300046525 Bacteria 13962
428 Ga0495642_0000174 3300046528 Bacteria 37880
429 Ga0495654_0000005 3300046530 Bacteria 491381
430 Ga0495609_0000009 3300046538 Bacteria 354860
431 Ga0495609_0000044 3300046538 Bacteria 161642
432 Ga0495609_0002111 3300046538 Bacteria 12497
433 Ga0495609_0038269 3300046538 Bacteria 2163
434 Ga0495597_0000630 3300046542 Bacteria 28791
435 Ga0495597_0001389 3300046542 Bacteria 17475
436 Ga0495597_0022682 3300046542 Bacteria 2910
437 Ga0495622_0000337 3300046557 Bacteria 33736
438 Ga0495622_0000342 3300046557 Bacteria 33472
439 Ga0495633_0000181 3300046558 Bacteria 82164
440 Ga0495633_0000775 3300046558 Bacteria 28578
441 Ga0495633_0001583 3300046558 Bacteria 17367
442 Ga0495633_0022330 3300046558 Bacteria 3151
443 Ga0495633_0028875 3300046558 Bacteria 2700
444 Ga0495633_0030104 3300046558 Bacteria 2638
445 Ga0495656_0006811 3300046615 Bacteria 4017
446 Ga0495668_0000300 3300046616 Bacteria 68118
447 Ga0495668_0000875 3300046616 Bacteria 33965
448 Ga0495668_0002420 3300046616 Bacteria 15392
449 Ga0495668_0046806 3300046616 Bacteria 2402
450 Ga0495668_0055128 3300046616 Bacteria 2195
451 Ga0495668_0067849 3300046616 Bacteria 1962
452 Ga0495611_0002942 3300046648 Bacteria 7594
453 Ga0495625_0001453 3300046660 Bacteria 28757
454 Ga0495625_0002719 3300046660 Bacteria 18757
455 Ga0495625_0002731 3300046660 Bacteria 18701
456 Ga0495625_0009740 3300046660 Bacteria 7998
457 Ga0495625_0010502 3300046660 Bacteria 7653
458 Ga0495625_0027765 3300046660 Bacteria 4254
459 Ga0495661_0000113 3300046665 Bacteria 96815
460 Ga0495661_0000426 3300046665 Bacteria 44529
461 Ga0495661_0001850 3300046665 Bacteria 16904
462 Ga0495661_0004761 3300046665 Bacteria 9737
463 Ga0495661_0033854 3300046665 Bacteria 3220
464 Ga0495670_0013561 3300046691 Bacteria 4008
465 Ga0495671_0000310 3300046692 Bacteria 41263
466 Ga0495649_0000052 3300046694 Bacteria 108087
467 Ga0495649_0003458 3300046694 Bacteria 10644
468 Ga0495649_0003576 3300046694 Bacteria 10424
469 Ga0495589_0000035 3300046794 Bacteria 161642
470 Ga0495589_0000037 3300046794 Bacteria 150603
471 Ga0495589_0001144 3300046794 Bacteria 15770
472 Ga0495589_0012665 3300046794 Bacteria 4361
473 Ga0495660_0000057 3300046810 Bacteria 133310
474 Ga0495660_0000555 3300046810 Bacteria 30632
475 Ga0495660_0000839 3300046810 Bacteria 22805
476 Ga0495660_0003693 3300046810 Bacteria 9410
477 Ga0495660_0004024 3300046810 Bacteria 8976
478 Ga0495660_0049998 3300046810 Bacteria 2279
479 Ga0495672_0000285 3300047320 Bacteria 70145
480 Ga0495672_0003714 3300047320 Bacteria 12870
481 Ga0495672_0077075 3300047320 Bacteria 1870
482 Ga0495683_0042646 3300047323 Bacteria 2287
483 Ga0495683_0051930 3300047323 Bacteria 2047
484 Ga0495687_000066 3300047443 Bacteria 161642
485 Ga0495687_000164 3300047443 Bacteria 99940
486 Ga0495687_000168 3300047443 Bacteria 97267
487 Ga0495687_000215 3300047443 Bacteria 82752
488 Ga0495687_001222 3300047443 Bacteria 24544
489 Ga0495687_001324 3300047443 Bacteria 23105
490 Ga0495677_0000011 3300047445 Bacteria 149837
491 Ga0495677_0000013 3300047445 Bacteria 138372
492 Ga0495677_0000255 3300047445 Bacteria 23352
493 Ga0495677_0000609 3300047445 Bacteria 14618
494 Ga0495679_014209 3300047446 Bacteria 2960
495 Ga0495685_019827 3300047447 Bacteria 2311
496 Ga0495673_0000033 3300047469 Bacteria 354152
497 Ga0495673_0000150 3300047469 Bacteria 122768
498 Ga0495673_0001548 3300047469 Bacteria 18062
499 Ga0495681_0008972 3300047470 Bacteria 6207
500 Ga0495686_0000162 3300047472 Bacteria 126699
501 Ga0495686_0000356 3300047472 Bacteria 74751
502 Ga0495686_0013508 3300047472 Bacteria 5663
503 Ga0495686_0029801 3300047472 Bacteria 3547
504 Ga0495615_0002112 3300048090 Bacteria 3119
505 Ga0495626_0000011 3300048091 Bacteria 260928
506 Ga0495626_0000071 3300048091 Bacteria 136767
507 Ga0495626_0001607 3300048091 Bacteria 17612
508 Ga0495626_0006624 3300048091 Bacteria 6565
509 Ga0495626_0012281 3300048091 Bacteria 4496
510 Ga0495626_0043322 3300048091 Bacteria 2112
511 Ga0496102_0025873 3300048905 Bacteria 5227
512 Ga0496103_0006104 3300048906 Bacteria 7199
513 Ga0496103_0091644 3300048906 Bacteria 1918
514 Ga0496104_0145134 3300048907 Bacteria 2279
515 Ga0496105_0008394 3300048908 Bacteria 8029
516 Ga0496106_0047263 3300048909 Bacteria 3238
517 Ga0496107_0020137 3300048910 Bacteria 4711
518 Ga0496114_0056186 3300048917 Bacteria 3284
519 Ga0496116_0000280 3300048919 Bacteria 87774
520 Ga0496116_0027734 3300048919 Bacteria 4116
521 Ga0496117_0004101 3300048920 Bacteria 16328
522 Ga0496118_0004682 3300048921 Bacteria 16037
523 Ga0496118_0105874 3300048921 Bacteria 1884
524 Ga0496119_0000048 3300048922 Bacteria 185846
525 Ga0496120_0000519 3300048923 Bacteria 59691
526 Ga0496121_0016952 3300048924 Bacteria 7484
527 Ga0496122_0000679 3300048925 Bacteria 68253
528 Ga0496122_0009741 3300048925 Bacteria 10039
529 Ga0496122_0019844 3300048925 Bacteria 6117
530 Ga0496123_0000273 3300048926 Bacteria 102487
531 Ga0496123_0010989 3300048926 Bacteria 7912
532 Ga0496123_0011828 3300048926 Bacteria 7510
533 Ga0496124_0015607 3300048927 Bacteria 7270
534 Ga0496124_0023054 3300048927 Bacteria 5694
535 Ga0496124_0023891 3300048927 Bacteria 5569
536 Ga0496124_0030207 3300048927 Bacteria 4813
537 Ga0496124_0030307 3300048927 Bacteria 4804
538 Ga0496124_0030713 3300048927 Bacteria 4764
539 Ga0496124_0058895 3300048927 Bacteria 3228
540 Ga0496124_0062069 3300048927 Bacteria 3129
541 Ga0496125_0001420 3300048928 Bacteria 34946
542 Ga0496125_0002009 3300048928 Bacteria 27587
543 Ga0496125_0016273 3300048928 Bacteria 7148
544 Ga0496125_0062005 3300048928 Bacteria 2994
545 Ga0496126_0000097 3300048929 Bacteria 206014
546 Ga0496126_0012448 3300048929 Bacteria 8712
547 Ga0495678_000002 3300049459 Bacteria 999613
548 Ga0495678_000241 3300049459 Bacteria 61623
549 Ga0501299_005017 3300049522 Bacteria 2012
550 Ga0501300_002498 3300049523 Bacteria 2749
551 Ga0501034_0015172 3300049571 Bacteria 7918
552 Ga0501034_0060956 3300049571 Bacteria 3790
553 Ga0501034_0116722 3300049571 Bacteria 2657
554 Ga0501034_0228865 3300049571 Bacteria 1809
555 Ga0501227_001061 3300049665 Bacteria 6116
556 Ga0501258_000255 3300049687 Bacteria 3287
557 Ga0501221_000455 3300049704 Bacteria 6392
558 Ga0501269_000312 3300049766 Bacteria 13021
559 Ga0501035_0021676 3300049822 Bacteria 5908
560 nmdc:mga07m45_14250_c1 3300050496 Bacteria 4231
561 Ga0500635_0012917 3300053080 Bacteria 2412
562 Ga0500608_000084 3300053122 Bacteria 38834
563 Ga0500618_001044 3300053125 Bacteria 13824
564 Ga0500586_001190 3300053145 Bacteria 5418
565 Ga0500586_001453 3300053145 Bacteria 4996
566 Ga0500634_0000385 3300053161 Bacteria 14134
567 Ga0500637_0000575 3300053178 Bacteria 14440
568 Ga0500609_000195 3300053731 Bacteria 8636
569 Ga0466962_0001038 3300061719 Bacteria 12735
570 Ga0466962_0002853 3300061719 Bacteria 8232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2857564685 2857566398 413
2 3300046522 Ga0495643_0041750 Ga0495643_0041750_1135_2439 426
3 3300044842 Ga0466957_0098628 Ga0466957_0098628_26_1366 443
4 3300003794 Ga0055531_10000025 Ga0055531_10000025104 451
5 3300025298 Ga0209050_1003834 Ga0209050_10038349 451
6 3300025303 Ga0209051_1016276 Ga0209051_10162762 451
7 3300025304 Ga0209257_1000032 Ga0209257_1000032187 451
8 3300047320 Ga0495672_0077075 Ga0495672_0077075_327_1856 469
9 3300046471 Ga0495650_0000212 Ga0495650_0000212_104683_106200 473
10 3300046558 Ga0495633_0030104 Ga0495633_0030104_707_2224 473
11 3300046616 Ga0495668_0055128 Ga0495668_0055128_399_1916 473
12 3300046525 Ga0495663_0000512 Ga0495663_0000512_10401_11972 478
13 3300044719 Ga0466971_0024553 Ga0466971_0024553_906_2426 479
14 3300044842 Ga0466957_0008884 Ga0466957_0008884_2920_4440 479
15 3300045049 Ga0466959_0005917 Ga0466959_0005917_1720_3240 479
16 3300045976 Ga0466967_0112882 Ga0466967_0112882_536_2056 479
17 3300046519 Ga0495632_0000864 Ga0495632_0000864_23177_24775 479
18 3300046474 Ga0495605_0022554 Ga0495605_0022554_194_1792 480
19 3300046506 Ga0495583_0000655 Ga0495583_0000655_21978_23576 480
20 3300046513 Ga0495616_0053010 Ga0495616_0053010_259_1857 480
21 3300046518 Ga0495631_0016898 Ga0495631_0016898_258_1856 480
22 3300046538 Ga0495609_0038269 Ga0495609_0038269_436_2034 480
23 3300046616 Ga0495668_0046806 Ga0495668_0046806_403_2001 480
24 3300046694 Ga0495649_0003576 Ga0495649_0003576_669_2279 480
25 3300046810 Ga0495660_0049998 Ga0495660_0049998_456_2054 480
26 3300047323 Ga0495683_0051930 Ga0495683_0051930_182_1780 480
27 3300047446 Ga0495679_014209 Ga0495679_014209_261_1859 480
28 3300048091 Ga0495626_0006624 Ga0495626_0006624_4143_5741 482
29 3300046474 Ga0495605_0008715 Ga0495605_0008715_1741_3327 483
30 3300003322 rootL2_10006538 rootL2_1000653818 484
31 3300003794 Ga0055531_10005331 Ga0055531_100053312 484
32 3300012497 Ga0157319_1000005 Ga0157319_1000005190 484
33 3300025304 Ga0209257_1000347 Ga0209257_100034775 484
34 3300042127 Ga0450890_000748 Ga0450890_000748_1680_3320 484
35 3300048090 Ga0495615_0002112 Ga0495615_0002112_1329_2870 484
36 3300047445 Ga0495677_0000609 Ga0495677_0000609_8694_10298 486
37 3300003323 rootH1_10039315 rootH1_1003931510 487
38 3300003775 Ga0055524_1000157 Ga0055524_10001572 487
39 3300003794 Ga0055531_10006800 Ga0055531_100068003 487
40 3300025273 Ga0209673_1007488 Ga0209673_10074882 487
41 3300025298 Ga0209050_1009532 Ga0209050_10095324 487
42 3300025299 Ga0209256_1000177 Ga0209256_100017722 487
43 3300025299 Ga0209256_1001512 Ga0209256_10015122 487
44 3300025303 Ga0209051_1001521 Ga0209051_10015216 487
45 3300025304 Ga0209257_1007715 Ga0209257_10077153 487
46 3300042135 Ga0450899_001924 Ga0450899_001924_234_1829 488
47 3300046471 Ga0495650_0003980 Ga0495650_0003980_4528_6096 488
48 3300028666 Ga0265336_10000057 Ga0265336_1000005756 489
49 3300029957 Ga0265324_10002428 Ga0265324_100024285 489
50 3300042134 Ga0450898_006302 Ga0450898_006302_24_1622 489
51 3300037471 Ga0395905_0012497 Ga0395905_0012497_5099_6760 490
52 3300044765 Ga0466970_0014806 Ga0466970_0014806_1007_2614 490
53 3300045051 Ga0451576_0072490 Ga0451576_0072490_1307_2815 490
54 3300003752 Ga0055539_1000855 Ga0055539_10008554 491
55 3300003756 Ga0055533_1001601 Ga0055533_10016013 491
56 3300005614 Ga0068856_100003862 Ga0068856_1000038625 491
57 3300025228 Ga0209672_100009 Ga0209672_100009401 491
58 3300025242 Ga0209258_100011 Ga0209258_100011243 491
59 3300025254 Ga0209148_1000013 Ga0209148_1000013243 491
60 3300025272 Ga0209455_1000012 Ga0209455_1000012243 491
61 3300026078 Ga0207702_10001065 Ga0207702_100010658 491
62 3300028794 Ga0307515_10001291 Ga0307515_1000129128 491
63 3300042004 Ga0439445_0000017 Ga0439445_0000017_6714_8276 491
64 3300042007 Ga0439449_0036880 Ga0439449_0036880_307_1791 491
65 3300045051 Ga0451576_0001377 Ga0451576_0001377_5283_6785 491
66 3300046507 Ga0495606_0000392 Ga0495606_0000392_18276_19844 491
67 3300046512 Ga0495610_0004761 Ga0495610_0004761_3086_4654 491
68 3300046558 Ga0495633_0028875 Ga0495633_0028875_186_1754 491
69 3300046616 Ga0495668_0000300 Ga0495668_0000300_48290_49858 491
70 3300047472 Ga0495686_0013508 Ga0495686_0013508_1801_3369 491
71 iso_pu_bacteria 2884411467 2884414783 491
72 3300003323 rootH1_10293050 rootH1_102930502 492
73 3300005366 Ga0070659_100122196 Ga0070659_1001221962 492
74 3300031548 Ga0307408_100000087 Ga0307408_10000008727 492
75 3300031548 Ga0307408_100067759 Ga0307408_1000677592 492
76 3300032005 Ga0307411_10000073 Ga0307411_100000738 492
77 3300049665 Ga0501227_001061 Ga0501227_001061_3109_4701 492
78 3300049687 Ga0501258_000255 Ga0501258_000255_1597_3183 492
79 3300025919 Ga0207657_10050389 Ga0207657_100503893 493
80 3300037418 Ga0395900_0015294 Ga0395900_0015294_613_2226 493
81 3300037471 Ga0395905_0007479 Ga0395905_0007479_5569_7182 493
82 3300038443 Ga0395901_0003168 Ga0395901_0003168_8819_10432 493
83 iso_pu_bacteria 2643221584 2643927961 493
84 3300025913 Ga0207695_10036830 Ga0207695_100368302 494
85 3300046507 Ga0495606_0074046 Ga0495606_0074046_36_1586 494
86 iso_pu_bacteria 2510917020 2511122812 494
87 3300001990 JGI24737J22298_10001103 JGI24737J22298_100011036 496
88 3300002067 JGI24735J21928_10002142 JGI24735J21928_100021421 496
89 3300002741 JGI25157J39369_1000008 JGI25157J39369_100000829 496
90 3300005563 Ga0068855_100002022 Ga0068855_1000020229 496
91 3300005563 Ga0068855_100062580 Ga0068855_1000625802 496
92 3300005577 Ga0068857_100004277 Ga0068857_1000042775 496
93 3300005578 Ga0068854_100000144 Ga0068854_10000014433 496
94 3300005578 Ga0068854_100009849 Ga0068854_1000098494 496
95 3300009093 Ga0105240_10004407 Ga0105240_1000440710 496
96 3300009093 Ga0105240_10018464 Ga0105240_100184644 496
97 3300009093 Ga0105240_10072508 Ga0105240_100725083 496
98 3300009545 Ga0105237_10010419 Ga0105237_100104194 496
99 3300013105 Ga0157369_10097340 Ga0157369_100973404 496
100 3300025258 Ga0209129_1000987 Ga0209129_10009873 496
101 3300025297 Ga0209758_1000916 Ga0209758_100091626 496
102 3300025904 Ga0207647_10000829 Ga0207647_1000082922 496
103 3300025913 Ga0207695_10003952 Ga0207695_100039524 496
104 3300025913 Ga0207695_10009701 Ga0207695_1000970110 496
105 3300025913 Ga0207695_10029533 Ga0207695_100295334 496
106 3300025914 Ga0207671_10000031 Ga0207671_100000314 496
107 3300025919 Ga0207657_10034868 Ga0207657_100348683 496
108 3300025949 Ga0207667_10000082 Ga0207667_1000008233 496
109 3300025949 Ga0207667_10000806 Ga0207667_100008064 496
110 3300025981 Ga0207640_10000014 Ga0207640_1000001423 496
111 3300025981 Ga0207640_10000016 Ga0207640_1000001623 496
112 3300025981 Ga0207640_10000018 Ga0207640_10000018118 496
113 3300025981 Ga0207640_10000552 Ga0207640_1000055221 496
114 3300026078 Ga0207702_10091948 Ga0207702_100919482 496
115 3300026116 Ga0207674_10012597 Ga0207674_100125976 496
116 3300026116 Ga0207674_10052187 Ga0207674_100521872 496
117 3300028794 Ga0307515_10000132 Ga0307515_1000013221 496
118 3300037471 Ga0395905_0062826 Ga0395905_0062826_1874_3433 496
119 3300046691 Ga0495670_0013561 Ga0495670_0013561_435_2045 496
120 3300048924 Ga0496121_0016952 Ga0496121_0016952_5426_7042 496
121 3300048928 Ga0496125_0001420 Ga0496125_0001420_1751_3367 496
122 3300005457 Ga0070662_100035349 Ga0070662_1000353492 497
123 3300013100 Ga0157373_10003230 Ga0157373_100032304 497
124 3300014497 Ga0182008_10000798 Ga0182008_100007987 497
125 3300015261 Ga0182006_1001734 Ga0182006_10017341 497
126 3300025933 Ga0207706_10031715 Ga0207706_100317152 497
127 3300048925 Ga0496122_0009741 Ga0496122_0009741_8314_9957 497
128 3300048928 Ga0496125_0062005 Ga0496125_0062005_1119_2762 497
129 3300003322 rootL2_10061224 rootL2_100612242 499
130 3300003752 Ga0055539_1000042 Ga0055539_100004283 499
131 3300003756 Ga0055533_1000006 Ga0055533_1000006256 499
132 3300003759 Ga0055525_1000940 Ga0055525_10009403 499
133 3300025226 Ga0209674_100003 Ga0209674_1000031081 499
134 3300025230 Ga0209563_100010 Ga0209563_100010809 499
135 3300025253 Ga0209677_100026 Ga0209677_100026126 499
136 3300050496 nmdc:mga07m45_14250_c1 nmdc:mga07m45_14250_c1_406_1986 499
137 3300005337 Ga0070682_100023656 Ga0070682_1000236562 500
138 3300028794 Ga0307515_10000026 Ga0307515_10000026266 500
139 3300035691 Ga0373931_0002933 Ga0373931_0002933_5310_6911 500
140 3300048927 Ga0496124_0030713 Ga0496124_0030713_2377_4011 500
141 3300002773 JGI25152J39213_1000004 JGI25152J39213_100000425 501
142 3300002773 JGI25152J39213_1000188 JGI25152J39213_10001885 501
143 3300002774 JGI25150J39212_1000438 JGI25150J39212_10004385 501
144 3300003187 JGI25151J46595_10000010 JGI25151J46595_1000001025 501
145 3300003215 JGI25153J46596_10000013 JGI25153J46596_1000001325 501
146 3300005563 Ga0068855_100003008 Ga0068855_10000300814 501
147 3300025245 Ga0207425_1000015 Ga0207425_1000015265 501
148 3300025258 Ga0209129_1000074 Ga0209129_1000074146 501
149 3300025294 Ga0209025_1000002 Ga0209025_10000021163 501
150 3300025297 Ga0209758_1000003 Ga0209758_10000031170 501
151 3300025949 Ga0207667_10002830 Ga0207667_100028303 501
152 3300026078 Ga0207702_10002612 Ga0207702_100026126 501
153 3300005327 Ga0070658_10003827 Ga0070658_100038273 502
154 3300005367 Ga0070667_100020773 Ga0070667_1000207732 502
155 3300042005 Ga0439448_0001498 Ga0439448_0001498_2838_4484 502
156 3300046665 Ga0495661_0004761 Ga0495661_0004761_1378_2955 502
157 3300003214 JGI25165J46597_1000566 JGI25165J46597_10005663 503
158 3300013104 Ga0157370_10000140 Ga0157370_1000014038 503
159 3300025272 Ga0209455_1000440 Ga0209455_100044028 503
160 3300048919 Ga0496116_0000280 Ga0496116_0000280_51208_52818 503
161 3300048925 Ga0496122_0000679 Ga0496122_0000679_63132_64742 503
162 3300048926 Ga0496123_0000273 Ga0496123_0000273_70794_72404 503
163 3300048928 Ga0496125_0002009 Ga0496125_0002009_13863_15473 503
164 3300048929 Ga0496126_0000097 Ga0496126_0000097_153811_155421 503
165 3300049522 Ga0501299_005017 Ga0501299_005017_99_1685 503
166 3300049523 Ga0501300_002498 Ga0501300_002498_764_2350 503
167 3300049704 Ga0501221_000455 Ga0501221_000455_4457_6043 503
168 iso_pu_bacteria 2738541297 2738826004 503
169 iso_pu_bacteria 2738541357 2739149801 503
170 iso_pu_bacteria 2738543003 2739191720 503
171 iso_pu_bacteria 2738543026 2739318197 503
172 iso_pu_bacteria 2738543029 2739336438 503
173 3300021361 Ga0213872_10000083 Ga0213872_1000008334 504
174 3300003316 rootH1_10022300 rootH1_100223001 505
175 iso_pu_bacteria 2643221639 2644218668 505
176 iso_pu_bacteria 2643221646 2644256764 505
177 iso_pu_bacteria 2738541337 2739058059 505
178 3300037471 Ga0395905_0031140 Ga0395905_0031140_239_1852 506
179 3300046520 Ga0495637_0000517 Ga0495637_0000517_8846_10414 506
180 3300046530 Ga0495654_0000005 Ga0495654_0000005_17598_19166 506
181 3300003771 Ga0055526_1000095 Ga0055526_100009554 507
182 3300009036 Ga0105244_10001449 Ga0105244_1000144915 507
183 3300025245 Ga0207425_1000427 Ga0207425_100042716 507
184 3300025294 Ga0209025_1001943 Ga0209025_100194317 507
185 3300025295 Ga0209564_1000026 Ga0209564_1000026470 507
186 3300025297 Ga0209758_1000270 Ga0209758_100027076 507
187 3300025728 Ga0207655_1004970 Ga0207655_10049708 507
188 3300046452 Ga0495617_000048 Ga0495617_000048_17747_19315 507
189 3300046463 Ga0495653_0000094 Ga0495653_0000094_17536_19104 507
190 3300046471 Ga0495650_0000227 Ga0495650_0000227_17528_19093 507
191 3300046471 Ga0495650_0015103 Ga0495650_0015103_352_1917 507
192 3300046492 Ga0495585_0003347 Ga0495585_0003347_8105_9673 507
193 3300046507 Ga0495606_0001466 Ga0495606_0001466_12332_13900 507
194 3300046512 Ga0495610_0000021 Ga0495610_0000021_17665_19233 507
195 3300046524 Ga0495648_0005053 Ga0495648_0005053_6231_7799 507
196 3300046524 Ga0495648_0007457 Ga0495648_0007457_2814_4382 507
197 3300046616 Ga0495668_0002420 Ga0495668_0002420_7205_8773 507
198 3300046660 Ga0495625_0002719 Ga0495625_0002719_11517_13085 507
199 3300046665 Ga0495661_0033854 Ga0495661_0033854_312_1880 507
200 3300046692 Ga0495671_0000310 Ga0495671_0000310_22162_23730 507
201 3300046810 Ga0495660_0004024 Ga0495660_0004024_538_2106 507
202 3300047469 Ga0495673_0000033 Ga0495673_0000033_16411_17979 507
203 3300047469 Ga0495673_0000150 Ga0495673_0000150_103321_104889 507
204 3300048926 Ga0496123_0010989 Ga0496123_0010989_843_2411 507
205 3300048927 Ga0496124_0030307 Ga0496124_0030307_652_2220 507
206 3300048927 Ga0496124_0058895 Ga0496124_0058895_1402_2970 507
207 3300048929 Ga0496126_0012448 Ga0496126_0012448_1443_3011 507
208 3300053125 Ga0500618_001044 Ga0500618_001044_3875_5437 507
209 3300053145 Ga0500586_001453 Ga0500586_001453_2307_3875 507
210 3300002705 JGI25156J39149_1000026 JGI25156J39149_100002666 508
211 3300003316 rootH1_10001460 rootH1_100014602 508
212 3300003320 rootH2_10005870 rootH2_100058702 508
213 3300003323 rootH1_10006711 rootH1_1000671110 508
214 3300003323 rootH1_10180860 rootH1_101808602 508
215 3300005330 Ga0070690_100000894 Ga0070690_1000008944 508
216 3300005334 Ga0068869_100049393 Ga0068869_1000493932 508
217 3300005364 Ga0070673_100081336 Ga0070673_1000813362 508
218 3300005539 Ga0068853_100049139 Ga0068853_1000491392 508
219 3300005577 Ga0068857_100010583 Ga0068857_1000105835 508
220 3300005614 Ga0068856_100003732 Ga0068856_1000037325 508
221 3300006195 Ga0075366_10034839 Ga0075366_100348391 508
222 3300013105 Ga0157369_10048674 Ga0157369_100486742 508
223 3300025231 Ga0207427_100220 Ga0207427_1002209 508
224 3300025242 Ga0209258_100474 Ga0209258_10047413 508
225 3300025246 Ga0209646_1000039 Ga0209646_1000039226 508
226 3300025250 Ga0209026_1000006 Ga0209026_1000006375 508
227 3300025256 Ga0209759_1000020 Ga0209759_100002030 508
228 3300025256 Ga0209759_1000291 Ga0209759_100029144 508
229 3300025256 Ga0209759_1005083 Ga0209759_10050832 508
230 3300025913 Ga0207695_10068371 Ga0207695_100683713 508
231 3300025942 Ga0207689_10066303 Ga0207689_100663032 508
232 3300025949 Ga0207667_10174406 Ga0207667_101744062 508
233 3300025960 Ga0207651_10003738 Ga0207651_100037384 508
234 3300031730 Ga0307516_10001414 Ga0307516_100014147 508
235 3300033180 Ga0307510_10001244 Ga0307510_1000124422 508
236 3300037466 Ga0395898_0002834 Ga0395898_0002834_2105_3691 508
237 3300038443 Ga0395901_0007644 Ga0395901_0007644_1501_3087 508
238 3300046457 Ga0495590_0000030 Ga0495590_0000030_138821_140392 508
239 3300046506 Ga0495583_0000034 Ga0495583_0000034_147030_148625 508
240 3300046507 Ga0495606_0005479 Ga0495606_0005479_1444_3039 508
241 3300046512 Ga0495610_0020020 Ga0495610_0020020_2082_3653 508
242 3300046522 Ga0495643_0001431 Ga0495643_0001431_5785_7356 508
243 3300046542 Ga0495597_0001389 Ga0495597_0001389_5796_7367 508
244 3300046616 Ga0495668_0000875 Ga0495668_0000875_18400_19971 508
245 3300046616 Ga0495668_0067849 Ga0495668_0067849_322_1917 508
246 3300046660 Ga0495625_0002731 Ga0495625_0002731_13862_15451 508
247 3300046660 Ga0495625_0009740 Ga0495625_0009740_4060_5691 508
248 3300046660 Ga0495625_0010502 Ga0495625_0010502_530_2125 508
249 3300046694 Ga0495649_0000052 Ga0495649_0000052_44446_46041 508
250 3300046694 Ga0495649_0003458 Ga0495649_0003458_1483_3054 508
251 3300046794 Ga0495589_0012665 Ga0495589_0012665_2072_3667 508
252 3300047320 Ga0495672_0000285 Ga0495672_0000285_62777_64348 508
253 3300047472 Ga0495686_0000162 Ga0495686_0000162_38184_39836 508
254 3300048928 Ga0496125_0016273 Ga0496125_0016273_1947_3539 508
255 3300049459 Ga0495678_000241 Ga0495678_000241_54290_55861 508
256 3300053080 Ga0500635_0012917 Ga0500635_0012917_539_2131 508
257 3300003316 rootH1_10006701 rootH1_1000670116 509
258 3300031548 Ga0307408_100000089 Ga0307408_10000008993 509
259 3300037471 Ga0395905_0064772 Ga0395905_0064772_1495_3108 509
260 3300037471 Ga0395905_0199860 Ga0395905_0199860_173_1795 509
261 3300042129 Ga0450891_000030 Ga0450891_000030_3043_4617 509
262 3300042144 Ga0450889_000154 Ga0450889_000154_1483_3057 509
263 3300046460 Ga0495638_0000577 Ga0495638_0000577_21506_23080 509
264 3300046471 Ga0495650_0008312 Ga0495650_0008312_445_2019 509
265 3300046501 Ga0495607_0001184 Ga0495607_0001184_18749_20380 509
266 3300046506 Ga0495583_0000202 Ga0495583_0000202_18385_19959 509
267 3300046522 Ga0495643_0000639 Ga0495643_0000639_20180_21754 509
268 3300046524 Ga0495648_0000192 Ga0495648_0000192_18385_19959 509
269 3300046524 Ga0495648_0021530 Ga0495648_0021530_517_2148 509
270 3300046542 Ga0495597_0000630 Ga0495597_0000630_10253_11827 509
271 3300046557 Ga0495622_0000337 Ga0495622_0000337_16695_18269 509
272 3300046558 Ga0495633_0000775 Ga0495633_0000775_18395_19969 509
273 3300046558 Ga0495633_0001583 Ga0495633_0001583_4149_5768 509
274 3300046660 Ga0495625_0001453 Ga0495625_0001453_8550_10124 509
275 3300046810 Ga0495660_0003693 Ga0495660_0003693_5654_7228 509
276 3300047443 Ga0495687_001222 Ga0495687_001222_6216_7790 509
277 3300047443 Ga0495687_001324 Ga0495687_001324_6179_7753 509
278 3300053145 Ga0500586_001190 Ga0500586_001190_1138_2757 509
279 3300009551 Ga0105238_10037554 Ga0105238_100375542 510
280 3300010375 Ga0105239_10036352 Ga0105239_100363522 510
281 3300013296 Ga0157374_10027500 Ga0157374_100275002 510
282 3300037471 Ga0395905_0003461 Ga0395905_0003461_10517_12133 510
283 3300044684 Ga0466966_0000893 Ga0466966_0000893_2987_4669 510
284 3300046492 Ga0495585_0056931 Ga0495585_0056931_319_1926 510
285 3300046507 Ga0495606_0000316 Ga0495606_0000316_18602_20179 510
286 3300046528 Ga0495642_0000174 Ga0495642_0000174_3649_5271 510
287 3300048927 Ga0496124_0023891 Ga0496124_0023891_1990_3621 510
288 3300025932 Ga0207690_10008661 Ga0207690_100086612 511
289 3300031730 Ga0307516_10008045 Ga0307516_100080457 511
290 3300037471 Ga0395905_0070117 Ga0395905_0070117_988_2589 511
291 3300041452 Ga0451793_0647515 Ga0451793_0647515_326_1948 511
292 3300042005 Ga0439448_0009318 Ga0439448_0009318_77_1711 511
293 3300046557 Ga0495622_0000342 Ga0495622_0000342_12805_14397 511
294 3300003323 rootH1_10044261 rootH1_100442612 512
295 3300005578 Ga0068854_100087744 Ga0068854_1000877442 512
296 3300044656 Ga0466969_0030475 Ga0466969_0030475_886_2508 512
297 3300044693 Ga0466961_0009691 Ga0466961_0009691_3585_5198 512
298 3300044719 Ga0466971_0006747 Ga0466971_0006747_2285_3898 512
299 3300044842 Ga0466957_0079680 Ga0466957_0079680_145_1758 512
300 3300045049 Ga0466959_0051365 Ga0466959_0051365_907_2529 512
301 3300045836 Ga0466958_0035388 Ga0466958_0035388_1285_2898 512
302 3300046460 Ga0495638_0001521 Ga0495638_0001521_27_1649 512
303 3300049571 Ga0501034_0015172 Ga0501034_0015172_4152_5783 512
304 3300061719 Ga0466962_0001038 Ga0466962_0001038_1406_3019 512
305 iso_pu_bacteria 2510917021 2511126323 512
306 iso_pu_bacteria 2643221579 2643908365 512
307 iso_pu_bacteria 2739367756 2739793427 512
308 iso_pu_bacteria 2747842501 2748017755 512
309 iso_pu_bacteria 2904424332 2904428839 512
310 iso_pu_bacteria 2923516293 2923517098 512
311 3300003323 rootH1_10031104 rootH1_100311042 513
312 3300003759 Ga0055525_1000001 Ga0055525_1000001388 513
313 3300005335 Ga0070666_10000008 Ga0070666_10000008169 513
314 3300005548 Ga0070665_100033848 Ga0070665_1000338482 513
315 3300009551 Ga0105238_10000335 Ga0105238_1000033543 513
316 3300013306 Ga0163162_10012837 Ga0163162_100128373 513
317 3300025230 Ga0209563_100007 Ga0209563_100007708 513
318 3300025903 Ga0207680_10000005 Ga0207680_1000000571 513
319 3300025909 Ga0207705_10006342 Ga0207705_100063422 513
320 3300025986 Ga0207658_10035076 Ga0207658_100350763 513
321 3300028379 Ga0268266_10000051 Ga0268266_1000005169 513
322 3300037312 Ga0395899_0016811 Ga0395899_0016811_600_2246 513
323 3300037418 Ga0395900_0009197 Ga0395900_0009197_3808_5454 513
324 3300037466 Ga0395898_0010944 Ga0395898_0010944_3730_5376 513
325 3300037471 Ga0395905_0000091 Ga0395905_0000091_7631_9247 513
326 3300037471 Ga0395905_0034558 Ga0395905_0034558_2274_3923 513
327 3300045836 Ga0466958_0000079 Ga0466958_0000079_9794_11413 513
328 3300046506 Ga0495583_0000480 Ga0495583_0000480_49448_51070 513
329 3300046513 Ga0495616_0000195 Ga0495616_0000195_20624_22246 513
330 3300046519 Ga0495632_0008099 Ga0495632_0008099_1201_2823 513
331 3300046523 Ga0495644_0008286 Ga0495644_0008286_344_1966 513
332 3300046538 Ga0495609_0000044 Ga0495609_0000044_50484_52106 513
333 3300046648 Ga0495611_0002942 Ga0495611_0002942_5728_7350 513
334 3300046660 Ga0495625_0027765 Ga0495625_0027765_1794_3416 513
335 3300046665 Ga0495661_0000426 Ga0495661_0000426_19235_20857 513
336 3300046794 Ga0495589_0000035 Ga0495589_0000035_50484_52106 513
337 3300047443 Ga0495687_000066 Ga0495687_000066_50484_52106 513
338 3300047445 Ga0495677_0000013 Ga0495677_0000013_109537_111159 513
339 3300047447 Ga0495685_019827 Ga0495685_019827_190_1812 513
340 3300048091 Ga0495626_0000071 Ga0495626_0000071_21991_23613 513
341 3300048091 Ga0495626_0012281 Ga0495626_0012281_2649_4271 513
342 3300048091 Ga0495626_0043322 Ga0495626_0043322_286_1908 513
343 3300048921 Ga0496118_0105874 Ga0496118_0105874_157_1776 513
344 3300048927 Ga0496124_0015607 Ga0496124_0015607_2196_3839 513
345 3300053178 Ga0500637_0000575 Ga0500637_0000575_3916_5529 513
346 iso_pu_bacteria 2643221556 2643802211 513
347 iso_pu_bacteria 2643221684 2644475719 513
348 3300002705 JGI25156J39149_1004036 JGI25156J39149_10040362 514
349 3300002737 JGI25162J39368_1000625 JGI25162J39368_10006259 514
350 3300002741 JGI25157J39369_1001103 JGI25157J39369_10011038 514
351 3300002741 JGI25157J39369_1001587 JGI25157J39369_10015871 514
352 3300002772 JGI25164J39214_1000048 JGI25164J39214_100004879 514
353 3300003214 JGI25165J46597_1000096 JGI25165J46597_100009691 514
354 3300003761 Ga0055535_1000823 Ga0055535_10008233 514
355 3300003762 Ga0055542_1000384 Ga0055542_100038424 514
356 3300003762 Ga0055542_1000486 Ga0055542_100048614 514
357 3300003763 Ga0055529_1000049 Ga0055529_1000049150 514
358 3300013105 Ga0157369_10020993 Ga0157369_100209936 514
359 3300025228 Ga0209672_100133 Ga0209672_10013325 514
360 3300025228 Ga0209672_101393 Ga0209672_1013934 514
361 3300025231 Ga0207427_100040 Ga0207427_100040148 514
362 3300025231 Ga0207427_101385 Ga0207427_1013854 514
363 3300025233 Ga0209437_100189 Ga0209437_10018978 514
364 3300025242 Ga0209258_100118 Ga0209258_100118127 514
365 3300025242 Ga0209258_100521 Ga0209258_10052114 514
366 3300025246 Ga0209646_1000741 Ga0209646_10007419 514
367 3300025250 Ga0209026_1000044 Ga0209026_1000044195 514
368 3300025250 Ga0209026_1001111 Ga0209026_10011115 514
369 3300025250 Ga0209026_1002186 Ga0209026_10021865 514
370 3300025254 Ga0209148_1000024 Ga0209148_1000024412 514
371 3300025254 Ga0209148_1000385 Ga0209148_100038521 514
372 3300025256 Ga0209759_1000759 Ga0209759_100075922 514
373 3300025256 Ga0209759_1001513 Ga0209759_10015133 514
374 3300025261 Ga0209233_1000108 Ga0209233_100010878 514
375 3300025261 Ga0209233_1000143 Ga0209233_1000143163 514
376 3300025272 Ga0209455_1000025 Ga0209455_1000025412 514
377 3300025299 Ga0209256_1008909 Ga0209256_10089094 514
378 3300026078 Ga0207702_10006080 Ga0207702_1000608010 514
379 3300037312 Ga0395899_0044456 Ga0395899_0044456_681_2318 514
380 3300037418 Ga0395900_0000875 Ga0395900_0000875_12480_14123 514
381 3300037466 Ga0395898_0000069 Ga0395898_0000069_163597_165201 514
382 3300042532 Ga0450893_0003065 Ga0450893_0003065_608_2224 514
383 3300044658 Ga0466972_0009228 Ga0466972_0009228_2885_4510 514
384 3300044693 Ga0466961_0034991 Ga0466961_0034991_56_1669 514
385 3300044706 Ga0466964_0000235 Ga0466964_0000235_2897_4522 514
386 3300044735 Ga0466968_0000415 Ga0466968_0000415_883_2508 514
387 3300046474 Ga0495605_0007359 Ga0495605_0007359_67_1707 514
388 3300046491 Ga0495584_0004029 Ga0495584_0004029_709_2349 514
389 3300046501 Ga0495607_0000791 Ga0495607_0000791_11070_12710 514
390 3300046513 Ga0495616_0010746 Ga0495616_0010746_1643_3283 514
391 3300046538 Ga0495609_0000009 Ga0495609_0000009_335907_337547 514
392 3300046665 Ga0495661_0000113 Ga0495661_0000113_17311_18951 514
393 3300046794 Ga0495589_0000037 Ga0495589_0000037_17316_18956 514
394 3300047443 Ga0495687_000168 Ga0495687_000168_17316_18956 514
395 3300047445 Ga0495677_0000011 Ga0495677_0000011_130882_132522 514
396 3300047469 Ga0495673_0001548 Ga0495673_0001548_3786_5408 514
397 3300047470 Ga0495681_0008972 Ga0495681_0008972_1432_3063 514
398 3300049571 Ga0501034_0116722 Ga0501034_0116722_651_2258 514
399 3300053122 Ga0500608_000084 Ga0500608_000084_35059_36669 514
400 iso_pu_bacteria 8002869464 8002870118 514
401 3300003759 Ga0055525_1000120 Ga0055525_100012050 515
402 3300003760 Ga0055527_1000058 Ga0055527_100005823 515
403 3300003760 Ga0055527_1000107 Ga0055527_100010726 515
404 3300003761 Ga0055535_1000325 Ga0055535_100032529 515
405 3300003761 Ga0055535_1000983 Ga0055535_10009836 515
406 3300003762 Ga0055542_1000149 Ga0055542_100014923 515
407 3300003762 Ga0055542_1000260 Ga0055542_100026029 515
408 3300003763 Ga0055529_1000289 Ga0055529_100028936 515
409 3300003763 Ga0055529_1000374 Ga0055529_100037414 515
410 3300005289 Ga0065704_10070370 Ga0065704_1007037016 515
411 3300005331 Ga0070670_100061379 Ga0070670_1000613792 515
412 3300005366 Ga0070659_100008751 Ga0070659_1000087516 515
413 3300006051 Ga0075364_10000300 Ga0075364_100003003 515
414 3300009036 Ga0105244_10000158 Ga0105244_1000015815 515
415 3300025226 Ga0209674_100394 Ga0209674_10039413 515
416 3300025228 Ga0209672_100024 Ga0209672_100024152 515
417 3300025230 Ga0209563_100067 Ga0209563_100067152 515
418 3300025242 Ga0209258_100047 Ga0209258_100047152 515
419 3300025253 Ga0209677_103649 Ga0209677_1036493 515
420 3300025254 Ga0209148_1000054 Ga0209148_1000054152 515
421 3300025272 Ga0209455_1000052 Ga0209455_1000052152 515
422 3300025292 Ga0209676_1000063 Ga0209676_1000063255 515
423 3300025728 Ga0207655_1000710 Ga0207655_100071011 515
424 3300025904 Ga0207647_10037171 Ga0207647_100371712 515
425 3300025932 Ga0207690_10033212 Ga0207690_100332122 515
426 3300031456 Ga0307513_10016752 Ga0307513_100167524 515
427 3300031548 Ga0307408_100000279 Ga0307408_10000027945 515
428 3300032004 Ga0307414_10001626 Ga0307414_100016262 515
429 3300037312 Ga0395899_0000183 Ga0395899_0000183_60253_61875 515
430 3300037418 Ga0395900_0000039 Ga0395900_0000039_194021_195631 515
431 3300037466 Ga0395898_0000140 Ga0395898_0000140_106426_108036 515
432 3300038443 Ga0395901_0197947 Ga0395901_0197947_282_1892 515
433 3300038443 Ga0395901_0245928 Ga0395901_0245928_40_1650 515
434 3300044661 Ga0466975_0142054 Ga0466975_0142054_25_1641 515
435 3300044693 Ga0466961_0002054 Ga0466961_0002054_5654_7270 515
436 3300044765 Ga0466970_0053522 Ga0466970_0053522_468_2084 515
437 3300045049 Ga0466959_0011694 Ga0466959_0011694_3317_4933 515
438 3300045049 Ga0466959_0060055 Ga0466959_0060055_264_1880 515
439 3300046512 Ga0495610_0018050 Ga0495610_0018050_1645_3267 515
440 3300046558 Ga0495633_0022330 Ga0495633_0022330_1500_3113 515
441 3300046665 Ga0495661_0001850 Ga0495661_0001850_604_2409 515
442 3300048905 Ga0496102_0025873 Ga0496102_0025873_2259_3902 515
443 3300048906 Ga0496103_0006104 Ga0496103_0006104_3076_4698 515
444 3300048906 Ga0496103_0091644 Ga0496103_0091644_28_1671 515
445 3300048917 Ga0496114_0056186 Ga0496114_0056186_664_2277 515
446 3300049459 Ga0495678_000002 Ga0495678_000002_930873_932504 515
447 3300049766 Ga0501269_000312 Ga0501269_000312_8278_9900 515
448 iso_pu_bacteria 8047673197 8047678365 515
449 3300002741 JGI25157J39369_1000967 JGI25157J39369_100096712 516
450 3300003323 rootH1_10044262 rootH1_100442623 516
451 3300005435 Ga0070714_100002914 Ga0070714_10000291410 516
452 3300005436 Ga0070713_100003831 Ga0070713_1000038312 516
453 3300014497 Ga0182008_10020044 Ga0182008_100200442 516
454 3300025250 Ga0209026_1000237 Ga0209026_100023749 516
455 3300025254 Ga0209148_1000280 Ga0209148_100028043 516
456 3300025256 Ga0209759_1007145 Ga0209759_10071452 516
457 3300025928 Ga0207700_10013158 Ga0207700_100131582 516
458 3300032004 Ga0307414_10017121 Ga0307414_100171213 516
459 3300037312 Ga0395899_0026990 Ga0395899_0026990_154_1773 516
460 3300037418 Ga0395900_0000297 Ga0395900_0000297_34060_35760 516
461 3300037471 Ga0395905_0165113 Ga0395905_0165113_88_1707 516
462 3300038443 Ga0395901_0000182 Ga0395901_0000182_45756_47390 516
463 3300046558 Ga0495633_0000181 Ga0495633_0000181_16743_18395 516
464 3300048909 Ga0496106_0047263 Ga0496106_0047263_472_2091 516
465 3300048910 Ga0496107_0020137 Ga0496107_0020137_1111_2730 516
466 3300048927 Ga0496124_0030207 Ga0496124_0030207_2478_4091 516
467 3300049571 Ga0501034_0228865 Ga0501034_0228865_27_1718 516
468 iso_pu_bacteria 2857553236 2857555900 516
469 iso_pu_bacteria 8054302542 8054306147 516
470 3300001979 JGI24740J21852_10006551 JGI24740J21852_100065512 517
471 3300001989 JGI24739J22299_10010483 JGI24739J22299_100104834 517
472 3300002067 JGI24735J21928_10024486 JGI24735J21928_100244861 517
473 3300002075 JGI24738J21930_10007731 JGI24738J21930_100077312 517
474 3300003322 rootL2_10049842 rootL2_100498422 517
475 3300005327 Ga0070658_10019464 Ga0070658_100194642 517
476 3300005455 Ga0070663_100001297 Ga0070663_10000129711 517
477 3300005455 Ga0070663_100005219 Ga0070663_1000052192 517
478 3300005539 Ga0068853_100005512 Ga0068853_1000055124 517
479 3300005563 Ga0068855_100008710 Ga0068855_1000087102 517
480 3300005578 Ga0068854_100001017 Ga0068854_1000010176 517
481 3300006237 Ga0097621_100019160 Ga0097621_1000191602 517
482 3300009093 Ga0105240_10000049 Ga0105240_1000004928 517
483 3300009093 Ga0105240_10003394 Ga0105240_1000339413 517
484 3300009176 Ga0105242_10004609 Ga0105242_100046092 517
485 3300009545 Ga0105237_10000630 Ga0105237_1000063014 517
486 3300009551 Ga0105238_10034728 Ga0105238_100347283 517
487 3300010375 Ga0105239_10000070 Ga0105239_1000007099 517
488 3300013102 Ga0157371_10000856 Ga0157371_1000085610 517
489 3300013104 Ga0157370_10036932 Ga0157370_100369323 517
490 3300025246 Ga0209646_1005796 Ga0209646_10057962 517
491 3300025250 Ga0209026_1000077 Ga0209026_100007790 517
492 3300025909 Ga0207705_10014504 Ga0207705_100145043 517
493 3300025913 Ga0207695_10000114 Ga0207695_10000114126 517
494 3300025913 Ga0207695_10000543 Ga0207695_1000054316 517
495 3300025914 Ga0207671_10000484 Ga0207671_1000048430 517
496 3300025934 Ga0207686_10001705 Ga0207686_100017053 517
497 3300025949 Ga0207667_10024867 Ga0207667_100248676 517
498 3300025981 Ga0207640_10000357 Ga0207640_1000035712 517
499 3300026041 Ga0207639_10004023 Ga0207639_100040238 517
500 3300026067 Ga0207678_10004112 Ga0207678_1000411210 517
501 3300026067 Ga0207678_10009362 Ga0207678_100093625 517
502 3300031548 Ga0307408_100000044 Ga0307408_10000004443 517
503 3300031901 Ga0307406_10000460 Ga0307406_1000046020 517
504 3300037312 Ga0395899_0025782 Ga0395899_0025782_1008_2813 517
505 3300037312 Ga0395899_0060294 Ga0395899_0060294_369_2003 517
506 3300038443 Ga0395901_0002267 Ga0395901_0002267_565_2370 517
507 3300042007 Ga0439449_0000148 Ga0439449_0000148_12142_13764 517
508 3300042876 Ga0451577_0001100 Ga0451577_0001100_17048_18751 517
509 3300044673 Ga0453683_0000388 Ga0453683_0000388_37772_39478 517
510 3300044842 Ga0466957_0000301 Ga0466957_0000301_18900_20534 517
511 3300045049 Ga0466959_0004379 Ga0466959_0004379_3628_5262 517
512 3300046453 Ga0495627_022856 Ga0495627_022856_181_1800 517
513 3300046500 Ga0495596_0000522 Ga0495596_0000522_7803_9425 517
514 3300046507 Ga0495606_0011434 Ga0495606_0011434_2061_3758 517
515 3300046512 Ga0495610_0004696 Ga0495610_0004696_963_2585 517
516 3300047443 Ga0495687_000215 Ga0495687_000215_41919_43616 517
517 3300048091 Ga0495626_0001607 Ga0495626_0001607_792_2414 517
518 3300048907 Ga0496104_0145134 Ga0496104_0145134_522_2156 517
519 3300048908 Ga0496105_0008394 Ga0496105_0008394_2598_4223 517
520 3300048920 Ga0496117_0004101 Ga0496117_0004101_4318_5943 517
521 3300048921 Ga0496118_0004682 Ga0496118_0004682_14349_15974 517
522 3300048922 Ga0496119_0000048 Ga0496119_0000048_30152_31777 517
523 3300048923 Ga0496120_0000519 Ga0496120_0000519_30095_31720 517
524 3300048927 Ga0496124_0023054 Ga0496124_0023054_3841_5466 517
525 3300049571 Ga0501034_0060956 Ga0501034_0060956_2030_3700 517
526 3300049822 Ga0501035_0021676 Ga0501035_0021676_691_2316 517
527 3300053161 Ga0500634_0000385 Ga0500634_0000385_12185_13804 517
528 iso_pu_bacteria 2687453130 2687583120 517
529 iso_pu_bacteria 2791355048 2792459984 517
530 iso_pu_bacteria 2849573788 2849575054 517
531 iso_pu_bacteria 2898329390 2898332455 517
532 3300005614 Ga0068856_100000012 Ga0068856_1000000127 518
533 3300009093 Ga0105240_10123731 Ga0105240_101237311 518
534 3300013105 Ga0157369_10007582 Ga0157369_100075826 518
535 3300025913 Ga0207695_10128193 Ga0207695_101281932 518
536 3300026078 Ga0207702_10000108 Ga0207702_1000010844 518
537 3300044656 Ga0466969_0001829 Ga0466969_0001829_5978_7588 518
538 3300044684 Ga0466966_0000185 Ga0466966_0000185_24451_26061 518
539 3300044693 Ga0466961_0000838 Ga0466961_0000838_9048_10658 518
540 3300044719 Ga0466971_0000321 Ga0466971_0000321_16077_17687 518
541 3300044765 Ga0466970_0000676 Ga0466970_0000676_3383_4993 518
542 3300045049 Ga0466959_0000324 Ga0466959_0000324_6877_8487 518
543 3300045836 Ga0466958_0001861 Ga0466958_0001861_2103_3713 518
544 3300045976 Ga0466967_0004988 Ga0466967_0004988_5993_7636 518
545 3300046474 Ga0495605_0000684 Ga0495605_0000684_12177_13799 518
546 3300046501 Ga0495607_0003449 Ga0495607_0003449_3143_4765 518
547 3300046615 Ga0495656_0006811 Ga0495656_0006811_777_2399 518
548 3300046794 Ga0495589_0001144 Ga0495589_0001144_1911_3533 518
549 3300046810 Ga0495660_0000057 Ga0495660_0000057_37083_38705 518
550 3300047320 Ga0495672_0003714 Ga0495672_0003714_10037_11659 518
551 3300047323 Ga0495683_0042646 Ga0495683_0042646_498_2120 518
552 3300047443 Ga0495687_000164 Ga0495687_000164_3143_4765 518
553 3300047445 Ga0495677_0000255 Ga0495677_0000255_7499_9121 518
554 3300047472 Ga0495686_0000356 Ga0495686_0000356_19777_21387 518
555 3300048091 Ga0495626_0000011 Ga0495626_0000011_240828_242450 518
556 3300048925 Ga0496122_0019844 Ga0496122_0019844_3759_5381 518
557 3300048926 Ga0496123_0011828 Ga0496123_0011828_2443_4065 518
558 3300048927 Ga0496124_0062069 Ga0496124_0062069_670_2292 518
559 3300061719 Ga0466962_0002853 Ga0466962_0002853_2216_3826 518
560 iso_pu_bacteria 2643221552 2643782316 518
561 iso_pu_bacteria 2851153111 2851155899 518
562 3300015261 Ga0182006_1000040 Ga0182006_100004026 519
563 3300015265 Ga0182005_1000051 Ga0182005_100005110 519
564 3300027111 Ga0209281_1004926 Ga0209281_10049262 519
565 3300033180 Ga0307510_10000038 Ga0307510_1000003819 519
566 3300046453 Ga0495627_000008 Ga0495627_000008_8718_10388 519
567 3300046522 Ga0495643_0060304 Ga0495643_0060304_24_1694 519
568 3300046523 Ga0495644_0003909 Ga0495644_0003909_1965_3635 519
569 3300046538 Ga0495609_0002111 Ga0495609_0002111_6979_8649 519
570 3300046810 Ga0495660_0000555 Ga0495660_0000555_25627_27291 519
571 3300046810 Ga0495660_0000839 Ga0495660_0000839_14375_16018 519
572 3300048919 Ga0496116_0027734 Ga0496116_0027734_2329_3993 519
573 3300037471 Ga0395905_0026323 Ga0395905_0026323_2488_4194 520
574 3300047472 Ga0495686_0029801 Ga0495686_0029801_801_2429 520
575 3300001904 JGI24736J21556_1005228 JGI24736J21556_10052282 522
576 3300001989 JGI24739J22299_10000764 JGI24739J22299_100007647 522
577 3300001990 JGI24737J22298_10000146 JGI24737J22298_100001464 522
578 3300001990 JGI24737J22298_10012744 JGI24737J22298_100127441 522
579 3300002067 JGI24735J21928_10001534 JGI24735J21928_100015347 522
580 3300002075 JGI24738J21930_10000047 JGI24738J21930_1000004719 522
581 3300005539 Ga0068853_100157940 Ga0068853_1001579402 522
582 3300005548 Ga0070665_100143704 Ga0070665_1001437041 522
583 3300005842 Ga0068858_100000499 Ga0068858_10000049933 522
584 3300025904 Ga0207647_10002960 Ga0207647_100029605 522
585 3300026035 Ga0207703_10001993 Ga0207703_1000199313 522
586 3300037312 Ga0395899_0000062 Ga0395899_0000062_103310_105136 522
587 3300042005 Ga0439448_0002529 Ga0439448_0002529_3086_4720 522
588 3300042157 Ga0439458_0003400 Ga0439458_0003400_1495_3129 522
589 3300044658 Ga0466972_0006972 Ga0466972_0006972_3490_5124 522
590 3300044693 Ga0466961_0021300 Ga0466961_0021300_2093_3742 522
591 3300044706 Ga0466964_0013264 Ga0466964_0013264_1165_2799 522
592 3300044765 Ga0466970_0032087 Ga0466970_0032087_485_2134 522
593 3300045049 Ga0466959_0050430 Ga0466959_0050430_428_2077 522
594 3300045836 Ga0466958_0023991 Ga0466958_0023991_1309_2958 522
595 3300046460 Ga0495638_0000502 Ga0495638_0000502_36377_38017 522
596 3300046506 Ga0495583_0000002 Ga0495583_0000002_363126_364766 522
597 3300046513 Ga0495616_0000008 Ga0495616_0000008_123313_124953 522
598 3300046524 Ga0495648_0010461 Ga0495648_0010461_4747_6387 522
599 3300046542 Ga0495597_0022682 Ga0495597_0022682_30_1670 522
600 3300053731 Ga0500609_000195 Ga0500609_000195_3822_5462 522
601 iso_pu_bacteria 2849560528 2849565008 522

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04616

Glyco_hydro_43

Glycosyl hydrolases family 43

56

328

0.97

PF17851

GH43_C2

Beta xylosidase C-terminal Concanavalin A-like domain

355

533

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ms2-assembly1.cif.gz_A-2 crystal structure of the gh43 blxynb protein from bacillus licheniformis 0.8966 34 514
6ms3-assembly1.cif.gz_B crystal structure of the gh43 protein blxynb mutant (k247s) from bacillus licheniformis 0.896 34 514
1yi7-assembly1.cif.gz_B beta-d-xylosidase (selenomethionine) xynd from clostridium acetobutylicum 0.8878 34 514
1yif-assembly1.cif.gz_D crystal structure of beta-1,4-xylosidase from bacillus subtilis, new york structural genomics consortium 0.8838 36 514
2exj-assembly1.cif.gz_D structure of the family43 beta-xylosidase d128g mutant from geobacillus stearothermophilus in complex with xylobiose 0.8823 36 514
ID Description Score Start End Superfamily
6ms2A01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8641 34 332 2.115.10.20
5z5iA02 Mainly Beta;Sandwich;Jelly Rolls; 0.8636 332 514 2.60.120.200
5z5fA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.862 34 309 2.115.10.20
5zqsA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8616 34 329 2.115.10.20
5jozB01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8585 34 328 2.115.10.20
ID Description Score Start End GO Terms
AF-A0A7X5N273-F1-model_v4 Family 43 glycosylhydrolase 0.9954 40 321 GO:0004553
GO:0005975
AF-A0A258GR49-F1-model_v4 Xylan 1,4-beta-xylosidase 0.9903 25 313 GO:0004553
GO:0005975
AF-A0A154QID8-F1-model_v4 Xylan 1,4-beta-xylosidase 0.9898 25 517 GO:0004553
GO:0005975
AF-A0A0Q7W0D6-F1-model_v4 Xylan 1,4-beta-xylosidase 0.9898 23 517 GO:0004553
GO:0005975
AF-A0A3D4LYV2-F1-model_v4 deleted 0.9896 25 260

Feature Viewer

pLDDT pTM Quality
91.94 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map