F468067

General Info

Members Datasets Scaffolds Average Seq Length
601 307 1202 249

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10112199|Ga0207700_101121992
Length 295
Sequence MSSNLPEGPPVPAEGRIGSGAPLLEVRDLIVHHGQLRALSGISLTVYPGEVYALIGANGAGKSTLLRTIAGLHRPTSGSISYDGRDVTGLRPEKRATAGIVMVPEGRRLFPSLTLEDNLKVGATYSRKGPWDVAAVFELFPWMKDRRSQRTAQMSGGEQQSVAIGRALVANPRMLLLDELSLGLAPVIVQRIYSMLPQILASGITVLLVEQDVSQALKVATHLQCLLEGHTTLEGTPAEVNREQVEAAYFGVNADHHKGTPPPPDRSNALWPGLTPLSRACSPEAFTRCSRAACR

Samples

Sample ID Description Type Environment
1 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
188 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
189 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
190 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
274 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
293 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
294 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
295 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
296 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
297 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
301 2643221714 Streptomyces sp. Root264 Isolate Unclassified
302 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
303 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
304 2867428634 Streptomyces sp. RP5T Isolate Unclassified
305 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
306 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
307 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.67
Metatranscriptomes 1.16
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0.33
Rhizoplane 6.16
Rhizosphere 90.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207700_10112199 3300025928 Bacteria 2196
2 JGI25406J46586_10000353 3300003203 Bacteria 20822
3 Ga0070676_10088071 3300005328 Bacteria 1896
4 Ga0070683_100009689 3300005329 Bacteria 8245
5 Ga0070683_100011648 3300005329 Bacteria 7613
6 Ga0070683_100070397 3300005329 Bacteria 3263
7 Ga0070683_100107883 3300005329 Bacteria 2625
8 Ga0070683_100519381 3300005329 Bacteria 1138
9 Ga0070670_100001189 3300005331 Bacteria 20636
10 Ga0070670_100055057 3300005331 Bacteria 3414
11 Ga0070680_100023483 3300005336 Bacteria 4918
12 Ga0070680_100351370 3300005336 Bacteria 1254
13 Ga0068868_100087200 3300005338 Bacteria 2510
14 Ga0070660_100038222 3300005339 Bacteria 3643
15 Ga0070660_100096332 3300005339 Bacteria 2340
16 Ga0070660_100220845 3300005339 Bacteria 1540
17 Ga0070689_100032053 3300005340 Bacteria 3995
18 Ga0070691_10153620 3300005341 Bacteria 1182
19 Ga0070661_100142395 3300005344 Bacteria 1808
20 Ga0070661_100264395 3300005344 Bacteria 1331
21 Ga0070668_100206090 3300005347 Bacteria 1616
22 Ga0070675_100009177 3300005354 Bacteria 7681
23 Ga0070674_100006916 3300005356 Bacteria 6649
24 Ga0070674_100060066 3300005356 Bacteria 2648
25 Ga0070688_100006031 3300005365 Bacteria 6432
26 Ga0070659_100281477 3300005366 Bacteria 1383
27 Ga0070709_10138122 3300005434 Bacteria 1671
28 Ga0070709_10201121 3300005434 Bacteria 1411
29 Ga0070714_100006117 3300005435 Bacteria 9250
30 Ga0070714_100015719 3300005435 Bacteria 6095
31 Ga0070714_100032951 3300005435 Bacteria 4329
32 Ga0070714_100133499 3300005435 Bacteria 2220
33 Ga0070714_100504734 3300005435 Bacteria 1154
34 Ga0070713_100002613 3300005436 Bacteria 11765
35 Ga0070713_100050678 3300005436 Bacteria 3430
36 Ga0070710_10087058 3300005437 Bacteria 1835
37 Ga0070711_100052016 3300005439 Bacteria 2817
38 Ga0070711_100076774 3300005439 Bacteria 2369
39 Ga0070711_100267606 3300005439 Bacteria 1347
40 Ga0070700_100015337 3300005441 Bacteria 4344
41 Ga0070708_100059600 3300005445 Bacteria 3404
42 Ga0070663_100448305 3300005455 Bacteria 1063
43 Ga0070681_10047039 3300005458 Bacteria 4313
44 Ga0070681_10149621 3300005458 Bacteria 2262
45 Ga0068867_100071410 3300005459 Bacteria 2597
46 Ga0070685_10291825 3300005466 Bacteria 1096
47 Ga0070707_100026788 3300005468 Bacteria 5477
48 Ga0070707_100043349 3300005468 Bacteria 4306
49 Ga0070698_100030798 3300005471 Bacteria 5563
50 Ga0070698_100146743 3300005471 Bacteria 2308
51 Ga0070699_100000051 3300005518 Bacteria 116174
52 Ga0070679_100013754 3300005530 Bacteria 7753
53 Ga0070679_100046598 3300005530 Bacteria 4320
54 Ga0070679_100117308 3300005530 Bacteria 2647
55 Ga0070679_100320506 3300005530 Bacteria 1499
56 Ga0070684_100012082 3300005535 Bacteria 6905
57 Ga0070684_100113840 3300005535 Bacteria 2428
58 Ga0070684_100614797 3300005535 Bacteria 1011
59 Ga0070684_100669706 3300005535 Bacteria 966
60 Ga0070684_100695443 3300005535 Bacteria 948
61 Ga0070697_100030880 3300005536 Bacteria 4306
62 Ga0068853_100262656 3300005539 Bacteria 1588
63 Ga0070686_100010484 3300005544 Bacteria 5228
64 Ga0070696_100525286 3300005546 Bacteria 945
65 Ga0070693_100562408 3300005547 Bacteria 818
66 Ga0070665_100027259 3300005548 Bacteria 5754
67 Ga0068855_100084917 3300005563 Bacteria 3664
68 Ga0070664_100010134 3300005564 Bacteria 7642
69 Ga0068857_100108767 3300005577 Bacteria 2491
70 Ga0068854_100046635 3300005578 Bacteria 3086
71 Ga0068856_100350508 3300005614 Bacteria 1495
72 Ga0070702_100360999 3300005615 Bacteria 1026
73 Ga0068859_100457727 3300005617 Bacteria 1372
74 Ga0068864_100031832 3300005618 Bacteria 4477
75 Ga0068864_100048441 3300005618 Bacteria 3653
76 Ga0068866_10026698 3300005718 Bacteria 2731
77 Ga0068866_10238220 3300005718 Bacteria 1107
78 Ga0068861_100208403 3300005719 Bacteria 1645
79 Ga0068870_10001003 3300005840 Bacteria 11148
80 Ga0068863_100878259 3300005841 Bacteria 896
81 Ga0081455_10020251 3300005937 Bacteria 6270
82 Ga0081540_1001294 3300005983 Bacteria 21844
83 Ga0081539_10000012 3300005985 Bacteria 440369
84 Ga0070717_10139017 3300006028 Bacteria 2094
85 Ga0070717_10479075 3300006028 Bacteria 1123
86 Ga0070717_10505790 3300006028 Bacteria 1092
87 Ga0070717_10608931 3300006028 Bacteria 991
88 Ga0075432_10058345 3300006058 Bacteria 1371
89 Ga0070715_10026540 3300006163 Bacteria 2306
90 Ga0070716_100006579 3300006173 Bacteria 5679
91 Ga0070716_100010091 3300006173 Bacteria 4726
92 Ga0070716_100142233 3300006173 Bacteria 1531
93 Ga0097621_100022203 3300006237 Bacteria 4923
94 Ga0097621_100095638 3300006237 Bacteria 2492
95 Ga0075428_100001601 3300006844 Bacteria 24210
96 Ga0075428_100003331 3300006844 Bacteria 17575
97 Ga0075428_100024473 3300006844 Bacteria 6682
98 Ga0075428_100086616 3300006844 Bacteria 3416
99 Ga0075428_100151566 3300006844 Bacteria 2519
100 Ga0075430_100001229 3300006846 Bacteria 20614
101 Ga0075430_100001779 3300006846 Bacteria 17608
102 Ga0075430_100011531 3300006846 Bacteria 7512
103 Ga0075430_100034520 3300006846 Bacteria 4293
104 Ga0075431_100012666 3300006847 Bacteria 8517
105 Ga0075431_100076094 3300006847 Bacteria 3464
106 Ga0075431_100163094 3300006847 Bacteria 2291
107 Ga0075433_10000068 3300006852 Bacteria 45762
108 Ga0075433_10269210 3300006852 Bacteria 1510
109 Ga0075433_10410607 3300006852 Bacteria 1194
110 Ga0075434_100035655 3300006871 Bacteria 4918
111 Ga0075434_100112045 3300006871 Bacteria 2739
112 Ga0075434_100514727 3300006871 Bacteria 1217
113 Ga0075429_100000896 3300006880 Bacteria 23544
114 Ga0075429_100001258 3300006880 Bacteria 20614
115 Ga0075429_100017338 3300006880 Bacteria 6227
116 Ga0068865_100308147 3300006881 Bacteria 1270
117 Ga0075436_100029363 3300006914 Bacteria 3781
118 Ga0097620_100457687 3300006931 Bacteria 1372
119 Ga0075435_100003400 3300007076 Bacteria 10789
120 Ga0075435_100046856 3300007076 Bacteria 3469
121 Ga0105251_10030918 3300009011 Bacteria 2684
122 Ga0105250_10094132 3300009092 Bacteria 1220
123 Ga0105240_11066453 3300009093 Bacteria 861
124 Ga0111539_10002993 3300009094 Bacteria 22418
125 Ga0111539_10388834 3300009094 Bacteria 1624
126 Ga0111539_10489612 3300009094 Bacteria 1432
127 Ga0111539_11115669 3300009094 Bacteria 916
128 Ga0105245_10094447 3300009098 Bacteria 2756
129 Ga0105245_10238306 3300009098 Bacteria 1762
130 Ga0105245_10424397 3300009098 Bacteria 1333
131 Ga0105247_10268004 3300009101 Bacteria 1173
132 Ga0114129_10001819 3300009147 Bacteria 29052
133 Ga0114129_10008968 3300009147 Bacteria 14262
134 Ga0114129_10009207 3300009147 Bacteria 14081
135 Ga0114129_10053911 3300009147 Bacteria 5640
136 Ga0114129_10063203 3300009147 Bacteria 5170
137 Ga0114129_10110153 3300009147 Bacteria 3801
138 Ga0105243_10073802 3300009148 Bacteria 2765
139 Ga0105243_10685613 3300009148 Bacteria 997
140 Ga0105242_10043513 3300009176 Bacteria 3633
141 Ga0105242_10123895 3300009176 Bacteria 2222
142 Ga0105242_10233842 3300009176 Bacteria 1648
143 Ga0105248_10609817 3300009177 Bacteria 1231
144 Ga0105248_11114873 3300009177 Bacteria 892
145 Ga0105249_10769985 3300009553 Bacteria 1025
146 Ga0105239_10018138 3300010375 Bacteria 7780
147 Ga0105239_10158207 3300010375 Bacteria 2531
148 Ga0105239_10368135 3300010375 Bacteria 1624
149 Ga0105246_10009665 3300011119 Bacteria 5944
150 Ga0105246_10018488 3300011119 Bacteria 4443
151 Ga0105246_10037633 3300011119 Bacteria 3248
152 Ga0105246_10140238 3300011119 Bacteria 1817
153 Ga0157373_10077086 3300013100 Bacteria 2351
154 Ga0157371_10332740 3300013102 Bacteria 1104
155 Ga0157370_10065147 3300013104 Bacteria 3448
156 Ga0157370_10135779 3300013104 Bacteria 2293
157 Ga0157369_10037180 3300013105 Bacteria 5331
158 Ga0157369_10063542 3300013105 Bacteria 3977
159 Ga0157369_10187465 3300013105 Bacteria 2175
160 Ga0157374_10060345 3300013296 Bacteria 3549
161 Ga0157374_10290593 3300013296 Bacteria 1615
162 Ga0163162_10151110 3300013306 Bacteria 2440
163 Ga0157375_10106863 3300013308 Bacteria 2891
164 Ga0157375_10315019 3300013308 Bacteria 1729
165 Ga0157375_10364443 3300013308 Bacteria 1611
166 Ga0163163_10016466 3300014325 Bacteria 6873
167 Ga0163163_10124184 3300014325 Bacteria 2618
168 Ga0163163_10351722 3300014325 Bacteria 1530
169 Ga0163163_10475583 3300014325 Bacteria 1310
170 Ga0157380_11081800 3300014326 Bacteria 840
171 Ga0182008_10000854 3300014497 Bacteria 21163
172 Ga0157377_10012930 3300014745 Bacteria 4210
173 Ga0157377_10070048 3300014745 Bacteria 2025
174 Ga0157377_10180995 3300014745 Bacteria 1325
175 Ga0157379_10007982 3300014968 Bacteria 9181
176 Ga0157379_10772028 3300014968 Bacteria 906
177 Ga0157376_10193756 3300014969 Bacteria 1865
178 Ga0182007_10000482 3300015262 Bacteria 24001
179 Ga0206353_10779140 3300020082 Bacteria 1465
180 Ga0213875_10000294 3300021388 Bacteria 48221
181 Ga0213875_10000442 3300021388 Bacteria 36242
182 Ga0224712_10002424 3300022467 Bacteria 4596
183 Ga0224712_10152205 3300022467 Bacteria 1026
184 Ga0207692_10027456 3300025898 Bacteria 2682
185 Ga0207692_10132236 3300025898 Bacteria 1410
186 Ga0207688_10003380 3300025901 Bacteria 8707
187 Ga0207699_10048627 3300025906 Bacteria 2492
188 Ga0207699_10199139 3300025906 Bacteria 1356
189 Ga0207643_10006379 3300025908 Bacteria 6317
190 Ga0207643_10007430 3300025908 Bacteria 5878
191 Ga0207684_10000002 3300025910 Bacteria 1042751
192 Ga0207707_10006329 3300025912 Bacteria 10338
193 Ga0207707_10015363 3300025912 Bacteria 6667
194 Ga0207707_10031688 3300025912 Bacteria 4627
195 Ga0207707_10121829 3300025912 Bacteria 2280
196 Ga0207693_10179935 3300025915 Bacteria 1664
197 Ga0207660_10017842 3300025917 Bacteria 4723
198 Ga0207660_10088409 3300025917 Bacteria 2291
199 Ga0207662_10004219 3300025918 Bacteria 7537
200 Ga0207657_10053828 3300025919 Bacteria 3483
201 Ga0207657_10103510 3300025919 Bacteria 2360
202 Ga0207649_10249631 3300025920 Bacteria 1277
203 Ga0207652_10004638 3300025921 Bacteria 11139
204 Ga0207652_10057226 3300025921 Bacteria 3357
205 Ga0207652_10086280 3300025921 Bacteria 2752
206 Ga0207652_10137831 3300025921 Bacteria 2180
207 Ga0207652_10412856 3300025921 Bacteria 1218
208 Ga0207646_10001226 3300025922 Bacteria 32220
209 Ga0207646_10010981 3300025922 Bacteria 8795
210 Ga0207646_10351759 3300025922 Bacteria 1331
211 Ga0207650_10039209 3300025925 Bacteria 3462
212 Ga0207659_10026366 3300025926 Bacteria 3920
213 Ga0207687_10011877 3300025927 Bacteria 5696
214 Ga0207687_10084313 3300025927 Bacteria 2303
215 Ga0207700_10014732 3300025928 Bacteria 5132
216 Ga0207700_10025585 3300025928 Bacteria 4101
217 Ga0207700_10065775 3300025928 Bacteria 2768
218 Ga0207700_10118618 3300025928 Bacteria 2141
219 Ga0207700_10184478 3300025928 Bacteria 1749
220 Ga0207700_10275105 3300025928 Bacteria 1446
221 Ga0207664_10012440 3300025929 Bacteria 6083
222 Ga0207664_10013739 3300025929 Bacteria 5824
223 Ga0207664_10014046 3300025929 Bacteria 5774
224 Ga0207664_10132772 3300025929 Bacteria 2098
225 Ga0207664_10243899 3300025929 Bacteria 1566
226 Ga0207690_10148908 3300025932 Bacteria 1733
227 Ga0207690_10161954 3300025932 Bacteria 1669
228 Ga0207706_10025158 3300025933 Bacteria 5337
229 Ga0207686_10026709 3300025934 Bacteria 3371
230 Ga0207686_10077746 3300025934 Bacteria 2155
231 Ga0207709_10674947 3300025935 Bacteria 825
232 Ga0207669_10041150 3300025937 Bacteria 2687
233 Ga0207704_10052538 3300025938 Bacteria 2471
234 Ga0207665_10024890 3300025939 Bacteria 3948
235 Ga0207711_10156964 3300025941 Bacteria 2057
236 Ga0207711_10875105 3300025941 Bacteria 836
237 Ga0207689_10282112 3300025942 Bacteria 1376
238 Ga0207689_10625271 3300025942 Bacteria 907
239 Ga0207661_10002273 3300025944 Bacteria 13240
240 Ga0207661_10068493 3300025944 Bacteria 2890
241 Ga0207661_10178629 3300025944 Bacteria 1852
242 Ga0207667_10108400 3300025949 Bacteria 2865
243 Ga0207640_10022169 3300025981 Bacteria 3797
244 Ga0207640_10064957 3300025981 Bacteria 2433
245 Ga0207677_10067547 3300026023 Bacteria 2505
246 Ga0207703_10210865 3300026035 Bacteria 1732
247 Ga0207639_10297870 3300026041 Bacteria 1425
248 Ga0207639_10396629 3300026041 Bacteria 1242
249 Ga0207708_10022026 3300026075 Bacteria 4810
250 Ga0207708_10091111 3300026075 Bacteria 2351
251 Ga0207702_10016362 3300026078 Bacteria 6140
252 Ga0207702_10114243 3300026078 Bacteria 2406
253 Ga0207702_10185777 3300026078 Bacteria 1917
254 Ga0207702_10601298 3300026078 Bacteria 1079
255 Ga0207641_10045964 3300026088 Bacteria 3679
256 Ga0207676_10023610 3300026095 Bacteria 4540
257 Ga0207676_10030356 3300026095 Bacteria 4057
258 Ga0207674_10059865 3300026116 Bacteria 3853
259 Ga0207674_10060880 3300026116 Bacteria 3816
260 Ga0207675_100952250 3300026118 Bacteria 876
261 Ga0207683_10036211 3300026121 Bacteria 4296
262 Ga0207428_10121789 3300027907 Bacteria 2000
263 Ga0265337_1002314 3300028556 Bacteria 8842
264 Ga0265334_10000207 3300028573 Bacteria 34007
265 Ga0265318_10015860 3300028577 Bacteria 3122
266 Ga0265336_10005142 3300028666 Bacteria 4863
267 Ga0265338_10009182 3300028800 Bacteria 11856
268 Ga0265338_10020567 3300028800 Bacteria 6937
269 Ga0265338_10036869 3300028800 Bacteria 4668
270 Ga0265338_10268800 3300028800 Bacteria 1250
271 Ga0265770_1008945 3300030878 Bacteria 1437
272 Ga0265760_10060510 3300031090 Bacteria 1150
273 Ga0265332_10007900 3300031238 Bacteria 4794
274 Ga0265320_10038961 3300031240 Bacteria 2379
275 Ga0265325_10007474 3300031241 Bacteria 6535
276 Ga0265340_10004578 3300031247 Bacteria 7700
277 Ga0265339_10011885 3300031249 Bacteria 5340
278 Ga0265316_10053685 3300031344 Bacteria 3157
279 Ga0265316_10272430 3300031344 Bacteria 1238
280 Ga0307513_10050168 3300031456 Bacteria 4514
281 Ga0307508_10171531 3300031616 Bacteria 1773
282 Ga0307508_10185427 3300031616 Bacteria 1683
283 Ga0265314_10005783 3300031711 Bacteria 11095
284 Ga0307406_10706883 3300031901 Bacteria 842
285 Ga0307409_100373565 3300031995 Bacteria 1353
286 Ga0307507_10000003 3300033179 Bacteria 371707
287 Ga0373940_0053661 3300035088 Bacteria 1138
288 Ga0373923_0082640 3300035111 Bacteria 1395
289 Ga0373936_0228350 3300035113 Bacteria 827
290 Ga0373939_0020456 3300035114 Bacteria 1798
291 Ga0373945_0056024 3300035116 Bacteria 1461
292 Ga0373945_0228240 3300035116 Bacteria 780
293 Ga0373953_0005138 3300035117 Bacteria 4228
294 Ga0373954_0046600 3300035118 Bacteria 2027
295 Ga0373956_0086521 3300035119 Bacteria 1443
296 Ga0373957_0009376 3300035120 Bacteria 3202
297 Ga0373957_0050739 3300035120 Bacteria 1586
298 Ga0373943_0400349 3300035170 Bacteria 792
299 Ga0373946_0040348 3300035171 Bacteria 1909
300 Ga0373946_0235532 3300035171 Bacteria 888
301 Ga0373955_0026142 3300035172 Bacteria 3003
302 Ga0373955_0101125 3300035172 Bacteria 1655
303 Ga0373961_0097579 3300035241 Bacteria 947
304 Ga0373924_0006422 3300035410 Bacteria 4213
305 Ga0373924_0016620 3300035410 Bacteria 2811
306 Ga0373924_0052137 3300035410 Bacteria 1697
307 Ga0373931_0109758 3300035691 Bacteria 1563
308 Ga0373935_0000236 3300035692 Bacteria 27178
309 Ga0373935_0169879 3300035692 Bacteria 1491
310 Ga0373927_0213542 3300035695 Bacteria 1267
311 Ga0373933_0009616 3300035724 Bacteria 5281
312 Ga0373933_0076457 3300035724 Bacteria 2045
313 Ga0373947_0000013 3300035725 Bacteria 145159
314 Ga0373947_0063363 3300035725 Bacteria 2252
315 Ga0373937_0541476 3300036401 Bacteria 1106
316 Ga0372808_013140 3300036459 Bacteria 1179
317 Ga0372808_014849 3300036459 Bacteria 1113
318 Ga0373925_0000028 3300037068 Bacteria 149654
319 Ga0373925_0015367 3300037068 Bacteria 5536
320 Ga0395899_0001923 3300037312 Bacteria 17116
321 Ga0395899_0060360 3300037312 Bacteria 2794
322 Ga0395899_0064637 3300037312 Bacteria 2690
323 Ga0395900_0002851 3300037418 Bacteria 18865
324 Ga0395900_0009392 3300037418 Bacteria 10027
325 Ga0395900_0016031 3300037418 Bacteria 7635
326 Ga0395900_0024090 3300037418 Bacteria 6230
327 Ga0395900_0085798 3300037418 Bacteria 3235
328 Ga0395900_0640048 3300037418 Bacteria 1001
329 Ga0395898_0012426 3300037466 Bacteria 8803
330 Ga0395898_0016365 3300037466 Bacteria 7590
331 Ga0395898_0019679 3300037466 Bacteria 6866
332 Ga0395898_0038228 3300037466 Bacteria 4757
333 Ga0395905_0003155 3300037471 Bacteria 17753
334 Ga0395905_0028101 3300037471 Bacteria 5303
335 Ga0436364_0029165 3300037853 Bacteria 38556
336 Ga0436364_1476073 3300037853 Bacteria 87559
337 Ga0395901_0004061 3300038443 Bacteria 14739
338 Ga0395901_0006825 3300038443 Bacteria 11526
339 Ga0395901_0027273 3300038443 Bacteria 5867
340 Ga0436361_0856678 3300039447 Bacteria 823
341 Ga0451793_1532201 3300041452 Bacteria 1733
342 Ga0451851_0361118 3300041507 Bacteria 7123
343 Ga0450917_003047 3300042120 Bacteria 1208
344 Ga0450906_003360 3300042145 Bacteria 3449
345 Ga0466961_0082614 3300044693 Bacteria 2032
346 Ga0466963_0051024 3300044694 Bacteria 2741
347 Ga0466963_0122037 3300044694 Bacteria 1794
348 Ga0466963_0165869 3300044694 Bacteria 1538
349 Ga0466963_0510669 3300044694 Bacteria 849
350 Ga0466968_0025694 3300044735 Bacteria 2413
351 Ga0466968_0044274 3300044735 Bacteria 1886
352 Ga0466957_0149717 3300044842 Bacteria 1508
353 Ga0466959_0007402 3300045049 Bacteria 7702
354 Ga0466959_0078747 3300045049 Bacteria 2377
355 Ga0466958_0198556 3300045836 Bacteria 1276
356 Ga0466958_0295989 3300045836 Bacteria 1039
357 Ga0466967_0599065 3300045976 Bacteria 1087
358 Ga0495603_0051021 3300046455 Bacteria 2459
359 Ga0495629_0002559 3300046459 Bacteria 13946
360 Ga0495651_0000091 3300046462 Bacteria 66174
361 Ga0495651_0002503 3300046462 Bacteria 14207
362 Ga0495651_0150726 3300046462 Bacteria 1676
363 Ga0495653_0041633 3300046463 Bacteria 3584
364 Ga0495653_0201925 3300046463 Bacteria 1349
365 Ga0495653_0215143 3300046463 Bacteria 1295
366 Ga0495639_0052774 3300046475 Bacteria 1851
367 Ga0495639_0079879 3300046475 Bacteria 1522
368 Ga0495664_0059941 3300046477 Bacteria 2265
369 Ga0495608_0189517 3300046511 Bacteria 1299
370 Ga0495618_0046438 3300046514 Bacteria 2741
371 Ga0495628_0077291 3300046516 Bacteria 2589
372 Ga0495628_0109168 3300046516 Bacteria 2129
373 Ga0495628_0390058 3300046516 Bacteria 1019
374 Ga0495630_0020307 3300046517 Bacteria 4898
375 Ga0495630_0515349 3300046517 Bacteria 917
376 Ga0495642_0067488 3300046528 Bacteria 1492
377 Ga0495652_0004600 3300046529 Bacteria 13154
378 Ga0495652_0007960 3300046529 Bacteria 9730
379 Ga0495652_0126045 3300046529 Bacteria 2034
380 Ga0495652_0201665 3300046529 Bacteria 1509
381 Ga0495640_0041489 3300046533 Bacteria 3216
382 Ga0495586_0028809 3300046535 Bacteria 2971
383 Ga0495586_0051346 3300046535 Bacteria 2232
384 Ga0495586_0108905 3300046535 Bacteria 1541
385 Ga0495587_0001406 3300046536 Bacteria 15995
386 Ga0495587_0110798 3300046536 Bacteria 1577
387 Ga0495645_0025003 3300046543 Bacteria 4334
388 Ga0495667_0012762 3300046559 Bacteria 5692
389 Ga0495667_0049436 3300046559 Bacteria 2776
390 Ga0495667_0067104 3300046559 Bacteria 2344
391 Ga0495656_0063881 3300046615 Bacteria 1615
392 Ga0495634_0004549 3300046642 Bacteria 10847
393 Ga0495634_0033314 3300046642 Bacteria 3540
394 Ga0495634_0057880 3300046642 Bacteria 2586
395 Ga0495635_0005204 3300046663 Bacteria 9051
396 Ga0495635_0021007 3300046663 Bacteria 4550
397 Ga0495635_0217550 3300046663 Bacteria 1293
398 Ga0495659_0041476 3300046664 Bacteria 1644
399 Ga0495657_0019918 3300046675 Bacteria 4834
400 Ga0495657_0026459 3300046675 Bacteria 4107
401 Ga0495657_0029143 3300046675 Bacteria 3875
402 Ga0495623_0040145 3300046679 Bacteria 2989
403 Ga0495623_0172950 3300046679 Bacteria 1260
404 Ga0495646_0045384 3300046680 Bacteria 2684
405 Ga0495646_0051354 3300046680 Bacteria 2496
406 Ga0495658_0000299 3300046683 Bacteria 28208
407 Ga0495658_0015824 3300046683 Bacteria 3876
408 Ga0495658_0139822 3300046683 Bacteria 1480
409 Ga0495613_0002159 3300046689 Bacteria 14909
410 Ga0495613_0150352 3300046689 Bacteria 1661
411 Ga0495624_0023268 3300046690 Bacteria 4087
412 Ga0495600_0012931 3300046809 Bacteria 5231
413 Ga0495600_0024881 3300046809 Bacteria 3854
414 Ga0495600_0101847 3300046809 Bacteria 1872
415 Ga0495581_0005318 3300047315 Bacteria 7448
416 Ga0495581_0205939 3300047315 Bacteria 1150
417 Ga0495604_0018062 3300047317 Bacteria 5644
418 Ga0495604_0019942 3300047317 Bacteria 5360
419 Ga0495604_0020497 3300047317 Bacteria 5281
420 Ga0495604_0120587 3300047317 Bacteria 1899
421 Ga0495674_0042357 3300047319 Bacteria 4061
422 Ga0495674_0169857 3300047319 Bacteria 1820
423 Ga0495676_0077013 3300047321 Bacteria 2544
424 Ga0495676_0098035 3300047321 Bacteria 2176
425 Ga0495680_0057110 3300047322 Bacteria 3020
426 Ga0495680_0087408 3300047322 Bacteria 2344
427 Ga0495680_0211358 3300047322 Bacteria 1389
428 Ga0495675_0050811 3300047444 Bacteria 2635
429 Ga0495675_0301729 3300047444 Bacteria 951
430 Ga0495684_0034105 3300047471 Bacteria 3905
431 Ga0495684_0072307 3300047471 Bacteria 2620
432 Ga0495684_0232816 3300047471 Bacteria 1347
433 Ga0495684_0349075 3300047471 Bacteria 1051
434 Ga0495593_0151188 3300047673 Bacteria 1174
435 Ga0495593_0287829 3300047673 Bacteria 822
436 Ga0495602_0047500 3300048088 Bacteria 3867
437 Ga0495602_0060754 3300048088 Bacteria 3291
438 Ga0495602_0061356 3300048088 Bacteria 3270
439 Ga0495602_0087321 3300048088 Bacteria 2600
440 Ga0496101_0068996 3300048904 Bacteria 2586
441 Ga0496101_0088366 3300048904 Bacteria 2302
442 Ga0496102_0025339 3300048905 Bacteria 5279
443 Ga0496102_0246124 3300048905 Bacteria 1686
444 Ga0496102_0471926 3300048905 Bacteria 1176
445 Ga0496103_0017530 3300048906 Bacteria 4287
446 Ga0496104_0000151 3300048907 Bacteria 64587
447 Ga0496104_0003033 3300048907 Bacteria 14467
448 Ga0496104_0107061 3300048907 Bacteria 2679
449 Ga0496105_0000049 3300048908 Bacteria 94762
450 Ga0496105_0245657 3300048908 Bacteria 1451
451 Ga0496108_0005502 3300048911 Bacteria 10247
452 Ga0496108_0028180 3300048911 Bacteria 4646
453 Ga0496108_0171787 3300048911 Bacteria 1876
454 Ga0496108_0229916 3300048911 Bacteria 1613
455 Ga0496108_0497962 3300048911 Bacteria 1064
456 Ga0496108_0639250 3300048911 Bacteria 925
457 Ga0496109_0000205 3300048912 Bacteria 58240
458 Ga0496109_0289935 3300048912 Bacteria 1543
459 Ga0496110_0000345 3300048913 Bacteria 30982
460 Ga0496110_0005185 3300048913 Bacteria 10193
461 Ga0496110_0097446 3300048913 Bacteria 2635
462 Ga0496110_0460712 3300048913 Bacteria 1158
463 Ga0496111_0000755 3300048914 Bacteria 17269
464 Ga0496111_0016489 3300048914 Bacteria 5091
465 Ga0496111_0106811 3300048914 Bacteria 2060
466 Ga0496111_0163123 3300048914 Bacteria 1655
467 Ga0496112_0027522 3300048915 Bacteria 5482
468 Ga0496113_0125989 3300048916 Bacteria 2006
469 Ga0496114_0000129 3300048917 Bacteria 54506
470 Ga0496114_0004229 3300048917 Bacteria 11123
471 Ga0496114_0036374 3300048917 Bacteria 4070
472 Ga0496114_0041348 3300048917 Bacteria 3820
473 Ga0496115_0102770 3300048918 Bacteria 2344
474 Ga0496115_0175250 3300048918 Bacteria 1773
475 Ga0496115_0300339 3300048918 Bacteria 1316
476 Ga0496126_0041171 3300048929 Bacteria 4278
477 Ga0501294_003793 3300049517 Bacteria 1425
478 Ga0501031_0015909 3300049568 Bacteria 4884
479 Ga0501031_0092424 3300049568 Bacteria 1974
480 Ga0501032_0079142 3300049569 Bacteria 2188
481 Ga0501036_0013311 3300049572 Bacteria 6831
482 Ga0501036_0020467 3300049572 Bacteria 5557
483 Ga0501036_0020676 3300049572 Bacteria 5529
484 Ga0501037_0116243 3300049573 Bacteria 1925
485 Ga0501038_0020840 3300049574 Bacteria 5891
486 Ga0501038_0052690 3300049574 Bacteria 3507
487 Ga0501038_0287387 3300049574 Bacteria 1293
488 Ga0501039_0028066 3300049575 Bacteria 4329
489 Ga0501039_0039130 3300049575 Bacteria 3662
490 Ga0501039_0128674 3300049575 Bacteria 1987
491 Ga0501040_0047724 3300049576 Bacteria 2924
492 Ga0501041_0006395 3300049577 Bacteria 6893
493 Ga0501041_0051207 3300049577 Bacteria 2516
494 Ga0501041_0081969 3300049577 Bacteria 1987
495 Ga0501042_0007880 3300049578 Bacteria 7007
496 Ga0501042_0020876 3300049578 Bacteria 4560
497 Ga0501043_0019343 3300049579 Bacteria 5346
498 Ga0501043_0065219 3300049579 Bacteria 2859
499 Ga0501046_0000208 3300049580 Bacteria 60966
500 Ga0501046_0043591 3300049580 Bacteria 3571
501 Ga0501046_0045801 3300049580 Bacteria 3473
502 Ga0501047_0238762 3300049581 Bacteria 1669
503 Ga0501048_0010879 3300049582 Bacteria 6786
504 Ga0501048_0016586 3300049582 Bacteria 5431
505 Ga0501067_0003611 3300049583 Bacteria 8524
506 Ga0501068_0037772 3300049584 Bacteria 2891
507 Ga0501068_0055751 3300049584 Bacteria 2395
508 Ga0501069_0003672 3300049585 Bacteria 7900
509 Ga0501069_0038976 3300049585 Bacteria 2624
510 Ga0501069_0160435 3300049585 Bacteria 1295
511 Ga0501069_0175175 3300049585 Bacteria 1239
512 Ga0501070_0006369 3300049586 Bacteria 10046
513 Ga0501071_0008309 3300049587 Bacteria 6857
514 Ga0501071_0117871 3300049587 Bacteria 1966
515 Ga0501072_0012982 3300049588 Bacteria 6375
516 Ga0501072_0014558 3300049588 Bacteria 6027
517 Ga0501072_0212131 3300049588 Bacteria 1543
518 Ga0501074_0042330 3300049590 Bacteria 3295
519 Ga0501074_0162997 3300049590 Bacteria 1592
520 Ga0501074_0245393 3300049590 Bacteria 1273
521 Ga0501075_0004159 3300049591 Bacteria 9771
522 Ga0501075_0336928 3300049591 Bacteria 1149
523 Ga0501076_0017968 3300049592 Bacteria 5379
524 Ga0501076_0028410 3300049592 Bacteria 4343
525 Ga0501076_0092318 3300049592 Bacteria 2435
526 Ga0501076_0327468 3300049592 Bacteria 1257
527 Ga0501077_0005558 3300049593 Bacteria 7672
528 Ga0501077_0018529 3300049593 Bacteria 4403
529 Ga0501198_030715 3300049649 Bacteria 896
530 Ga0501206_004618 3300049653 Bacteria 1757
531 Ga0501079_0008124 3300049741 Bacteria 7951
532 Ga0501079_0046862 3300049741 Bacteria 3336
533 Ga0501079_0077768 3300049741 Bacteria 2566
534 Ga0501080_0127769 3300049742 Bacteria 2353
535 Ga0501080_0202852 3300049742 Bacteria 1820
536 Ga0501080_0245432 3300049742 Bacteria 1633
537 Ga0501081_0005539 3300049743 Bacteria 8149
538 Ga0501081_0008076 3300049743 Bacteria 6831
539 Ga0501081_0029713 3300049743 Bacteria 3695
540 Ga0501083_0005637 3300049744 Bacteria 8866
541 Ga0501083_0098975 3300049744 Bacteria 1924
542 Ga0501035_0016768 3300049822 Bacteria 6754
543 Ga0501035_0031586 3300049822 Bacteria 4823
544 Ga0501035_0138474 3300049822 Bacteria 2117
545 Ga0501044_0022727 3300049823 Bacteria 6678
546 Ga0501044_0780102 3300049823 Bacteria 836
547 Ga0501045_0004396 3300049824 Bacteria 9720
548 Ga0501045_0010142 3300049824 Bacteria 6592
549 Ga0501045_0016513 3300049824 Bacteria 5245
550 Ga0501045_0025745 3300049824 Bacteria 4230
551 nmdc:mga05p37_12914_c1 3300050507 Bacteria 9989
552 nmdc:mga05p37_15909_c1 3300050507 Bacteria 9050
553 nmdc:mga05p37_64337_c1 3300050507 Bacteria 4513
554 nmdc:mga09592_279905_c1 3300050508 Bacteria 1447
555 nmdc:mga09592_53049_c1 3300050508 Bacteria 3423
556 nmdc:mga09592_82450_c1 3300050508 Bacteria 2740
557 nmdc:mga0qj67_179514_c1 3300050509 Bacteria 1719
558 nmdc:mga0qj67_427566_c1 3300050509 Bacteria 1068
559 nmdc:mga06r32_336821_c1 3300050510 Bacteria 1494
560 nmdc:mga06r32_59834_c1 3300050510 Bacteria 3665
561 nmdc:mga06r32_605839_c1 3300050510 Bacteria 1066
562 nmdc:mga08y16_310865_c1 3300050511 Bacteria 1623
563 nmdc:mga08y16_38304_c1 3300050511 Bacteria 5035
564 nmdc:mga08y16_869275_c1 3300050511 Bacteria 890
565 nmdc:mga0n895_82006_c1 3300050512 Bacteria 3215
566 nmdc:mga0rr50_316686_c1 3300050513 Bacteria 1307
567 nmdc:mga0rr50_721020_c1 3300050513 Bacteria 851
568 nmdc:mga08x19_23529_c1 3300050514 Bacteria 3822
569 nmdc:mga0a205_166559_c1 3300050515 Bacteria 2100
570 Ga0495601_0013597 3300053077 Bacteria 4896
571 Ga0495601_0021132 3300053077 Bacteria 3983
572 Ga0495601_0032412 3300053077 Bacteria 3253
573 Ga0495612_0002034 3300053078 Bacteria 8329
574 Ga0495612_0043209 3300053078 Bacteria 1841
575 Ga0495595_0004440 3300053084 Bacteria 5646
576 Ga0495619_0000115 3300053085 Bacteria 58866
577 Ga0495619_0008081 3300053085 Bacteria 6658
578 Ga0495619_0022662 3300053085 Bacteria 4022
579 Ga0495619_0118827 3300053085 Bacteria 1811
580 Ga0500646_0000208 3300053090 Bacteria 17594
581 Ga0500618_000343 3300053125 Bacteria 33406
582 Ga0500636_0186880 3300053177 Bacteria 1107
583 Ga0501084_0018640 3300054114 Bacteria 5777
584 Ga0501084_0020843 3300054114 Bacteria 5467
585 Ga0501084_0027717 3300054114 Bacteria 4733
586 Ga0501084_0083557 3300054114 Bacteria 2680
587 Ga0501084_0088882 3300054114 Bacteria 2593
588 Ga0501082_0011358 3300060353 Bacteria 7658
589 Ga0501082_0017336 3300060353 Bacteria 6204
590 Ga0501082_0037244 3300060353 Bacteria 4192
591 Ga0530510_0013390 3300061734 Bacteria 5766
592 Ga0530510_0080655 3300061734 Bacteria 2368
593 Ga0530510_0091806 3300061734 Bacteria 2216
594 Ga0530510_0192593 3300061734 Bacteria 1513
595 2644625937 2643221714 Bacteria 9015452
596 2671694390 2671180139 Bacteria 4196045
597 2862389799 2862382967 Bacteria 10317375
598 2867432436 2867428634 Bacteria 9590268
599 2877676818 2877676314 Bacteria 9512378
600 2891052125 2891048133 Bacteria 4447501
601 8008564305 8008558824 Bacteria 10610750
602 Ga0207700_10112199
603 JGI25406J46586_10000353
604 Ga0070676_10088071
605 Ga0070683_100009689
606 Ga0070683_100011648
607 Ga0070683_100070397
608 Ga0070683_100107883
609 Ga0070683_100519381
610 Ga0070670_100001189
611 Ga0070670_100055057
612 Ga0070680_100023483
613 Ga0070680_100351370
614 Ga0068868_100087200
615 Ga0070660_100038222
616 Ga0070660_100096332
617 Ga0070660_100220845
618 Ga0070689_100032053
619 Ga0070691_10153620
620 Ga0070661_100142395
621 Ga0070661_100264395
622 Ga0070668_100206090
623 Ga0070675_100009177
624 Ga0070674_100006916
625 Ga0070674_100060066
626 Ga0070688_100006031
627 Ga0070659_100281477
628 Ga0070709_10138122
629 Ga0070709_10201121
630 Ga0070714_100006117
631 Ga0070714_100015719
632 Ga0070714_100032951
633 Ga0070714_100133499
634 Ga0070714_100504734
635 Ga0070713_100002613
636 Ga0070713_100050678
637 Ga0070710_10087058
638 Ga0070711_100052016
639 Ga0070711_100076774
640 Ga0070711_100267606
641 Ga0070700_100015337
642 Ga0070708_100059600
643 Ga0070663_100448305
644 Ga0070681_10047039
645 Ga0070681_10149621
646 Ga0068867_100071410
647 Ga0070685_10291825
648 Ga0070707_100026788
649 Ga0070707_100043349
650 Ga0070698_100030798
651 Ga0070698_100146743
652 Ga0070699_100000051
653 Ga0070679_100013754
654 Ga0070679_100046598
655 Ga0070679_100117308
656 Ga0070679_100320506
657 Ga0070684_100012082
658 Ga0070684_100113840
659 Ga0070684_100614797
660 Ga0070684_100669706
661 Ga0070684_100695443
662 Ga0070697_100030880
663 Ga0068853_100262656
664 Ga0070686_100010484
665 Ga0070696_100525286
666 Ga0070693_100562408
667 Ga0070665_100027259
668 Ga0068855_100084917
669 Ga0070664_100010134
670 Ga0068857_100108767
671 Ga0068854_100046635
672 Ga0068856_100350508
673 Ga0070702_100360999
674 Ga0068859_100457727
675 Ga0068864_100031832
676 Ga0068864_100048441
677 Ga0068866_10026698
678 Ga0068866_10238220
679 Ga0068861_100208403
680 Ga0068870_10001003
681 Ga0068863_100878259
682 Ga0081455_10020251
683 Ga0081540_1001294
684 Ga0081539_10000012
685 Ga0070717_10139017
686 Ga0070717_10479075
687 Ga0070717_10505790
688 Ga0070717_10608931
689 Ga0075432_10058345
690 Ga0070715_10026540
691 Ga0070716_100006579
692 Ga0070716_100010091
693 Ga0070716_100142233
694 Ga0097621_100022203
695 Ga0097621_100095638
696 Ga0075428_100001601
697 Ga0075428_100003331
698 Ga0075428_100024473
699 Ga0075428_100086616
700 Ga0075428_100151566
701 Ga0075430_100001229
702 Ga0075430_100001779
703 Ga0075430_100011531
704 Ga0075430_100034520
705 Ga0075431_100012666
706 Ga0075431_100076094
707 Ga0075431_100163094
708 Ga0075433_10000068
709 Ga0075433_10269210
710 Ga0075433_10410607
711 Ga0075434_100035655
712 Ga0075434_100112045
713 Ga0075434_100514727
714 Ga0075429_100000896
715 Ga0075429_100001258
716 Ga0075429_100017338
717 Ga0068865_100308147
718 Ga0075436_100029363
719 Ga0097620_100457687
720 Ga0075435_100003400
721 Ga0075435_100046856
722 Ga0105251_10030918
723 Ga0105250_10094132
724 Ga0105240_11066453
725 Ga0111539_10002993
726 Ga0111539_10388834
727 Ga0111539_10489612
728 Ga0111539_11115669
729 Ga0105245_10094447
730 Ga0105245_10238306
731 Ga0105245_10424397
732 Ga0105247_10268004
733 Ga0114129_10001819
734 Ga0114129_10008968
735 Ga0114129_10009207
736 Ga0114129_10053911
737 Ga0114129_10063203
738 Ga0114129_10110153
739 Ga0105243_10073802
740 Ga0105243_10685613
741 Ga0105242_10043513
742 Ga0105242_10123895
743 Ga0105242_10233842
744 Ga0105248_10609817
745 Ga0105248_11114873
746 Ga0105249_10769985
747 Ga0105239_10018138
748 Ga0105239_10158207
749 Ga0105239_10368135
750 Ga0105246_10009665
751 Ga0105246_10018488
752 Ga0105246_10037633
753 Ga0105246_10140238
754 Ga0157373_10077086
755 Ga0157371_10332740
756 Ga0157370_10065147
757 Ga0157370_10135779
758 Ga0157369_10037180
759 Ga0157369_10063542
760 Ga0157369_10187465
761 Ga0157374_10060345
762 Ga0157374_10290593
763 Ga0163162_10151110
764 Ga0157375_10106863
765 Ga0157375_10315019
766 Ga0157375_10364443
767 Ga0163163_10016466
768 Ga0163163_10124184
769 Ga0163163_10351722
770 Ga0163163_10475583
771 Ga0157380_11081800
772 Ga0182008_10000854
773 Ga0157377_10012930
774 Ga0157377_10070048
775 Ga0157377_10180995
776 Ga0157379_10007982
777 Ga0157379_10772028
778 Ga0157376_10193756
779 Ga0182007_10000482
780 Ga0206353_10779140
781 Ga0213875_10000294
782 Ga0213875_10000442
783 Ga0224712_10002424
784 Ga0224712_10152205
785 Ga0207692_10027456
786 Ga0207692_10132236
787 Ga0207688_10003380
788 Ga0207699_10048627
789 Ga0207699_10199139
790 Ga0207643_10006379
791 Ga0207643_10007430
792 Ga0207684_10000002
793 Ga0207707_10006329
794 Ga0207707_10015363
795 Ga0207707_10031688
796 Ga0207707_10121829
797 Ga0207693_10179935
798 Ga0207660_10017842
799 Ga0207660_10088409
800 Ga0207662_10004219
801 Ga0207657_10053828
802 Ga0207657_10103510
803 Ga0207649_10249631
804 Ga0207652_10004638
805 Ga0207652_10057226
806 Ga0207652_10086280
807 Ga0207652_10137831
808 Ga0207652_10412856
809 Ga0207646_10001226
810 Ga0207646_10010981
811 Ga0207646_10351759
812 Ga0207650_10039209
813 Ga0207659_10026366
814 Ga0207687_10011877
815 Ga0207687_10084313
816 Ga0207700_10014732
817 Ga0207700_10025585
818 Ga0207700_10065775
819 Ga0207700_10118618
820 Ga0207700_10184478
821 Ga0207700_10275105
822 Ga0207664_10012440
823 Ga0207664_10013739
824 Ga0207664_10014046
825 Ga0207664_10132772
826 Ga0207664_10243899
827 Ga0207690_10148908
828 Ga0207690_10161954
829 Ga0207706_10025158
830 Ga0207686_10026709
831 Ga0207686_10077746
832 Ga0207709_10674947
833 Ga0207669_10041150
834 Ga0207704_10052538
835 Ga0207665_10024890
836 Ga0207711_10156964
837 Ga0207711_10875105
838 Ga0207689_10282112
839 Ga0207689_10625271
840 Ga0207661_10002273
841 Ga0207661_10068493
842 Ga0207661_10178629
843 Ga0207667_10108400
844 Ga0207640_10022169
845 Ga0207640_10064957
846 Ga0207677_10067547
847 Ga0207703_10210865
848 Ga0207639_10297870
849 Ga0207639_10396629
850 Ga0207708_10022026
851 Ga0207708_10091111
852 Ga0207702_10016362
853 Ga0207702_10114243
854 Ga0207702_10185777
855 Ga0207702_10601298
856 Ga0207641_10045964
857 Ga0207676_10023610
858 Ga0207676_10030356
859 Ga0207674_10059865
860 Ga0207674_10060880
861 Ga0207675_100952250
862 Ga0207683_10036211
863 Ga0207428_10121789
864 Ga0265337_1002314
865 Ga0265334_10000207
866 Ga0265318_10015860
867 Ga0265336_10005142
868 Ga0265338_10009182
869 Ga0265338_10020567
870 Ga0265338_10036869
871 Ga0265338_10268800
872 Ga0265770_1008945
873 Ga0265760_10060510
874 Ga0265332_10007900
875 Ga0265320_10038961
876 Ga0265325_10007474
877 Ga0265340_10004578
878 Ga0265339_10011885
879 Ga0265316_10053685
880 Ga0265316_10272430
881 Ga0307513_10050168
882 Ga0307508_10171531
883 Ga0307508_10185427
884 Ga0265314_10005783
885 Ga0307406_10706883
886 Ga0307409_100373565
887 Ga0307507_10000003
888 Ga0373940_0053661
889 Ga0373923_0082640
890 Ga0373936_0228350
891 Ga0373939_0020456
892 Ga0373945_0056024
893 Ga0373945_0228240
894 Ga0373953_0005138
895 Ga0373954_0046600
896 Ga0373956_0086521
897 Ga0373957_0009376
898 Ga0373957_0050739
899 Ga0373943_0400349
900 Ga0373946_0040348
901 Ga0373946_0235532
902 Ga0373955_0026142
903 Ga0373955_0101125
904 Ga0373961_0097579
905 Ga0373924_0006422
906 Ga0373924_0016620
907 Ga0373924_0052137
908 Ga0373931_0109758
909 Ga0373935_0000236
910 Ga0373935_0169879
911 Ga0373927_0213542
912 Ga0373933_0009616
913 Ga0373933_0076457
914 Ga0373947_0000013
915 Ga0373947_0063363
916 Ga0373937_0541476
917 Ga0372808_013140
918 Ga0372808_014849
919 Ga0373925_0000028
920 Ga0373925_0015367
921 Ga0395899_0001923
922 Ga0395899_0060360
923 Ga0395899_0064637
924 Ga0395900_0002851
925 Ga0395900_0009392
926 Ga0395900_0016031
927 Ga0395900_0024090
928 Ga0395900_0085798
929 Ga0395900_0640048
930 Ga0395898_0012426
931 Ga0395898_0016365
932 Ga0395898_0019679
933 Ga0395898_0038228
934 Ga0395905_0003155
935 Ga0395905_0028101
936 Ga0436364_0029165
937 Ga0436364_1476073
938 Ga0395901_0004061
939 Ga0395901_0006825
940 Ga0395901_0027273
941 Ga0436361_0856678
942 Ga0451793_1532201
943 Ga0451851_0361118
944 Ga0450917_003047
945 Ga0450906_003360
946 Ga0466961_0082614
947 Ga0466963_0051024
948 Ga0466963_0122037
949 Ga0466963_0165869
950 Ga0466963_0510669
951 Ga0466968_0025694
952 Ga0466968_0044274
953 Ga0466957_0149717
954 Ga0466959_0007402
955 Ga0466959_0078747
956 Ga0466958_0198556
957 Ga0466958_0295989
958 Ga0466967_0599065
959 Ga0495603_0051021
960 Ga0495629_0002559
961 Ga0495651_0000091
962 Ga0495651_0002503
963 Ga0495651_0150726
964 Ga0495653_0041633
965 Ga0495653_0201925
966 Ga0495653_0215143
967 Ga0495639_0052774
968 Ga0495639_0079879
969 Ga0495664_0059941
970 Ga0495608_0189517
971 Ga0495618_0046438
972 Ga0495628_0077291
973 Ga0495628_0109168
974 Ga0495628_0390058
975 Ga0495630_0020307
976 Ga0495630_0515349
977 Ga0495642_0067488
978 Ga0495652_0004600
979 Ga0495652_0007960
980 Ga0495652_0126045
981 Ga0495652_0201665
982 Ga0495640_0041489
983 Ga0495586_0028809
984 Ga0495586_0051346
985 Ga0495586_0108905
986 Ga0495587_0001406
987 Ga0495587_0110798
988 Ga0495645_0025003
989 Ga0495667_0012762
990 Ga0495667_0049436
991 Ga0495667_0067104
992 Ga0495656_0063881
993 Ga0495634_0004549
994 Ga0495634_0033314
995 Ga0495634_0057880
996 Ga0495635_0005204
997 Ga0495635_0021007
998 Ga0495635_0217550
999 Ga0495659_0041476
1000 Ga0495657_0019918
1001 Ga0495657_0026459
1002 Ga0495657_0029143
1003 Ga0495623_0040145
1004 Ga0495623_0172950
1005 Ga0495646_0045384
1006 Ga0495646_0051354
1007 Ga0495658_0000299
1008 Ga0495658_0015824
1009 Ga0495658_0139822
1010 Ga0495613_0002159
1011 Ga0495613_0150352
1012 Ga0495624_0023268
1013 Ga0495600_0012931
1014 Ga0495600_0024881
1015 Ga0495600_0101847
1016 Ga0495581_0005318
1017 Ga0495581_0205939
1018 Ga0495604_0018062
1019 Ga0495604_0019942
1020 Ga0495604_0020497
1021 Ga0495604_0120587
1022 Ga0495674_0042357
1023 Ga0495674_0169857
1024 Ga0495676_0077013
1025 Ga0495676_0098035
1026 Ga0495680_0057110
1027 Ga0495680_0087408
1028 Ga0495680_0211358
1029 Ga0495675_0050811
1030 Ga0495675_0301729
1031 Ga0495684_0034105
1032 Ga0495684_0072307
1033 Ga0495684_0232816
1034 Ga0495684_0349075
1035 Ga0495593_0151188
1036 Ga0495593_0287829
1037 Ga0495602_0047500
1038 Ga0495602_0060754
1039 Ga0495602_0061356
1040 Ga0495602_0087321
1041 Ga0496101_0068996
1042 Ga0496101_0088366
1043 Ga0496102_0025339
1044 Ga0496102_0246124
1045 Ga0496102_0471926
1046 Ga0496103_0017530
1047 Ga0496104_0000151
1048 Ga0496104_0003033
1049 Ga0496104_0107061
1050 Ga0496105_0000049
1051 Ga0496105_0245657
1052 Ga0496108_0005502
1053 Ga0496108_0028180
1054 Ga0496108_0171787
1055 Ga0496108_0229916
1056 Ga0496108_0497962
1057 Ga0496108_0639250
1058 Ga0496109_0000205
1059 Ga0496109_0289935
1060 Ga0496110_0000345
1061 Ga0496110_0005185
1062 Ga0496110_0097446
1063 Ga0496110_0460712
1064 Ga0496111_0000755
1065 Ga0496111_0016489
1066 Ga0496111_0106811
1067 Ga0496111_0163123
1068 Ga0496112_0027522
1069 Ga0496113_0125989
1070 Ga0496114_0000129
1071 Ga0496114_0004229
1072 Ga0496114_0036374
1073 Ga0496114_0041348
1074 Ga0496115_0102770
1075 Ga0496115_0175250
1076 Ga0496115_0300339
1077 Ga0496126_0041171
1078 Ga0501294_003793
1079 Ga0501031_0015909
1080 Ga0501031_0092424
1081 Ga0501032_0079142
1082 Ga0501036_0013311
1083 Ga0501036_0020467
1084 Ga0501036_0020676
1085 Ga0501037_0116243
1086 Ga0501038_0020840
1087 Ga0501038_0052690
1088 Ga0501038_0287387
1089 Ga0501039_0028066
1090 Ga0501039_0039130
1091 Ga0501039_0128674
1092 Ga0501040_0047724
1093 Ga0501041_0006395
1094 Ga0501041_0051207
1095 Ga0501041_0081969
1096 Ga0501042_0007880
1097 Ga0501042_0020876
1098 Ga0501043_0019343
1099 Ga0501043_0065219
1100 Ga0501046_0000208
1101 Ga0501046_0043591
1102 Ga0501046_0045801
1103 Ga0501047_0238762
1104 Ga0501048_0010879
1105 Ga0501048_0016586
1106 Ga0501067_0003611
1107 Ga0501068_0037772
1108 Ga0501068_0055751
1109 Ga0501069_0003672
1110 Ga0501069_0038976
1111 Ga0501069_0160435
1112 Ga0501069_0175175
1113 Ga0501070_0006369
1114 Ga0501071_0008309
1115 Ga0501071_0117871
1116 Ga0501072_0012982
1117 Ga0501072_0014558
1118 Ga0501072_0212131
1119 Ga0501074_0042330
1120 Ga0501074_0162997
1121 Ga0501074_0245393
1122 Ga0501075_0004159
1123 Ga0501075_0336928
1124 Ga0501076_0017968
1125 Ga0501076_0028410
1126 Ga0501076_0092318
1127 Ga0501076_0327468
1128 Ga0501077_0005558
1129 Ga0501077_0018529
1130 Ga0501198_030715
1131 Ga0501206_004618
1132 Ga0501079_0008124
1133 Ga0501079_0046862
1134 Ga0501079_0077768
1135 Ga0501080_0127769
1136 Ga0501080_0202852
1137 Ga0501080_0245432
1138 Ga0501081_0005539
1139 Ga0501081_0008076
1140 Ga0501081_0029713
1141 Ga0501083_0005637
1142 Ga0501083_0098975
1143 Ga0501035_0016768
1144 Ga0501035_0031586
1145 Ga0501035_0138474
1146 Ga0501044_0022727
1147 Ga0501044_0780102
1148 Ga0501045_0004396
1149 Ga0501045_0010142
1150 Ga0501045_0016513
1151 Ga0501045_0025745
1152 nmdc:mga05p37_12914_c1
1153 nmdc:mga05p37_15909_c1
1154 nmdc:mga05p37_64337_c1
1155 nmdc:mga09592_279905_c1
1156 nmdc:mga09592_53049_c1
1157 nmdc:mga09592_82450_c1
1158 nmdc:mga0qj67_179514_c1
1159 nmdc:mga0qj67_427566_c1
1160 nmdc:mga06r32_336821_c1
1161 nmdc:mga06r32_59834_c1
1162 nmdc:mga06r32_605839_c1
1163 nmdc:mga08y16_310865_c1
1164 nmdc:mga08y16_38304_c1
1165 nmdc:mga08y16_869275_c1
1166 nmdc:mga0n895_82006_c1
1167 nmdc:mga0rr50_316686_c1
1168 nmdc:mga0rr50_721020_c1
1169 nmdc:mga08x19_23529_c1
1170 nmdc:mga0a205_166559_c1
1171 Ga0495601_0013597
1172 Ga0495601_0021132
1173 Ga0495601_0032412
1174 Ga0495612_0002034
1175 Ga0495612_0043209
1176 Ga0495595_0004440
1177 Ga0495619_0000115
1178 Ga0495619_0008081
1179 Ga0495619_0022662
1180 Ga0495619_0118827
1181 Ga0500646_0000208
1182 Ga0500618_000343
1183 Ga0500636_0186880
1184 Ga0501084_0018640
1185 Ga0501084_0020843
1186 Ga0501084_0027717
1187 Ga0501084_0083557
1188 Ga0501084_0088882
1189 Ga0501082_0011358
1190 Ga0501082_0017336
1191 Ga0501082_0037244
1192 Ga0530510_0013390
1193 Ga0530510_0080655
1194 Ga0530510_0091806
1195 Ga0530510_0192593
1196 2644625937
1197 2671694390
1198 2862389799
1199 2867432436
1200 2877676818
1201 2891052125
1202 8008564305

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

39

181

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9287 1 223
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9092 1 223
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9053 1 235
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9016 1 235
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.8949 1 230
ID Description Score Start End Superfamily
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9332 2 66 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9275 1 218 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9217 2 72 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9213 1 218 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9153 2 236 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V4A1G7-F1-model_v4 ABC transporter ATP-binding protein 0.9627 1 234 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A7S7UT03-F1-model_v4 ABC transporter ATP-binding protein 0.9547 1 231 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A7V4A1G7-F1-model_v4 ABC transporter ATP-binding protein 0.9545 1 234 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A132EYC1-F1-model_v4 ABC transporter ATP-binding protein 0.9534 1 237 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A7X7GDW3-F1-model_v4 ABC transporter ATP-binding protein 0.948 2 237 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map