metagRoot

F468054

General Info

Members	Datasets	Scaffolds	Average Seq Length
601	283	563	140

Family's Representative Sequence

Representative Sequence	3300009148\|Ga0105243_10000009\|Ga0105243_10000009107
Length	152
Sequence	MSGVNKVILVGHLGKDPEIRYLEGNVSVASFPLATSETYNKDGKRVEQTEWHNIVMWRGLADVAVKYLTKGKLVYIEGRLRTRTYEDKEGIRRYATEVVAETFTLLGRKSDFEPAGAANTGNVASTPAQKAEDKEIEVDFTENDQEDNPLPF

Samples

	Sample ID	Description	Type	Environment
1	2585427687	Pedobacter borealis DSM 19626	Isolate	Rhizosphere
2	2599185184	Mucilaginibacter sp. NFR10	Isolate	Rhizoplane
3	2721755487	Sphingobacterium sp. B29	Isolate	Rhizosphere
4	2738541283	Pedobacter sp. OK701	Isolate	Unclassified
5	2738541284	Pedobacter sp. YR016	Isolate	Unclassified
6	2738541302	Pedobacter sp. CF074	Isolate	Unclassified
7	2738543023	Pedobacter sp. OK628	Isolate	Unclassified
8	2739367651	Pedobacter sp. OK291	Isolate	Unclassified
9	2739367656	Pedobacter sp. CF523	Isolate	Unclassified
10	2739367663	Pedobacter sp. YR510	Isolate	Unclassified
11	2818991437	Pedobacter terrae 518	Isolate	Unclassified
12	2842722452	Pedobacter sp. R-72249	Isolate	Unclassified
13	2842903701	Olivibacter sp. R-72191	Isolate	Unclassified
14	2842909656	Pedobacter sp. R-72393	Isolate	Unclassified
15	2849281842	Pedobacter sp. AK013	Isolate	Rhizosphere
16	2852623160	Mucilaginibacter sp. AK015	Isolate	Rhizosphere
17	2852627209	Pedobacter sp. AK017	Isolate	Rhizosphere
18	2857627736	Pedobacter sp. R-74587	Isolate	Unclassified
19	2884933994	Mucilaginibacter sp. 14171R-50	Isolate	Rhizosphere
20	2890737413	Parapedobacter sp. SGR-10	Isolate	Rhizosphere
21	2896317667	Sphingobacterium sp. SGR-19	Isolate	Rhizosphere
22	2896344016	Sphingobacterium sp. SGL-16	Isolate	Rhizosphere
23	2898713307	Sphingobacterium sp. SGG-5	Isolate	Rhizosphere
24	2902048731	Pedobacter ureilyticus THG-T11	Isolate	Rhizosphere
25	2904445276	Pedobacter terrae 1734	Isolate	Rhizosphere
26	2904780799	Sphingobacterium sp. 1304	Isolate	Rhizosphere
27	2919177583	Sphingobacterium sp. 2149	Isolate	Rhizosphere
28	2919186247	Pedobacter africanus 2697	Isolate	Rhizosphere
29	2919437846	Mucilaginibacter pocheonensis 3262	Isolate	Rhizosphere
30	2928078545	Mucilaginibacter rubeus 1215	Isolate	Unclassified
31	2928147474	Mucilaginibacter rubeus 2025	Isolate	Unclassified
32	2932082852	Mucilaginibacter sp. 3215	Isolate	Rhizosphere
33	2939664404	Pedobacter africanus 2990	Isolate	Rhizosphere
34	2945997725	Pedobacter sp. W3I1	Isolate	Rhizosphere
35	2954016120	Flavobacterium sp. W4I14	Isolate	Rhizosphere
36	2977232053	Mucilaginibacter terrae SORGH_AS 422	Isolate	Unclassified
37	3003233435	Sphingobacterium shayense CrR18	Isolate	Unclassified
38	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
39	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
40	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
41	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
42	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
43	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
44	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
45	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
46	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
47	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
48	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
49	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
50	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
51	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
52	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
53	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
54	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
55	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
56	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
57	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
58	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
59	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
60	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
61	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
62	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
63	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
64	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
65	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
66	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
67	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
68	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
69	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
70	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
71	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
72	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
73	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
74	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
75	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
76	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
77	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
78	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
79	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
80	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
81	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
82	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
83	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
84	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
85	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
86	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
87	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
88	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
89	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
90	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
91	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
92	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
93	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
94	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
95	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
96	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
97	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
98	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
99	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
100	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
101	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
102	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
103	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
104	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
105	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
106	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
107	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
108	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
109	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
110	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
111	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
112	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
113	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
114	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
115	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
116	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
117	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
118	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
119	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
120	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
121	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
122	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
123	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
124	3300015682	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01	Metagenome	Rhizosphere
125	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
126	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
127	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
128	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
129	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
130	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
131	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
132	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
133	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
134	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
135	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
136	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
137	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
138	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
139	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
140	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
141	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
178	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
179	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
180	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
181	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
182	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
183	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
184	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
185	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
186	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
187	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
188	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
189	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
190	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
191	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
192	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
193	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
194	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
195	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
196	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
197	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
198	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
199	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
200	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
201	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
202	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
203	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
204	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
205	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
206	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
207	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
208	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
209	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
210	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
211	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
212	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
213	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
214	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
215	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
216	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
217	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
218	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
219	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
220	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
221	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
222	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
223	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
224	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
225	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
226	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
227	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
228	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
229	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
230	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
231	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
232	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
233	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
234	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
235	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
236	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
237	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
238	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
239	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
240	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
241	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
242	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
243	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
244	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
245	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
246	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
247	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
248	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
249	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
250	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
251	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
252	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
253	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
254	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
255	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
256	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
257	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
258	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
259	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
260	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
261	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
262	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
263	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
264	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
265	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
266	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
267	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
268	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
269	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
270	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
271	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
272	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
273	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
274	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
275	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
276	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
277	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
278	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
279	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
280	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
281	3300053143	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere	Metagenome	Endosphere
282	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
283	8055588893	Parapedobacter lycopersici KACC 18788	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	93.18
Metatranscriptomes	0.5
Isolates	6.32

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	7.82
Nodule	0
Rhizoplane	1.16
Rhizosphere	82.03
Stem	0
Stem Tuber	0
Unclassified	8.99

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24736J21556_1002958	3300001904	Bacteria	2973
2	JGI24736J21556_1004079	3300001904	Bacteria	2512
3	JGI24740J21852_10041651	3300001979	Bacteria	1382
4	JGI24739J22299_10012566	3300001989	Bacteria	3106
5	JGI24739J22299_10137969	3300001989	Bacteria	723
6	JGI24737J22298_10000179	3300001990	Bacteria	20450
7	JGI24735J21928_10000033	3300002067	Bacteria	70674
8	JGI24735J21928_10006545	3300002067	Bacteria	3829
9	JGI24744J21845_10007338	3300002077	Bacteria	2277
10	JGI25162J39368_1000088	3300002737	Bacteria	106999
11	JGI25162J39368_1000787	3300002737	Bacteria	21304
12	JGI25157J39369_1013644	3300002741	Unclassified	1019
13	JGI25164J39214_1000686	3300002772	Bacteria	13360
14	JGI25152J39213_1000016	3300002773	Bacteria	110433
15	JGI25150J39212_1000003	3300002774	Bacteria	508651
16	JGI25150J39212_1000004	3300002774	Bacteria	417320
17	JGI25151J46595_10000002	3300003187	Bacteria	731381
18	JGI25165J46597_1003467	3300003214	Bacteria	3913
19	JGI25165J46597_1025889	3300003214	Bacteria	760
20	JGI25153J46596_10000015	3300003215	Bacteria	289820
21	rootH1_10046508	3300003316	Bacteria	4859
22	rootH1_10159706	3300003316	Bacteria	3897
23	rootH2_10000823	3300003320	Bacteria	101452
24	rootH2_10043869	3300003320	Bacteria	10138
25	rootH2_10150488	3300003320	Bacteria	2014
26	rootH2_10247998	3300003320	Bacteria	2615
27	rootH2_10257148	3300003320	Bacteria	2924
28	rootL2_10119864	3300003322	Bacteria	3476
29	rootL2_10121862	3300003322	Bacteria	6770
30	rootH1_10032009	3300003323	Bacteria	20379
31	rootH1_10037752	3300003323	Bacteria	2229
32	rootH1_10067048	3300003323	Bacteria	3742
33	rootH1_10179551	3300003323	Bacteria	5054
34	rootH1_10210443	3300003323	Bacteria	2102
35	Ga0055536_1000006	3300003781	Bacteria	347733
36	Ga0055530_10001508	3300003791	Bacteria	16850
37	Ga0065714_10006519	3300005288	Bacteria	6184
38	Ga0065714_10017881	3300005288	Bacteria	1515
39	Ga0065714_10066943	3300005288	Bacteria	6060
40	Ga0065714_10079698	3300005288	Bacteria	2465
41	Ga0065714_10102639	3300005288	Bacteria	1619
42	Ga0065714_10385200	3300005288	Bacteria	603
43	Ga0065704_10071212	3300005289	Bacteria	12471
44	Ga0065704_10392791	3300005289	Bacteria	760
45	Ga0065704_10557547	3300005289	Bacteria	631
46	Ga0065704_10651910	3300005289	Bacteria	582
47	Ga0070658_10000016	3300005327	Bacteria	228551
48	Ga0070658_10029393	3300005327	Bacteria	4415
49	Ga0070658_10215617	3300005327	Bacteria	1622
50	Ga0070658_10298583	3300005327	Bacteria	1373
51	Ga0070658_10356280	3300005327	Bacteria	1253
52	Ga0070676_10001794	3300005328	Bacteria	10919
53	Ga0070683_100168706	3300005329	Bacteria	2077
54	Ga0068869_100173277	3300005334	Bacteria	1687
55	Ga0070680_100643867	3300005336	Bacteria	911
56	Ga0070682_101066644	3300005337	Bacteria	674
57	Ga0068868_100871770	3300005338	Bacteria	816
58	Ga0068868_102060811	3300005338	Bacteria	542
59	Ga0070660_100022750	3300005339	Bacteria	4641
60	Ga0070660_100034305	3300005339	Bacteria	3833
61	Ga0070660_100051537	3300005339	Bacteria	3170
62	Ga0070660_100078051	3300005339	Bacteria	2596
63	Ga0070660_100664082	3300005339	Bacteria	873
64	Ga0070671_100007404	3300005355	Bacteria	8772
65	Ga0070671_100758140	3300005355	Bacteria	844
66	Ga0070674_100325609	3300005356	Bacteria	1233
67	Ga0070674_100484187	3300005356	Bacteria	1027
68	Ga0070673_100096848	3300005364	Bacteria	2422
69	Ga0070673_100634926	3300005364	Bacteria	976
70	Ga0070673_100928232	3300005364	Bacteria	808
71	Ga0070673_100980334	3300005364	Bacteria	786
72	Ga0070688_100254589	3300005365	Bacteria	1251
73	Ga0070659_100000844	3300005366	Bacteria	22367
74	Ga0070659_100006048	3300005366	Bacteria	8729
75	Ga0070659_100198866	3300005366	Bacteria	1649
76	Ga0070663_100097731	3300005455	Bacteria	2186
77	Ga0070678_100002112	3300005456	Bacteria	10778
78	Ga0070662_100000043	3300005457	Bacteria	70660
79	Ga0070662_100181723	3300005457	Bacteria	1658
80	Ga0070681_10050374	3300005458	Bacteria	4155
81	Ga0068867_100003386	3300005459	Bacteria	11217
82	Ga0070679_100020214	3300005530	Bacteria	6491
83	Ga0070684_100066624	3300005535	Bacteria	3161
84	Ga0070684_100875116	3300005535	Bacteria	841
85	Ga0068853_100091065	3300005539	Bacteria	2681
86	Ga0068853_100177383	3300005539	Bacteria	1931
87	Ga0070672_100258766	3300005543	Bacteria	1467
88	Ga0070665_100000012	3300005548	Bacteria	508937
89	Ga0068855_100004387	3300005563	Bacteria	17240
90	Ga0068855_100065710	3300005563	Bacteria	4229
91	Ga0068855_100069342	3300005563	Bacteria	4103
92	Ga0068855_100081542	3300005563	Bacteria	3749
93	Ga0068855_100230510	3300005563	Bacteria	2074
94	Ga0068855_100458051	3300005563	Bacteria	1391
95	Ga0068855_101719564	3300005563	Bacteria	639
96	Ga0068855_102329947	3300005563	Bacteria	535
97	Ga0068857_100026439	3300005577	Bacteria	5116
98	Ga0068857_100465050	3300005577	Bacteria	1184
99	Ga0068857_101458704	3300005577	Bacteria	666
100	Ga0068854_101728359	3300005578	Bacteria	572
101	Ga0068856_100000941	3300005614	Bacteria	31199
102	Ga0068856_100003916	3300005614	Bacteria	14928
103	Ga0068856_100079252	3300005614	Bacteria	3257
104	Ga0068856_100123630	3300005614	Bacteria	2590
105	Ga0068856_100378197	3300005614	Bacteria	1435
106	Ga0068856_100686570	3300005614	Bacteria	1044
107	Ga0068852_100639705	3300005616	Bacteria	1070
108	Ga0068852_100660976	3300005616	Bacteria	1053
109	Ga0068852_100754661	3300005616	Bacteria	985
110	Ga0068852_102154323	3300005616	Bacteria	579
111	Ga0068852_102525114	3300005616	Bacteria	534
112	Ga0068859_102730433	3300005617	Bacteria	542
113	Ga0068864_101592349	3300005618	Bacteria	657
114	Ga0068864_102567859	3300005618	Bacteria	515
115	Ga0068866_10006139	3300005718	Bacteria	4999
116	Ga0068851_10172490	3300005834	Bacteria	1194
117	Ga0068858_100466013	3300005842	Bacteria	1218
118	Ga0075366_10022057	3300006195	Bacteria	3703
119	Ga0075366_10165917	3300006195	Bacteria	1339
120	Ga0097621_100000069	3300006237	Bacteria	52830
121	Ga0068871_100000649	3300006358	Bacteria	23896
122	Ga0068865_100000098	3300006881	Bacteria	45185
123	Ga0097620_102731248	3300006931	Bacteria	542
124	Ga0105251_10384282	3300009011	Bacteria	644
125	Ga0105244_10030379	3300009036	Bacteria	2875
126	Ga0105240_10003052	3300009093	Bacteria	26340
127	Ga0105240_10009770	3300009093	Bacteria	13545
128	Ga0105240_10273611	3300009093	Bacteria	1943
129	Ga0105240_10338341	3300009093	Bacteria	1710
130	Ga0105240_10462652	3300009093	Bacteria	1417
131	Ga0105240_10483738	3300009093	Bacteria	1379
132	Ga0105240_10701000	3300009093	Bacteria	1105
133	Ga0105240_10743109	3300009093	Bacteria	1067
134	Ga0105245_11732372	3300009098	Bacteria	677
135	Ga0105245_12801537	3300009098	Bacteria	540
136	Ga0105243_10000009	3300009148	Bacteria	354419
137	Ga0105241_10000641	3300009174	Bacteria	26244
138	Ga0105241_10011602	3300009174	Bacteria	6461
139	Ga0105241_10014012	3300009174	Bacteria	5878
140	Ga0105241_10074160	3300009174	Bacteria	2649
141	Ga0105241_10366344	3300009174	Bacteria	1255
142	Ga0105242_10062478	3300009176	Bacteria	3065
143	Ga0105237_10000146	3300009545	Bacteria	99601
144	Ga0105237_10001888	3300009545	Bacteria	26745
145	Ga0105237_10003936	3300009545	Bacteria	17390
146	Ga0105237_10013533	3300009545	Bacteria	8551
147	Ga0105237_10020311	3300009545	Bacteria	6852
148	Ga0105237_10028074	3300009545	Bacteria	5734
149	Ga0105237_10031573	3300009545	Bacteria	5367
150	Ga0105237_10128223	3300009545	Bacteria	2531
151	Ga0105237_10143599	3300009545	Bacteria	2381
152	Ga0105237_10167565	3300009545	Bacteria	2196
153	Ga0105237_10402941	3300009545	Bacteria	1373
154	Ga0105237_10663752	3300009545	Bacteria	1049
155	Ga0105238_10009373	3300009551	Bacteria	9797
156	Ga0105249_10108195	3300009553	Bacteria	2624
157	Ga0105239_10000008	3300010375	Bacteria	376925
158	Ga0105239_10000045	3300010375	Bacteria	186314
159	Ga0105239_10002831	3300010375	Bacteria	21700
160	Ga0105239_10007846	3300010375	Bacteria	12204
161	Ga0105239_10008855	3300010375	Bacteria	11392
162	Ga0105239_10009286	3300010375	Bacteria	11117
163	Ga0105239_10091721	3300010375	Bacteria	3353
164	Ga0105239_10111206	3300010375	Bacteria	3036
165	Ga0105239_10515874	3300010375	Bacteria	1360
166	Ga0105239_10682195	3300010375	Bacteria	1174
167	Ga0105239_10951280	3300010375	Bacteria	987
168	Ga0105246_10050501	3300011119	Bacteria	2853
169	Ga0105246_10382879	3300011119	Bacteria	1163
170	Ga0105246_12108071	3300011119	Bacteria	547
171	Ga0157373_10000089	3300013100	Bacteria	78449
172	Ga0157373_10001629	3300013100	Bacteria	17142
173	Ga0157373_10002800	3300013100	Bacteria	13192
174	Ga0157373_10003127	3300013100	Bacteria	12507
175	Ga0157373_10008166	3300013100	Bacteria	7783
176	Ga0157373_10034001	3300013100	Bacteria	3663
177	Ga0157373_10068879	3300013100	Bacteria	2501
178	Ga0157373_10176787	3300013100	Bacteria	1502
179	Ga0157371_10000961	3300013102	Bacteria	31971
180	Ga0157371_10002443	3300013102	Bacteria	17711
181	Ga0157371_10003512	3300013102	Bacteria	14157
182	Ga0157371_10007225	3300013102	Bacteria	9022
183	Ga0157371_10014712	3300013102	Bacteria	5889
184	Ga0157371_10016098	3300013102	Bacteria	5590
185	Ga0157371_10043453	3300013102	Bacteria	3201
186	Ga0157371_10451802	3300013102	Bacteria	945
187	Ga0157370_10001766	3300013104	Bacteria	26676
188	Ga0157370_10022319	3300013104	Bacteria	6299
189	Ga0157370_10045936	3300013104	Bacteria	4189
190	Ga0157370_10094968	3300013104	Bacteria	2797
191	Ga0157370_10151304	3300013104	Bacteria	2159
192	Ga0157370_10165714	3300013104	Bacteria	2055
193	Ga0157370_10197787	3300013104	Bacteria	1865
194	Ga0157370_10418289	3300013104	Bacteria	1233
195	Ga0157370_10466252	3300013104	Bacteria	1161
196	Ga0157370_10519057	3300013104	Bacteria	1093
197	Ga0157370_10688609	3300013104	Bacteria	933
198	Ga0157370_11187477	3300013104	Bacteria	689
199	Ga0157369_10000047	3300013105	Bacteria	172682
200	Ga0157369_10001337	3300013105	Bacteria	30446
201	Ga0157369_10109057	3300013105	Bacteria	2944
202	Ga0157369_10125377	3300013105	Bacteria	2723
203	Ga0157369_10380423	3300013105	Bacteria	1465
204	Ga0157369_10586577	3300013105	Unclassified	1151
205	Ga0157374_10000360	3300013296	Bacteria	42177
206	Ga0157374_10004643	3300013296	Bacteria	11518
207	Ga0157374_10121081	3300013296	Bacteria	2525
208	Ga0157374_10188840	3300013296	Bacteria	2015
209	Ga0157374_10284493	3300013296	Bacteria	1633
210	Ga0157374_10771706	3300013296	Bacteria	976
211	Ga0157378_10028522	3300013297	Bacteria	4927
212	Ga0157378_10068857	3300013297	Bacteria	3174
213	Ga0157378_10154607	3300013297	Bacteria	2140
214	Ga0157378_10231628	3300013297	Bacteria	1760
215	Ga0157378_10920623	3300013297	Bacteria	906
216	Ga0163162_10000013	3300013306	Bacteria	275366
217	Ga0163162_10000065	3300013306	Bacteria	102191
218	Ga0163162_10001108	3300013306	Bacteria	24991
219	Ga0163162_10006805	3300013306	Bacteria	11089
220	Ga0163162_10008405	3300013306	Bacteria	10068
221	Ga0163162_10129495	3300013306	Bacteria	2632
222	Ga0163162_11502773	3300013306	Bacteria	767
223	Ga0163162_11820608	3300013306	Bacteria	696
224	Ga0157372_10000029	3300013307	Bacteria	180371
225	Ga0157372_10000677	3300013307	Bacteria	37495
226	Ga0157372_10007365	3300013307	Bacteria	11708
227	Ga0157372_10045289	3300013307	Bacteria	4879
228	Ga0157372_10203570	3300013307	Bacteria	2293
229	Ga0157372_10497337	3300013307	Bacteria	1422
230	Ga0157372_10681133	3300013307	Bacteria	1197
231	Ga0157372_10702715	3300013307	Bacteria	1176
232	Ga0157375_10021212	3300013308	Bacteria	5952
233	Ga0157375_10630899	3300013308	Bacteria	1229
234	Ga0182008_10000002	3300014497	Bacteria	480216
235	Ga0182008_10000169	3300014497	Bacteria	50985
236	Ga0182008_10000458	3300014497	Bacteria	31101
237	Ga0182008_10178316	3300014497	Bacteria	1074
238	Ga0157377_10292339	3300014745	Bacteria	1072
239	Ga0157377_10445013	3300014745	Bacteria	893
240	Ga0157376_10358401	3300014969	Bacteria	1398
241	Ga0157376_10777393	3300014969	Bacteria	969
242	Ga0182006_1000224	3300015261	Bacteria	54977
243	Ga0182006_1000334	3300015261	Bacteria	40253
244	Ga0182006_1001014	3300015261	Bacteria	18373
245	Ga0182006_1010624	3300015261	Bacteria	4085
246	Ga0182006_1014051	3300015261	Bacteria	3457
247	Ga0182007_10000005	3300015262	Bacteria	442702
248	Ga0182007_10015469	3300015262	Bacteria	2844
249	Ga0182007_10058522	3300015262	Bacteria	1264
250	Ga0183373_1002	3300015682	Bacteria	990153
251	Ga0163161_10005678	3300017792	Bacteria	8648
252	Ga0163161_10011530	3300017792	Bacteria	6134
253	Ga0163161_10024632	3300017792	Bacteria	4253
254	Ga0163161_10044923	3300017792	Bacteria	3183
255	Ga0163161_10050753	3300017792	Bacteria	3003
256	Ga0163161_10099687	3300017792	Bacteria	2160
257	Ga0163161_10130043	3300017792	Bacteria	1898
258	Ga0163161_10198319	3300017792	Bacteria	1546
259	Ga0163161_10887969	3300017792	Bacteria	754
260	Ga0163161_10962006	3300017792	Bacteria	727
261	Ga0206351_10789175	3300020077	Bacteria	663
262	Ga0154015_1585042	3300020610	Bacteria	545
263	Ga0213872_10004758	3300021361	Bacteria	7109
264	Ga0207427_100109	3300025231	Bacteria	116061
265	Ga0209437_100096	3300025233	Bacteria	233558
266	Ga0209437_100190	3300025233	Bacteria	125000
267	Ga0209258_115736	3300025242	Bacteria	857
268	Ga0207425_1000003	3300025245	Bacteria	1145342
269	Ga0209026_1000991	3300025250	Bacteria	14111
270	Ga0209026_1001774	3300025250	Bacteria	8933
271	Ga0209026_1011491	3300025250	Bacteria	1592
272	Ga0209129_1000014	3300025258	Bacteria	509018
273	Ga0209129_1027084	3300025258	Bacteria	984
274	Ga0209233_1000029	3300025261	Bacteria	641642
275	Ga0209233_1001059	3300025261	Bacteria	11434
276	Ga0209233_1018999	3300025261	Bacteria	1836
277	Ga0209233_1025627	3300025261	Bacteria	1455
278	Ga0209455_1019032	3300025272	Bacteria	1396
279	Ga0209676_1000039	3300025292	Bacteria	443158
280	Ga0209025_1000007	3300025294	Bacteria	1145109
281	Ga0209758_1000012	3300025297	Bacteria	949866
282	Ga0209050_1000033	3300025298	Bacteria	442615
283	Ga0207656_10284317	3300025321	Bacteria	816
284	Ga0207655_1076224	3300025728	Bacteria	1227
285	Ga0207642_10014545	3300025899	Bacteria	2906
286	Ga0207647_10000092	3300025904	Bacteria	68188
287	Ga0207647_10000453	3300025904	Bacteria	33344
288	Ga0207647_10016937	3300025904	Bacteria	4962
289	Ga0207647_10103941	3300025904	Bacteria	1683
290	Ga0207645_10000205	3300025907	Bacteria	48288
291	Ga0207705_10000031	3300025909	Bacteria	228571
292	Ga0207705_10201865	3300025909	Bacteria	1507
293	Ga0207705_10239091	3300025909	Bacteria	1383
294	Ga0207705_10289109	3300025909	Bacteria	1256
295	Ga0207654_10001957	3300025911	Bacteria	10679
296	Ga0207654_10005664	3300025911	Bacteria	6315
297	Ga0207654_10194822	3300025911	Bacteria	1330
298	Ga0207654_10305016	3300025911	Bacteria	1084
299	Ga0207654_10400802	3300025911	Unclassified	954
300	Ga0207654_10583270	3300025911	Unclassified	797
301	Ga0207707_10014554	3300025912	Bacteria	6852
302	Ga0207695_10001067	3300025913	Bacteria	47991
303	Ga0207695_10054113	3300025913	Bacteria	4194
304	Ga0207695_10089703	3300025913	Bacteria	3091
305	Ga0207695_10169137	3300025913	Bacteria	2112
306	Ga0207695_10397346	3300025913	Bacteria	1263
307	Ga0207695_10607026	3300025913	Bacteria	975
308	Ga0207695_10629947	3300025913	Bacteria	954
309	Ga0207695_11451724	3300025913	Bacteria	566
310	Ga0207671_10000634	3300025914	Bacteria	46044
311	Ga0207671_10000799	3300025914	Bacteria	39903
312	Ga0207671_10001595	3300025914	Bacteria	25763
313	Ga0207671_10004059	3300025914	Bacteria	14193
314	Ga0207671_10010014	3300025914	Bacteria	7865
315	Ga0207671_10011797	3300025914	Bacteria	7074
316	Ga0207671_10024740	3300025914	Bacteria	4510
317	Ga0207671_10086775	3300025914	Bacteria	2353
318	Ga0207660_10493620	3300025917	Bacteria	993
319	Ga0207657_10062736	3300025919	Bacteria	3180
320	Ga0207657_10066872	3300025919	Bacteria	3058
321	Ga0207657_10092770	3300025919	Bacteria	2516
322	Ga0207652_10002308	3300025921	Bacteria	16167
323	Ga0207694_10010693	3300025924	Bacteria	6928
324	Ga0207644_10002465	3300025931	Bacteria	11937
325	Ga0207644_10666833	3300025931	Bacteria	866
326	Ga0207690_10000988	3300025932	Bacteria	18219
327	Ga0207690_10004005	3300025932	Bacteria	8698
328	Ga0207690_10037188	3300025932	Bacteria	3159
329	Ga0207706_10000466	3300025933	Bacteria	43209
330	Ga0207706_10220055	3300025933	Bacteria	1662
331	Ga0207686_10036258	3300025934	Bacteria	2968
332	Ga0207709_10000026	3300025935	Bacteria	354467
333	Ga0207669_10302922	3300025937	Bacteria	1215
334	Ga0207704_10000151	3300025938	Bacteria	37223
335	Ga0207691_10230408	3300025940	Bacteria	1604
336	Ga0207661_10010371	3300025944	Bacteria	6706
337	Ga0207667_10004367	3300025949	Bacteria	17315
338	Ga0207667_10047885	3300025949	Bacteria	4522
339	Ga0207667_10066766	3300025949	Bacteria	3749
340	Ga0207667_10134007	3300025949	Unclassified	2551
341	Ga0207667_10212074	3300025949	Bacteria	1985
342	Ga0207667_11184324	3300025949	Bacteria	744
343	Ga0207667_12029435	3300025949	Bacteria	535
344	Ga0207651_10104747	3300025960	Bacteria	2108
345	Ga0207651_10866073	3300025960	Bacteria	803
346	Ga0207651_11974813	3300025960	Bacteria	524
347	Ga0207712_10684981	3300025961	Bacteria	893
348	Ga0207640_10422250	3300025981	Bacteria	1092
349	Ga0207640_10887581	3300025981	Bacteria	778
350	Ga0207640_11216633	3300025981	Bacteria	670
351	Ga0207703_10421441	3300026035	Bacteria	1242
352	Ga0207639_10020583	3300026041	Bacteria	4724
353	Ga0207678_10008528	3300026067	Bacteria	9031
354	Ga0207702_10000348	3300026078	Bacteria	53003
355	Ga0207702_10005404	3300026078	Bacteria	11189
356	Ga0207648_10007310	3300026089	Bacteria	10885
357	Ga0207674_10039165	3300026116	Bacteria	4915
358	Ga0207674_10938344	3300026116	Bacteria	834
359	Ga0207674_12008766	3300026116	Bacteria	543
360	Ga0207683_10003532	3300026121	Bacteria	13635
361	Ga0207698_10024015	3300026142	Bacteria	4270
362	Ga0207698_10501012	3300026142	Bacteria	1182
363	Ga0207698_10661487	3300026142	Bacteria	1036
364	Ga0207698_10670931	3300026142	Bacteria	1029
365	Ga0207698_11365830	3300026142	Bacteria	723
366	Ga0268266_10000080	3300028379	Bacteria	210179
367	Ga0307517_10000255	3300028786	Bacteria	91028
368	Ga0307515_10000299	3300028794	Bacteria	122087
369	Ga0307515_10000667	3300028794	Bacteria	79135
370	Ga0307515_10000910	3300028794	Bacteria	68112
371	Ga0307515_10115348	3300028794	Bacteria	3095
372	Ga0316177_1079209	3300030731	Bacteria	39979
373	Ga0316177_1219854	3300030731	Bacteria	754
374	Ga0316176_1097927	3300030732	Bacteria	8246
375	Ga0314311_1024815	3300030733	Bacteria	1025
376	Ga0316183_1201626	3300030742	Bacteria	37918
377	Ga0316181_1233735	3300030744	Unclassified	859
378	Ga0316181_1234569	3300030744	Bacteria	2825
379	Ga0316182_1198734	3300030745	Bacteria	2173
380	Ga0265327_10115881	3300031251	Bacteria	1275
381	Ga0307513_10461566	3300031456	Bacteria	993
382	Ga0307509_10124670	3300031507	Bacteria	2545
383	Ga0307405_10000009	3300031731	Bacteria	259388
384	Ga0307405_10014744	3300031731	Bacteria	4212
385	Ga0307407_10000001	3300031903	Bacteria	570048
386	Ga0307412_10000001	3300031911	Bacteria	822691
387	Ga0307412_10004410	3300031911	Bacteria	7845
388	Ga0307412_10020373	3300031911	Bacteria	4036
389	Ga0307412_10340681	3300031911	Bacteria	1200
390	Ga0307412_10370793	3300031911	Bacteria	1156
391	Ga0307412_10928515	3300031911	Bacteria	764
392	Ga0307412_11063280	3300031911	Bacteria	718
393	Ga0307412_11598372	3300031911	Bacteria	595
394	Ga0307409_100015901	3300031995	Bacteria	4958
395	Ga0307416_100000008	3300032002	Bacteria	401343
396	Ga0307414_10000913	3300032004	Bacteria	15145
397	Ga0307414_10001177	3300032004	Bacteria	13440
398	Ga0307414_10001869	3300032004	Bacteria	10875
399	Ga0307414_10007351	3300032004	Bacteria	6190
400	Ga0307414_10016800	3300032004	Unclassified	4462
401	Ga0307414_10063684	3300032004	Bacteria	2622
402	Ga0307414_10071747	3300032004	Bacteria	2499
403	Ga0307414_10076583	3300032004	Bacteria	2431
404	Ga0307414_10116599	3300032004	Bacteria	2045
405	Ga0307414_10121393	3300032004	Bacteria	2009
406	Ga0307414_10392544	3300032004	Bacteria	1203
407	Ga0307414_10978062	3300032004	Bacteria	778
408	Ga0307414_11664299	3300032004	Bacteria	595
409	Ga0307411_10186143	3300032005	Bacteria	1581
410	Ga0307411_10403697	3300032005	Bacteria	1130
411	Ga0307507_10000337	3300033179	Bacteria	95356
412	Ga0307510_10003311	3300033180	Bacteria	18761
413	Ga0316596_1115294	3300033541	Bacteria	730
414	Ga0316574_0111137	3300035398	Bacteria	1757
415	Ga0395899_0000011	3300037312	Bacteria	521331
416	Ga0395899_0000024	3300037312	Bacteria	357402
417	Ga0395899_0000400	3300037312	Bacteria	50913
418	Ga0395899_0053223	3300037312	Bacteria	2998
419	Ga0395900_0000112	3300037418	Bacteria	143390
420	Ga0395900_0000151	3300037418	Bacteria	116281
421	Ga0395900_0006558	3300037418	Bacteria	12124
422	Ga0395898_0016521	3300037466	Bacteria	7549
423	Ga0395898_0297476	3300037466	Bacteria	1540
424	Ga0395905_0000118	3300037471	Bacteria	132298
425	Ga0395905_0002250	3300037471	Bacteria	21700
426	Ga0395901_0000912	3300038443	Bacteria	32282
427	Ga0395901_0002961	3300038443	Bacteria	17130
428	Ga0436361_0928313	3300039447	Bacteria	7098
429	Ga0451789_0935250	3300041443	Bacteria	812
430	Ga0451791_0860011	3300041451	Bacteria	667
431	Ga0451802_1952400	3300041460	Bacteria	523
432	Ga0451807_0884706	3300041486	Bacteria	1555
433	Ga0451841_0447141	3300041498	Bacteria	660
434	Ga0439448_0001359	3300042005	Bacteria	6278
435	Ga0466969_0089791	3300044656	Bacteria	1457
436	Ga0466961_0037615	3300044693	Bacteria	3105
437	Ga0466968_0200142	3300044735	Bacteria	935
438	Ga0466958_0004934	3300045836	Bacteria	7114
439	Ga0466967_1402819	3300045976	Bacteria	696
440	Ga0495627_011463	3300046453	Bacteria	3181
441	Ga0495592_0760917	3300046454	Bacteria	578
442	Ga0495629_0172950	3300046459	Bacteria	1498
443	Ga0495651_0140742	3300046462	Bacteria	1750
444	Ga0495650_0000548	3300046471	Bacteria	53696
445	Ga0495650_0091296	3300046471	Bacteria	1158
446	Ga0495650_0096685	3300046471	Bacteria	1114
447	Ga0495650_0198419	3300046471	Bacteria	698
448	Ga0495605_0072357	3300046474	Bacteria	1626
449	Ga0495585_0000572	3300046492	Bacteria	34663
450	Ga0495585_0001559	3300046492	Bacteria	17785
451	Ga0495585_0147612	3300046492	Bacteria	1228
452	Ga0495596_0024260	3300046500	Bacteria	2457
453	Ga0495607_0136537	3300046501	Bacteria	1270
454	Ga0495607_0288579	3300046501	Unclassified	776
455	Ga0495583_0027316	3300046506	Bacteria	2817
456	Ga0495583_0083001	3300046506	Bacteria	1390
457	Ga0495606_0000425	3300046507	Bacteria	70202
458	Ga0495606_0006115	3300046507	Bacteria	11239
459	Ga0495606_0009397	3300046507	Bacteria	8278
460	Ga0495606_0011352	3300046507	Bacteria	7275
461	Ga0495606_0117394	3300046507	Bacteria	1596
462	Ga0495606_0220492	3300046507	Bacteria	1069
463	Ga0495606_0264353	3300046507	Bacteria	948
464	Ga0495610_0000338	3300046512	Bacteria	49305
465	Ga0495610_0000614	3300046512	Bacteria	35222
466	Ga0495610_0002944	3300046512	Bacteria	13748
467	Ga0495610_0005220	3300046512	Bacteria	9298
468	Ga0495616_0001169	3300046513	Bacteria	18572
469	Ga0495616_0002468	3300046513	Bacteria	12258
470	Ga0495616_0055898	3300046513	Bacteria	1952
471	Ga0495631_0091053	3300046518	Bacteria	1313
472	Ga0495631_0405466	3300046518	Bacteria	580
473	Ga0495632_0081311	3300046519	Bacteria	1545
474	Ga0495637_0012297	3300046520	Bacteria	4099
475	Ga0495637_0043513	3300046520	Bacteria	1916
476	Ga0495637_0048577	3300046520	Bacteria	1786
477	Ga0495644_0017450	3300046523	Bacteria	2743
478	Ga0495648_0035830	3300046524	Bacteria	3211
479	Ga0495642_0021766	3300046528	Bacteria	2524
480	Ga0495642_0187733	3300046528	Bacteria	900
481	Ga0495652_0492992	3300046529	Bacteria	851
482	Ga0495587_0191788	3300046536	Bacteria	1157
483	Ga0495609_0002794	3300046538	Bacteria	10497
484	Ga0495609_0340233	3300046538	Bacteria	606
485	Ga0495622_0017202	3300046557	Bacteria	3366
486	Ga0495633_0000082	3300046558	Bacteria	125101
487	Ga0495633_0010095	3300046558	Bacteria	5174
488	Ga0495633_0287967	3300046558	Bacteria	747
489	Ga0495668_0000017	3300046616	Bacteria	434025
490	Ga0495668_0084118	3300046616	Bacteria	1745
491	Ga0495668_0151254	3300046616	Bacteria	1271
492	Ga0495668_0438839	3300046616	Bacteria	718
493	Ga0495634_0101003	3300046642	Bacteria	1864
494	Ga0495625_0000007	3300046660	Bacteria	565749
495	Ga0495625_0000067	3300046660	Bacteria	171483
496	Ga0495625_0000155	3300046660	Bacteria	105066
497	Ga0495625_0046101	3300046660	Bacteria	3146
498	Ga0495625_0102503	3300046660	Bacteria	1964
499	Ga0495625_0179518	3300046660	Bacteria	1409
500	Ga0495625_0232380	3300046660	Bacteria	1204
501	Ga0495625_0383644	3300046660	Bacteria	881
502	Ga0495661_0002399	3300046665	Bacteria	14465
503	Ga0495661_0007909	3300046665	Bacteria	7385
504	Ga0495661_0016074	3300046665	Bacteria	4972
505	Ga0495658_0021308	3300046683	Bacteria	3416
506	Ga0495669_0193094	3300046684	Bacteria	972
507	Ga0495670_0497702	3300046691	Bacteria	662
508	Ga0495671_0142656	3300046692	Bacteria	1167
509	Ga0495671_0211273	3300046692	Bacteria	940
510	Ga0495649_0000007	3300046694	Bacteria	518037
511	Ga0495649_0000135	3300046694	Bacteria	64533
512	Ga0495649_0028517	3300046694	Bacteria	3094
513	Ga0495589_0047545	3300046794	Bacteria	2126
514	Ga0495600_0077127	3300046809	Bacteria	2176
515	Ga0495660_0001506	3300046810	Bacteria	15728
516	Ga0495604_0737615	3300047317	Bacteria	624
517	Ga0495683_0016345	3300047323	Bacteria	3855
518	Ga0495687_000796	3300047443	Bacteria	33944
519	Ga0495687_063997	3300047443	Bacteria	1503
520	Ga0495677_0030475	3300047445	Bacteria	1963
521	Ga0495677_0125466	3300047445	Bacteria	980
522	Ga0495673_0009590	3300047469	Bacteria	5347
523	Ga0495681_0105307	3300047470	Bacteria	1228
524	Ga0495686_0000506	3300047472	Bacteria	56614
525	Ga0495686_0001259	3300047472	Bacteria	28751
526	Ga0495686_0008559	3300047472	Bacteria	7495
527	Ga0495686_0037688	3300047472	Bacteria	3096
528	Ga0495686_0057951	3300047472	Bacteria	2416
529	Ga0495614_0001666	3300048089	Bacteria	9686
530	Ga0496115_0022532	3300048918	Bacteria	4882
531	Ga0496115_1343478	3300048918	Bacteria	530
532	Ga0496116_0000752	3300048919	Bacteria	41208
533	Ga0496117_0001673	3300048920	Bacteria	30988
534	Ga0496118_0128875	3300048921	Bacteria	1629
535	Ga0496122_0004576	3300048925	Bacteria	17041
536	Ga0496122_0012821	3300048925	Bacteria	8289
537	Ga0496123_0004355	3300048926	Bacteria	14963
538	Ga0496123_0069726	3300048926	Bacteria	2205
539	Ga0496125_0101057	3300048928	Bacteria	2124
540	Ga0496125_0102264	3300048928	Bacteria	2106
541	Ga0496126_0343238	3300048929	Bacteria	1223
542	Ga0495678_012902	3300049459	Bacteria	3940
543	Ga0495682_0006403	3300049460	Bacteria	4764
544	Ga0495682_0161432	3300049460	Bacteria	798
545	Ga0501223_000532	3300049663	Bacteria	9180
546	Ga0501035_0471792	3300049822	Unclassified	1036
547	nmdc:mga0k408_149013_c1	3300050493	Bacteria	1393
548	nmdc:mga0k408_158_c1	3300050493	Bacteria	35033
549	nmdc:mga0k408_26521_c1	3300050493	Bacteria	3285
550	nmdc:mga0k408_443_c1	3300050493	Bacteria	22635
551	Ga0500635_0009593	3300053080	Bacteria	2691
552	Ga0500651_0000116	3300053093	Bacteria	49174
553	Ga0500650_0412354	3300053098	Bacteria	583
554	Ga0500608_003569	3300053122	Bacteria	5860
555	Ga0500608_120544	3300053122	Bacteria	1190
556	Ga0500614_015663	3300053123	Bacteria	1692
557	Ga0500618_000015	3300053125	Bacteria	175864
558	Ga0500652_153423	3300053131	Bacteria	955
559	Ga0500652_329066	3300053131	Bacteria	583
560	Ga0500568_0289608	3300053139	Bacteria	595
561	Ga0500568_0320496	3300053139	Bacteria	562
562	Ga0500579_169756	3300053143	Bacteria	892
563	Ga0500616_0100348	3300053153	Bacteria	1416

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005616	Ga0068852_100639705	Ga0068852_1006397051	118
2	3300009553	Ga0105249_10108195	Ga0105249_101081952	118
3	3300013306	Ga0163162_10006805	Ga0163162_100068059	118
4	3300025961	Ga0207712_10684981	Ga0207712_106849812	118
5	3300026142	Ga0207698_10661487	Ga0207698_106614871	118
6	3300006195	Ga0075366_10165917	Ga0075366_101659172	121
7	3300009545	Ga0105237_10000146	Ga0105237_1000014688	121
8	3300013296	Ga0157374_10121081	Ga0157374_101210813	121
9	3300014745	Ga0157377_10292339	Ga0157377_102923392	121
10	3300025914	Ga0207671_10000634	Ga0207671_1000063417	121
11	3300025981	Ga0207640_10422250	Ga0207640_104222502	121
12	3300028794	Ga0307515_10000299	Ga0307515_1000029992	121
13	3300030731	Ga0316177_1219854	Ga0316177_12198541	121
14	3300031731	Ga0307405_10014744	Ga0307405_100147442	121
15	3300031911	Ga0307412_10004410	Ga0307412_100044103	121
16	3300046506	Ga0495583_0083001	Ga0495583_0083001_837_1217	121
17	3300046512	Ga0495610_0000614	Ga0495610_0000614_30225_30677	121
18	3300046513	Ga0495616_0002468	Ga0495616_0002468_11601_12053	121
19	3300046520	Ga0495637_0012297	Ga0495637_0012297_188_640	121
20	3300046660	Ga0495625_0000007	Ga0495625_0000007_15169_15621	121
21	3300046665	Ga0495661_0002399	Ga0495661_0002399_2747_3199	121
22	3300046692	Ga0495671_0142656	Ga0495671_0142656_626_1078	121
23	3300046694	Ga0495649_0000007	Ga0495649_0000007_420011_420463	121
24	3300047323	Ga0495683_0016345	Ga0495683_0016345_1060_1512	121
25	3300049663	Ga0501223_000532	Ga0501223_000532_3055_3498	121
26	3300050493	nmdc:mga0k408_149013_c1	nmdc:mga0k408_149013_c1_835_1242	121
27	3300053131	Ga0500652_153423	Ga0500652_153423_282_662	121
28	3300013297	Ga0157378_10154607	Ga0157378_101546073	122
29	3300005289	Ga0065704_10392791	Ga0065704_103927912	124
30	3300025250	Ga0209026_1011491	Ga0209026_10114912	125
31	3300047317	Ga0495604_0737615	Ga0495604_0737615_14_400	125
32	3300005457	Ga0070662_100181723	Ga0070662_1001817233	126
33	3300009098	Ga0105245_11732372	Ga0105245_117323721	126
34	3300013297	Ga0157378_10920623	Ga0157378_109206232	126
35	3300013307	Ga0157372_10702715	Ga0157372_107027151	126
36	3300025909	Ga0207705_10201865	Ga0207705_102018652	126
37	3300025933	Ga0207706_10220055	Ga0207706_102200553	126
38	iso_pu_bacteria	2599185184	2599481807	126
39	iso_pu_bacteria	2928078545	2928083958	126
40	iso_pu_bacteria	2928147474	2928152884	126
41	iso_pu_bacteria	2932082852	2932086051	126
42	3300046492	Ga0495585_0147612	Ga0495585_0147612_365_790	127
43	3300003320	rootH2_10247998	rootH2_102479983	128
44	3300003323	rootH1_10067048	rootH1_100670483	128
45	3300005329	Ga0070683_100168706	Ga0070683_1001687062	128
46	3300005535	Ga0070684_100066624	Ga0070684_1000666243	128
47	3300005614	Ga0068856_100378197	Ga0068856_1003781972	128
48	3300013100	Ga0157373_10000089	Ga0157373_1000008943	128
49	3300013307	Ga0157372_10007365	Ga0157372_100073657	128
50	3300025944	Ga0207661_10010371	Ga0207661_100103712	128
51	3300046529	Ga0495652_0492992	Ga0495652_0492992_129_521	128
52	3300046536	Ga0495587_0191788	Ga0495587_0191788_428_850	128
53	3300046660	Ga0495625_0179518	Ga0495625_0179518_962_1354	128
54	3300005327	Ga0070658_10029393	Ga0070658_100293935	129
55	3300005339	Ga0070660_100051537	Ga0070660_1000515375	129
56	3300005366	Ga0070659_100000844	Ga0070659_1000008449	129
57	3300005563	Ga0068855_101719564	Ga0068855_1017195642	129
58	3300005563	Ga0068855_102329947	Ga0068855_1023299471	129
59	3300013102	Ga0157371_10003512	Ga0157371_1000351211	129
60	3300013104	Ga0157370_10418289	Ga0157370_104182892	129
61	3300013105	Ga0157369_10586577	Ga0157369_105865772	129
62	3300013296	Ga0157374_10284493	Ga0157374_102844932	129
63	3300017792	Ga0163161_10962006	Ga0163161_109620062	129
64	3300025919	Ga0207657_10062736	Ga0207657_100627362	129
65	3300025932	Ga0207690_10000988	Ga0207690_1000098811	129
66	3300025949	Ga0207667_12029435	Ga0207667_120294351	129
67	3300001904	JGI24736J21556_1004079	JGI24736J21556_10040792	130
68	3300001979	JGI24740J21852_10041651	JGI24740J21852_100416512	130
69	3300001989	JGI24739J22299_10012566	JGI24739J22299_100125661	130
70	3300001990	JGI24737J22298_10000179	JGI24737J22298_100001798	130
71	3300002067	JGI24735J21928_10000033	JGI24735J21928_1000003321	130
72	3300002067	JGI24735J21928_10006545	JGI24735J21928_100065451	130
73	3300003214	JGI25165J46597_1025889	JGI25165J46597_10258891	130
74	3300003316	rootH1_10046508	rootH1_100465084	130
75	3300003320	rootH2_10257148	rootH2_102571483	130
76	3300003322	rootL2_10121862	rootL2_101218623	130
77	3300003323	rootH1_10210443	rootH1_102104435	130
78	3300005327	Ga0070658_10298583	Ga0070658_102985831	130
79	3300005339	Ga0070660_100078051	Ga0070660_1000780512	130
80	3300005366	Ga0070659_100006048	Ga0070659_1000060487	130
81	3300005539	Ga0068853_100177383	Ga0068853_1001773832	130
82	3300005563	Ga0068855_100069342	Ga0068855_1000693424	130
83	3300005563	Ga0068855_100230510	Ga0068855_1002305102	130
84	3300005577	Ga0068857_100026439	Ga0068857_1000264396	130
85	3300005577	Ga0068857_100465050	Ga0068857_1004650502	130
86	3300005578	Ga0068854_101728359	Ga0068854_1017283591	130
87	3300005618	Ga0068864_102567859	Ga0068864_1025678591	130
88	3300009011	Ga0105251_10384282	Ga0105251_103842821	130
89	3300009545	Ga0105237_10143599	Ga0105237_101435991	130
90	3300010375	Ga0105239_10951280	Ga0105239_109512802	130
91	3300013100	Ga0157373_10008166	Ga0157373_100081669	130
92	3300013102	Ga0157371_10007225	Ga0157371_100072259	130
93	3300013102	Ga0157371_10043453	Ga0157371_100434532	130
94	3300013104	Ga0157370_10022319	Ga0157370_100223197	130
95	3300013104	Ga0157370_10151304	Ga0157370_101513042	130
96	3300013105	Ga0157369_10109057	Ga0157369_101090571	130
97	3300013105	Ga0157369_10125377	Ga0157369_101253774	130
98	3300013306	Ga0163162_10001108	Ga0163162_100011086	130
99	3300013307	Ga0157372_10000677	Ga0157372_100006778	130
100	3300013307	Ga0157372_10045289	Ga0157372_100452892	130
101	3300014969	Ga0157376_10777393	Ga0157376_107773932	130
102	3300020077	Ga0206351_10789175	Ga0206351_107891751	130
103	3300020610	Ga0154015_1585042	Ga0154015_15850421	130
104	3300025242	Ga0209258_115736	Ga0209258_1157362	130
105	3300025261	Ga0209233_1001059	Ga0209233_10010592	130
106	3300025261	Ga0209233_1025627	Ga0209233_10256271	130
107	3300025904	Ga0207647_10000092	Ga0207647_1000009243	130
108	3300025904	Ga0207647_10016937	Ga0207647_100169374	130
109	3300025919	Ga0207657_10092770	Ga0207657_100927702	130
110	3300025932	Ga0207690_10004005	Ga0207690_100040052	130
111	3300025949	Ga0207667_10047885	Ga0207667_100478854	130
112	3300025949	Ga0207667_10212074	Ga0207667_102120742	130
113	3300026116	Ga0207674_10039165	Ga0207674_100391655	130
114	3300026116	Ga0207674_10938344	Ga0207674_109383441	130
115	3300037312	Ga0395899_0000011	Ga0395899_0000011_102517_102927	130
116	3300037466	Ga0395898_0297476	Ga0395898_0297476_626_1033	130
117	3300041498	Ga0451841_0447141	Ga0451841_0447141_29_439	130
118	3300046471	Ga0495650_0000548	Ga0495650_0000548_24249_24659	130
119	3300046492	Ga0495585_0001559	Ga0495585_0001559_8301_8711	130
120	3300046506	Ga0495583_0027316	Ga0495583_0027316_365_775	130
121	3300046507	Ga0495606_0000425	Ga0495606_0000425_48050_48460	130
122	3300046512	Ga0495610_0005220	Ga0495610_0005220_7240_7650	130
123	3300046519	Ga0495632_0081311	Ga0495632_0081311_857_1267	130
124	3300046520	Ga0495637_0048577	Ga0495637_0048577_1087_1497	130
125	3300046538	Ga0495609_0340233	Ga0495609_0340233_162_572	130
126	3300046558	Ga0495633_0010095	Ga0495633_0010095_4143_4553	130
127	3300046616	Ga0495668_0151254	Ga0495668_0151254_206_616	130
128	3300046660	Ga0495625_0000067	Ga0495625_0000067_147046_147456	130
129	3300046665	Ga0495661_0016074	Ga0495661_0016074_184_594	130
130	3300046692	Ga0495671_0211273	Ga0495671_0211273_159_569	130
131	3300046694	Ga0495649_0000135	Ga0495649_0000135_23988_24398	130
132	3300046794	Ga0495589_0047545	Ga0495589_0047545_131_541	130
133	3300047443	Ga0495687_063997	Ga0495687_063997_238_648	130
134	3300047469	Ga0495673_0009590	Ga0495673_0009590_3030_3440	130
135	3300047472	Ga0495686_0008559	Ga0495686_0008559_3310_3720	130
136	3300050493	nmdc:mga0k408_26521_c1	nmdc:mga0k408_26521_c1_2068_2478	130
137	3300053139	Ga0500568_0289608	Ga0500568_0289608_24_434	130
138	iso_pu_bacteria	2738541284	2738761701	130
139	iso_pu_bacteria	2738543023	2739304309	130
140	iso_pu_bacteria	2842903701	2842905400	130
141	iso_pu_bacteria	2852627209	2852627902	130
142	iso_pu_bacteria	2902048731	2902050474	130
143	iso_pu_bacteria	2919186247	2919190845	130
144	iso_pu_bacteria	2939664404	2939668944	130
145	3300003323	rootH1_10037752	rootH1_100377522	131
146	3300046507	Ga0495606_0006115	Ga0495606_0006115_9842_10255	131
147	3300046810	Ga0495660_0001506	Ga0495660_0001506_15190_15603	131
148	3300053080	Ga0500635_0009593	Ga0500635_0009593_1085_1492	131
149	iso_pu_bacteria	2585427687	2586206711	131
150	iso_pu_bacteria	2738541283	2738759190	131
151	iso_pu_bacteria	2738541302	2738854952	131
152	iso_pu_bacteria	2739367651	2739586938	131
153	iso_pu_bacteria	2739367656	2739614725	131
154	iso_pu_bacteria	2739367663	2739648135	131
155	iso_pu_bacteria	2818991437	2819547394	131
156	iso_pu_bacteria	2842722452	2842727618	131
157	iso_pu_bacteria	2842909656	2842911176	131
158	iso_pu_bacteria	2849281842	2849283128	131
159	iso_pu_bacteria	2857627736	2857631536	131
160	iso_pu_bacteria	2896344016	2896346607	131
161	iso_pu_bacteria	2904445276	2904447857	131
162	iso_pu_bacteria	2945997725	2946003289	131
163	iso_pu_bacteria	2954016120	2954020167	131
164	iso_pu_bacteria	2977232053	2977235052	131
165	3300005289	Ga0065704_10557547	Ga0065704_105575471	132
166	3300005616	Ga0068852_102525114	Ga0068852_1025251141	132
167	3300009093	Ga0105240_10338341	Ga0105240_103383412	132
168	3300010375	Ga0105239_10000008	Ga0105239_100000088	132
169	3300013296	Ga0157374_10771706	Ga0157374_107717062	132
170	3300025250	Ga0209026_1000991	Ga0209026_10009912	132
171	3300025913	Ga0207695_10629947	Ga0207695_106299472	132
172	3300032004	Ga0307414_10063684	Ga0307414_100636842	132
173	3300032004	Ga0307414_10076583	Ga0307414_100765832	132
174	3300047472	Ga0495686_0001259	Ga0495686_0001259_20975_21388	132
175	3300048918	Ga0496115_0022532	Ga0496115_0022532_1315_1734	132
176	iso_pu_bacteria	2721755487	2722726081	132
177	iso_pu_bacteria	2890737413	2890739085	132
178	iso_pu_bacteria	2898713307	2898713841	132
179	iso_pu_bacteria	2904780799	2904782685	132
180	iso_pu_bacteria	2919177583	2919180295	132
181	iso_pu_bacteria	2919437846	2919440130	132
182	3300003320	rootH2_10043869	rootH2_100438699	133
183	3300005288	Ga0065714_10006519	Ga0065714_100065196	133
184	3300009174	Ga0105241_10074160	Ga0105241_100741604	133
185	3300015261	Ga0182006_1010624	Ga0182006_10106242	133
186	3300025911	Ga0207654_10400802	Ga0207654_104008022	133
187	3300033541	Ga0316596_1115294	Ga0316596_11152942	133
188	3300035398	Ga0316574_0111137	Ga0316574_0111137_599_1039	133
189	3300041451	Ga0451791_0860011	Ga0451791_0860011_46_468	133
190	3300047472	Ga0495686_0037688	Ga0495686_0037688_2098_2514	133
191	3300048918	Ga0496115_1343478	Ga0496115_1343478_81_500	133
192	3300049822	Ga0501035_0471792	Ga0501035_0471792_399_818	133
193	iso_pu_bacteria	2852623160	2852626538	133
194	iso_pu_bacteria	2884933994	2884934965	133
195	iso_pu_bacteria	8055588893	8055590222	133
196	3300001989	JGI24739J22299_10137969	JGI24739J22299_101379691	134
197	3300002737	JGI25162J39368_1000088	JGI25162J39368_100008866	134
198	3300002737	JGI25162J39368_1000787	JGI25162J39368_100078717	134
199	3300002772	JGI25164J39214_1000686	JGI25164J39214_10006863	134
200	3300003214	JGI25165J46597_1003467	JGI25165J46597_10034674	134
201	3300003320	rootH2_10150488	rootH2_101504882	134
202	3300003322	rootL2_10119864	rootL2_101198644	134
203	3300003323	rootH1_10032009	rootH1_1003200912	134
204	3300003323	rootH1_10179551	rootH1_101795516	134
205	3300005288	Ga0065714_10017881	Ga0065714_100178812	134
206	3300005288	Ga0065714_10066943	Ga0065714_100669433	134
207	3300005288	Ga0065714_10102639	Ga0065714_101026392	134
208	3300005288	Ga0065714_10385200	Ga0065714_103852002	134
209	3300005289	Ga0065704_10071212	Ga0065704_100712124	134
210	3300005289	Ga0065704_10651910	Ga0065704_106519101	134
211	3300005356	Ga0070674_100325609	Ga0070674_1003256091	134
212	3300005563	Ga0068855_100004387	Ga0068855_1000043873	134
213	3300005563	Ga0068855_100458051	Ga0068855_1004580512	134
214	3300005614	Ga0068856_100079252	Ga0068856_1000792526	134
215	3300005614	Ga0068856_100123630	Ga0068856_1001236302	134
216	3300009093	Ga0105240_10003052	Ga0105240_1000305222	134
217	3300009093	Ga0105240_10273611	Ga0105240_102736111	134
218	3300009093	Ga0105240_10743109	Ga0105240_107431091	134
219	3300009098	Ga0105245_12801537	Ga0105245_128015372	134
220	3300009174	Ga0105241_10000641	Ga0105241_100006414	134
221	3300009174	Ga0105241_10366344	Ga0105241_103663442	134
222	3300009545	Ga0105237_10003936	Ga0105237_100039365	134
223	3300009545	Ga0105237_10020311	Ga0105237_100203118	134
224	3300009545	Ga0105237_10128223	Ga0105237_101282232	134
225	3300010375	Ga0105239_10000045	Ga0105239_1000004588	134
226	3300010375	Ga0105239_10002831	Ga0105239_100028315	134
227	3300010375	Ga0105239_10007846	Ga0105239_100078468	134
228	3300010375	Ga0105239_10008855	Ga0105239_1000885510	134
229	3300013100	Ga0157373_10001629	Ga0157373_1000162911	134
230	3300013100	Ga0157373_10002800	Ga0157373_1000280013	134
231	3300013100	Ga0157373_10003127	Ga0157373_100031272	134
232	3300013102	Ga0157371_10014712	Ga0157371_100147122	134
233	3300013102	Ga0157371_10016098	Ga0157371_100160983	134
234	3300013104	Ga0157370_10197787	Ga0157370_101977872	134
235	3300013306	Ga0163162_11502773	Ga0163162_115027732	134
236	3300014497	Ga0182008_10000002	Ga0182008_1000000223	134
237	3300014497	Ga0182008_10178316	Ga0182008_101783162	134
238	3300015261	Ga0182006_1001014	Ga0182006_10010146	134
239	3300015262	Ga0182007_10015469	Ga0182007_100154695	134
240	3300015262	Ga0182007_10058522	Ga0182007_100585223	134
241	3300017792	Ga0163161_10050753	Ga0163161_100507531	134
242	3300017792	Ga0163161_10130043	Ga0163161_101300432	134
243	3300017792	Ga0163161_10887969	Ga0163161_108879692	134
244	3300025231	Ga0207427_100109	Ga0207427_10010980	134
245	3300025233	Ga0209437_100096	Ga0209437_100096187	134
246	3300025233	Ga0209437_100190	Ga0209437_10019043	134
247	3300025258	Ga0209129_1027084	Ga0209129_10270842	134
248	3300025261	Ga0209233_1000029	Ga0209233_1000029563	134
249	3300025272	Ga0209455_1019032	Ga0209455_10190322	134
250	3300025904	Ga0207647_10103941	Ga0207647_101039411	134
251	3300025911	Ga0207654_10194822	Ga0207654_101948222	134
252	3300025911	Ga0207654_10305016	Ga0207654_103050162	134
253	3300025911	Ga0207654_10583270	Ga0207654_105832702	134
254	3300025913	Ga0207695_10001067	Ga0207695_1000106723	134
255	3300025913	Ga0207695_10169137	Ga0207695_101691373	134
256	3300025913	Ga0207695_10397346	Ga0207695_103973461	134
257	3300025913	Ga0207695_10607026	Ga0207695_106070262	134
258	3300025913	Ga0207695_11451724	Ga0207695_114517241	134
259	3300025914	Ga0207671_10001595	Ga0207671_100015955	134
260	3300025914	Ga0207671_10004059	Ga0207671_1000405914	134
261	3300025937	Ga0207669_10302922	Ga0207669_103029222	134
262	3300025949	Ga0207667_10004367	Ga0207667_100043673	134
263	3300025949	Ga0207667_11184324	Ga0207667_111843241	134
264	3300026116	Ga0207674_12008766	Ga0207674_120087661	134
265	3300028794	Ga0307515_10000667	Ga0307515_1000066769	134
266	3300028794	Ga0307515_10000910	Ga0307515_100009107	134
267	3300030731	Ga0316177_1079209	Ga0316177_10792092	134
268	3300030732	Ga0316176_1097927	Ga0316176_10979272	134
269	3300030733	Ga0314311_1024815	Ga0314311_10248151	134
270	3300030742	Ga0316183_1201626	Ga0316183_120162610	134
271	3300030744	Ga0316181_1234569	Ga0316181_12345692	134
272	3300030745	Ga0316182_1198734	Ga0316182_11987342	134
273	3300031507	Ga0307509_10124670	Ga0307509_101246702	134
274	3300031911	Ga0307412_10000001	Ga0307412_10000001708	134
275	3300031911	Ga0307412_10340681	Ga0307412_103406811	134
276	3300031911	Ga0307412_10370793	Ga0307412_103707932	134
277	3300032004	Ga0307414_10000913	Ga0307414_100009137	134
278	3300032004	Ga0307414_10001177	Ga0307414_100011775	134
279	3300032004	Ga0307414_10016800	Ga0307414_100168002	134
280	3300032004	Ga0307414_10978062	Ga0307414_109780622	134
281	3300032005	Ga0307411_10186143	Ga0307411_101861432	134
282	3300033179	Ga0307507_10000337	Ga0307507_1000033739	134
283	3300046454	Ga0495592_0760917	Ga0495592_0760917_66_482	134
284	3300046459	Ga0495629_0172950	Ga0495629_0172950_654_1070	134
285	3300046462	Ga0495651_0140742	Ga0495651_0140742_216_629	134
286	3300046471	Ga0495650_0091296	Ga0495650_0091296_431_847	134
287	3300046492	Ga0495585_0000572	Ga0495585_0000572_16500_16916	134
288	3300046501	Ga0495607_0288579	Ga0495607_0288579_235_657	134
289	3300046507	Ga0495606_0011352	Ga0495606_0011352_2768_3187	134
290	3300046513	Ga0495616_0055898	Ga0495616_0055898_1097_1513	134
291	3300046518	Ga0495631_0091053	Ga0495631_0091053_609_1025	134
292	3300046524	Ga0495648_0035830	Ga0495648_0035830_493_909	134
293	3300046528	Ga0495642_0187733	Ga0495642_0187733_207_620	134
294	3300046538	Ga0495609_0002794	Ga0495609_0002794_6223_6639	134
295	3300046557	Ga0495622_0017202	Ga0495622_0017202_15_431	134
296	3300046558	Ga0495633_0000082	Ga0495633_0000082_45371_45787	134
297	3300046616	Ga0495668_0000017	Ga0495668_0000017_54048_54464	134
298	3300046660	Ga0495625_0000155	Ga0495625_0000155_102855_103271	134
299	3300046660	Ga0495625_0102503	Ga0495625_0102503_144_560	134
300	3300046683	Ga0495658_0021308	Ga0495658_0021308_490_906	134
301	3300046691	Ga0495670_0497702	Ga0495670_0497702_142_558	134
302	3300046809	Ga0495600_0077127	Ga0495600_0077127_1590_2006	134
303	3300047445	Ga0495677_0030475	Ga0495677_0030475_490_906	134
304	3300048089	Ga0495614_0001666	Ga0495614_0001666_7266_7682	134
305	3300049460	Ga0495682_0006403	Ga0495682_0006403_1961_2377	134
306	3300050493	nmdc:mga0k408_443_c1	nmdc:mga0k408_443_c1_9744_10160	134
307	3300053093	Ga0500651_0000116	Ga0500651_0000116_10304_10732	134
308	3300053122	Ga0500608_120544	Ga0500608_120544_732_1148	134
309	3300053123	Ga0500614_015663	Ga0500614_015663_810_1226	134
310	3300053125	Ga0500618_000015	Ga0500618_000015_34959_35375	134
311	3300053139	Ga0500568_0320496	Ga0500568_0320496_13_441	134
312	3300053153	Ga0500616_0100348	Ga0500616_0100348_821_1234	134
313	3300002741	JGI25157J39369_1013644	JGI25157J39369_10136441	135
314	3300002773	JGI25152J39213_1000016	JGI25152J39213_100001695	135
315	3300002774	JGI25150J39212_1000003	JGI25150J39212_1000003302	135
316	3300002774	JGI25150J39212_1000004	JGI25150J39212_1000004322	135
317	3300003187	JGI25151J46595_10000002	JGI25151J46595_10000002302	135
318	3300003215	JGI25153J46596_10000015	JGI25153J46596_10000015113	135
319	3300003781	Ga0055536_1000006	Ga0055536_1000006265	135
320	3300003791	Ga0055530_10001508	Ga0055530_100015088	135
321	3300005288	Ga0065714_10079698	Ga0065714_100796982	135
322	3300005327	Ga0070658_10356280	Ga0070658_103562801	135
323	3300005336	Ga0070680_100643867	Ga0070680_1006438672	135
324	3300005458	Ga0070681_10050374	Ga0070681_100503743	135
325	3300005530	Ga0070679_100020214	Ga0070679_1000202142	135
326	3300005614	Ga0068856_100000941	Ga0068856_1000009418	135
327	3300009036	Ga0105244_10030379	Ga0105244_100303793	135
328	3300009093	Ga0105240_10483738	Ga0105240_104837382	135
329	3300009545	Ga0105237_10028074	Ga0105237_100280745	135
330	3300009545	Ga0105237_10031573	Ga0105237_100315733	135
331	3300010375	Ga0105239_10009286	Ga0105239_100092862	135
332	3300013100	Ga0157373_10034001	Ga0157373_100340011	135
333	3300013100	Ga0157373_10176787	Ga0157373_101767871	135
334	3300013102	Ga0157371_10000961	Ga0157371_1000096114	135
335	3300013102	Ga0157371_10451802	Ga0157371_104518021	135
336	3300013104	Ga0157370_10001766	Ga0157370_1000176615	135
337	3300013104	Ga0157370_10045936	Ga0157370_100459366	135
338	3300013104	Ga0157370_10165714	Ga0157370_101657141	135
339	3300013104	Ga0157370_10519057	Ga0157370_105190571	135
340	3300013104	Ga0157370_10688609	Ga0157370_106886092	135
341	3300013104	Ga0157370_11187477	Ga0157370_111874772	135
342	3300013105	Ga0157369_10000047	Ga0157369_100000473	135
343	3300013306	Ga0163162_10000065	Ga0163162_1000006588	135
344	3300013306	Ga0163162_10129495	Ga0163162_101294952	135
345	3300013306	Ga0163162_11820608	Ga0163162_118206082	135
346	3300013307	Ga0157372_10203570	Ga0157372_102035702	135
347	3300014497	Ga0182008_10000169	Ga0182008_1000016910	135
348	3300014497	Ga0182008_10000458	Ga0182008_1000045820	135
349	3300015261	Ga0182006_1000224	Ga0182006_100022441	135
350	3300015261	Ga0182006_1000334	Ga0182006_100033419	135
351	3300015261	Ga0182006_1014051	Ga0182006_10140513	135
352	3300015262	Ga0182007_10000005	Ga0182007_1000000590	135
353	3300015682	Ga0183373_1002	Ga0183373_1002673	135
354	3300017792	Ga0163161_10005678	Ga0163161_100056783	135
355	3300017792	Ga0163161_10011530	Ga0163161_100115302	135
356	3300017792	Ga0163161_10024632	Ga0163161_100246322	135
357	3300017792	Ga0163161_10044923	Ga0163161_100449233	135
358	3300017792	Ga0163161_10099687	Ga0163161_100996872	135
359	3300017792	Ga0163161_10198319	Ga0163161_101983192	135
360	3300025245	Ga0207425_1000003	Ga0207425_1000003542	135
361	3300025250	Ga0209026_1001774	Ga0209026_10017744	135
362	3300025258	Ga0209129_1000014	Ga0209129_1000014291	135
363	3300025261	Ga0209233_1018999	Ga0209233_10189992	135
364	3300025292	Ga0209676_1000039	Ga0209676_1000039358	135
365	3300025294	Ga0209025_1000007	Ga0209025_1000007541	135
366	3300025297	Ga0209758_1000012	Ga0209758_1000012542	135
367	3300025298	Ga0209050_1000033	Ga0209050_100003390	135
368	3300025728	Ga0207655_1076224	Ga0207655_10762242	135
369	3300025909	Ga0207705_10289109	Ga0207705_102891092	135
370	3300025912	Ga0207707_10014554	Ga0207707_100145541	135
371	3300025914	Ga0207671_10010014	Ga0207671_100100142	135
372	3300025914	Ga0207671_10024740	Ga0207671_100247403	135
373	3300025914	Ga0207671_10086775	Ga0207671_100867752	135
374	3300025917	Ga0207660_10493620	Ga0207660_104936202	135
375	3300025921	Ga0207652_10002308	Ga0207652_100023082	135
376	3300025981	Ga0207640_10887581	Ga0207640_108875811	135
377	3300026078	Ga0207702_10000348	Ga0207702_1000034850	135
378	3300031456	Ga0307513_10461566	Ga0307513_104615662	135
379	3300031731	Ga0307405_10000009	Ga0307405_10000009185	135
380	3300031903	Ga0307407_10000001	Ga0307407_10000001367	135
381	3300031911	Ga0307412_11063280	Ga0307412_110632801	135
382	3300031995	Ga0307409_100015901	Ga0307409_1000159012	135
383	3300032002	Ga0307416_100000008	Ga0307416_10000000821	135
384	3300032004	Ga0307414_10001869	Ga0307414_1000186912	135
385	3300032004	Ga0307414_10071747	Ga0307414_100717472	135
386	3300032004	Ga0307414_11664299	Ga0307414_116642991	135
387	3300041443	Ga0451789_0935250	Ga0451789_0935250_346_783	135
388	3300041486	Ga0451807_0884706	Ga0451807_0884706_478_915	135
389	3300046453	Ga0495627_011463	Ga0495627_011463_2583_3020	135
390	3300046471	Ga0495650_0198419	Ga0495650_0198419_28_441	135
391	3300046507	Ga0495606_0009397	Ga0495606_0009397_1416_1835	135
392	3300046512	Ga0495610_0000338	Ga0495610_0000338_2825_3262	135
393	3300046512	Ga0495610_0002944	Ga0495610_0002944_1222_1659	135
394	3300046513	Ga0495616_0001169	Ga0495616_0001169_2906_3328	135
395	3300046520	Ga0495637_0043513	Ga0495637_0043513_1135_1572	135
396	3300046558	Ga0495633_0287967	Ga0495633_0287967_241_678	135
397	3300046660	Ga0495625_0046101	Ga0495625_0046101_1330_1752	135
398	3300046660	Ga0495625_0232380	Ga0495625_0232380_159_578	135
399	3300047472	Ga0495686_0000506	Ga0495686_0000506_49645_50058	135
400	3300047472	Ga0495686_0057951	Ga0495686_0057951_1540_1953	135
401	3300048925	Ga0496122_0012821	Ga0496122_0012821_7829_8263	135
402	3300048926	Ga0496123_0004355	Ga0496123_0004355_2854_3288	135
403	3300048928	Ga0496125_0102264	Ga0496125_0102264_1050_1484	135
404	3300049459	Ga0495678_012902	Ga0495678_012902_804_1226	135
405	3300053098	Ga0500650_0412354	Ga0500650_0412354_110_532	135
406	3300053143	Ga0500579_169756	Ga0500579_169756_50_472	135
407	3300005455	Ga0070663_100097731	Ga0070663_1000977312	136
408	3300005614	Ga0068856_100003916	Ga0068856_1000039162	136
409	3300006195	Ga0075366_10022057	Ga0075366_100220572	136
410	3300009148	Ga0105243_10000009	Ga0105243_10000009107	136
411	3300013102	Ga0157371_10002443	Ga0157371_100024432	136
412	3300013105	Ga0157369_10001337	Ga0157369_1000133716	136
413	3300013307	Ga0157372_10000029	Ga0157372_1000002919	136
414	3300025935	Ga0207709_10000026	Ga0207709_10000026108	136
415	3300026067	Ga0207678_10008528	Ga0207678_100085286	136
416	3300026078	Ga0207702_10005404	Ga0207702_1000540413	136
417	3300028794	Ga0307515_10115348	Ga0307515_101153483	136
418	3300030744	Ga0316181_1233735	Ga0316181_12337352	136
419	3300037312	Ga0395899_0000024	Ga0395899_0000024_109965_110387	136
420	3300037312	Ga0395899_0053223	Ga0395899_0053223_2475_2900	136
421	3300037418	Ga0395900_0006558	Ga0395900_0006558_10107_10532	136
422	3300037471	Ga0395905_0002250	Ga0395905_0002250_19753_20178	136
423	3300038443	Ga0395901_0002961	Ga0395901_0002961_13976_14401	136
424	3300044656	Ga0466969_0089791	Ga0466969_0089791_455_877	136
425	3300044693	Ga0466961_0037615	Ga0466961_0037615_566_988	136
426	3300045836	Ga0466958_0004934	Ga0466958_0004934_900_1322	136
427	3300048919	Ga0496116_0000752	Ga0496116_0000752_18492_18950	136
428	3300048920	Ga0496117_0001673	Ga0496117_0001673_21458_21916	136
429	3300048921	Ga0496118_0128875	Ga0496118_0128875_148_606	136
430	3300048925	Ga0496122_0004576	Ga0496122_0004576_13593_14051	136
431	3300048926	Ga0496123_0069726	Ga0496123_0069726_627_1085	136
432	3300048928	Ga0496125_0101057	Ga0496125_0101057_68_526	136
433	3300050493	nmdc:mga0k408_158_c1	nmdc:mga0k408_158_c1_2252_2674	136
434	3300053131	Ga0500652_329066	Ga0500652_329066_151_573	136
435	3300005327	Ga0070658_10000016	Ga0070658_10000016111	137
436	3300005338	Ga0068868_100871770	Ga0068868_1008717701	137
437	3300005339	Ga0070660_100022750	Ga0070660_1000227502	137
438	3300005364	Ga0070673_100980334	Ga0070673_1009803342	137
439	3300005563	Ga0068855_100065710	Ga0068855_1000657102	137
440	3300005616	Ga0068852_100660976	Ga0068852_1006609762	137
441	3300009545	Ga0105237_10402941	Ga0105237_104029412	137
442	3300013104	Ga0157370_10094968	Ga0157370_100949682	137
443	3300013296	Ga0157374_10188840	Ga0157374_101888402	137
444	3300013297	Ga0157378_10028522	Ga0157378_100285224	137
445	3300013297	Ga0157378_10231628	Ga0157378_102316282	137
446	3300013307	Ga0157372_10681133	Ga0157372_106811332	137
447	3300021361	Ga0213872_10004758	Ga0213872_100047587	137
448	3300025909	Ga0207705_10000031	Ga0207705_10000031111	137
449	3300025949	Ga0207667_10134007	Ga0207667_101340072	137
450	3300025960	Ga0207651_10866073	Ga0207651_108660732	137
451	3300026142	Ga0207698_10501012	Ga0207698_105010122	137
452	3300026142	Ga0207698_11365830	Ga0207698_113658302	137
453	3300031251	Ga0265327_10115881	Ga0265327_101158811	137
454	3300031911	Ga0307412_10020373	Ga0307412_100203732	137
455	3300031911	Ga0307412_10928515	Ga0307412_109285152	137
456	3300031911	Ga0307412_11598372	Ga0307412_115983722	137
457	3300032004	Ga0307414_10121393	Ga0307414_101213932	137
458	3300032005	Ga0307411_10403697	Ga0307411_104036972	137
459	3300039447	Ga0436361_0928313	Ga0436361_0928313_3916_4335	137
460	3300041460	Ga0451802_1952400	Ga0451802_1952400_70_498	137
461	3300044735	Ga0466968_0200142	Ga0466968_0200142_44_472	137
462	3300045976	Ga0466967_1402819	Ga0466967_1402819_78_521	137
463	3300046474	Ga0495605_0072357	Ga0495605_0072357_561_983	137
464	3300046501	Ga0495607_0136537	Ga0495607_0136537_74_499	137
465	3300046507	Ga0495606_0117394	Ga0495606_0117394_962_1384	137
466	3300046523	Ga0495644_0017450	Ga0495644_0017450_210_635	137
467	3300046528	Ga0495642_0021766	Ga0495642_0021766_674_1099	137
468	3300046616	Ga0495668_0084118	Ga0495668_0084118_711_1136	137
469	3300046665	Ga0495661_0007909	Ga0495661_0007909_1160_1585	137
470	3300046684	Ga0495669_0193094	Ga0495669_0193094_281_706	137
471	3300047445	Ga0495677_0125466	Ga0495677_0125466_59_484	137
472	3300047470	Ga0495681_0105307	Ga0495681_0105307_271_696	137
473	iso_pu_bacteria	2896317667	2896320986	137
474	iso_pu_bacteria	3003233435	3003236907	137
475	3300003316	rootH1_10159706	rootH1_101597064	138
476	3300005327	Ga0070658_10215617	Ga0070658_102156171	138
477	3300005334	Ga0068869_100173277	Ga0068869_1001732771	138
478	3300005355	Ga0070671_100007404	Ga0070671_1000074044	138
479	3300005364	Ga0070673_100634926	Ga0070673_1006349261	138
480	3300005617	Ga0068859_102730433	Ga0068859_1027304331	138
481	3300006931	Ga0097620_102731248	Ga0097620_1027312481	138
482	3300010375	Ga0105239_10091721	Ga0105239_100917212	138
483	3300011119	Ga0105246_10382879	Ga0105246_103828791	138
484	3300013308	Ga0157375_10021212	Ga0157375_100212122	138
485	3300014969	Ga0157376_10358401	Ga0157376_103584012	138
486	3300025931	Ga0207644_10002465	Ga0207644_100024659	138
487	3300025960	Ga0207651_11974813	Ga0207651_119748131	138
488	3300028786	Ga0307517_10000255	Ga0307517_1000025559	138
489	3300032004	Ga0307414_10007351	Ga0307414_100073512	138
490	3300032004	Ga0307414_10116599	Ga0307414_101165992	138
491	3300032004	Ga0307414_10392544	Ga0307414_103925441	138
492	3300033180	Ga0307510_10003311	Ga0307510_100033116	138
493	3300037312	Ga0395899_0000400	Ga0395899_0000400_46836_47252	138
494	3300037418	Ga0395900_0000112	Ga0395900_0000112_126311_126727	138
495	3300037418	Ga0395900_0000151	Ga0395900_0000151_2008_2448	138
496	3300037466	Ga0395898_0016521	Ga0395898_0016521_153_569	138
497	3300037471	Ga0395905_0000118	Ga0395905_0000118_115219_115635	138
498	3300038443	Ga0395901_0000912	Ga0395901_0000912_16664_17080	138
499	3300046500	Ga0495596_0024260	Ga0495596_0024260_979_1404	138
500	3300046507	Ga0495606_0220492	Ga0495606_0220492_553_978	138
501	3300046507	Ga0495606_0264353	Ga0495606_0264353_418_843	138
502	3300046518	Ga0495631_0405466	Ga0495631_0405466_69_494	138
503	3300046616	Ga0495668_0438839	Ga0495668_0438839_269_694	138
504	3300046642	Ga0495634_0101003	Ga0495634_0101003_262_687	138
505	3300046660	Ga0495625_0383644	Ga0495625_0383644_266_691	138
506	3300046694	Ga0495649_0028517	Ga0495649_0028517_2483_2908	138
507	3300047443	Ga0495687_000796	Ga0495687_000796_26549_26971	138
508	3300048929	Ga0496126_0343238	Ga0496126_0343238_182_610	138
509	3300049460	Ga0495682_0161432	Ga0495682_0161432_13_438	138
510	3300053122	Ga0500608_003569	Ga0500608_003569_5058_5483	138
511	3300003320	rootH2_10000823	rootH2_1000082362	139
512	3300005339	Ga0070660_100664082	Ga0070660_1006640822	139
513	3300005577	Ga0068857_101458704	Ga0068857_1014587041	139
514	3300009545	Ga0105237_10167565	Ga0105237_101675653	139
515	3300010375	Ga0105239_10515874	Ga0105239_105158741	139
516	3300025909	Ga0207705_10239091	Ga0207705_102390911	139
517	3300042005	Ga0439448_0001359	Ga0439448_0001359_2915_3346	140
518	3300001904	JGI24736J21556_1002958	JGI24736J21556_10029582	141
519	3300002077	JGI24744J21845_10007338	JGI24744J21845_100073382	141
520	3300005328	Ga0070676_10001794	Ga0070676_100017946	141
521	3300005337	Ga0070682_101066644	Ga0070682_1010666442	141
522	3300005338	Ga0068868_102060811	Ga0068868_1020608111	141
523	3300005339	Ga0070660_100034305	Ga0070660_1000343054	141
524	3300005355	Ga0070671_100758140	Ga0070671_1007581401	141
525	3300005356	Ga0070674_100484187	Ga0070674_1004841871	141
526	3300005364	Ga0070673_100096848	Ga0070673_1000968482	141
527	3300005364	Ga0070673_100928232	Ga0070673_1009282321	141
528	3300005365	Ga0070688_100254589	Ga0070688_1002545892	141
529	3300005366	Ga0070659_100198866	Ga0070659_1001988661	141
530	3300005456	Ga0070678_100002112	Ga0070678_10000211211	141
531	3300005457	Ga0070662_100000043	Ga0070662_1000000434	141
532	3300005459	Ga0068867_100003386	Ga0068867_1000033866	141
533	3300005535	Ga0070684_100875116	Ga0070684_1008751161	141
534	3300005539	Ga0068853_100091065	Ga0068853_1000910652	141
535	3300005543	Ga0070672_100258766	Ga0070672_1002587662	141
536	3300005548	Ga0070665_100000012	Ga0070665_100000012164	141
537	3300005563	Ga0068855_100081542	Ga0068855_1000815422	141
538	3300005614	Ga0068856_100686570	Ga0068856_1006865702	141
539	3300005616	Ga0068852_100754661	Ga0068852_1007546612	141
540	3300005616	Ga0068852_102154323	Ga0068852_1021543232	141
541	3300005618	Ga0068864_101592349	Ga0068864_1015923491	141
542	3300005718	Ga0068866_10006139	Ga0068866_100061392	141
543	3300005834	Ga0068851_10172490	Ga0068851_101724902	141
544	3300005842	Ga0068858_100466013	Ga0068858_1004660133	141
545	3300006237	Ga0097621_100000069	Ga0097621_10000006941	141
546	3300006358	Ga0068871_100000649	Ga0068871_10000064911	141
547	3300006881	Ga0068865_100000098	Ga0068865_10000009834	141
548	3300009093	Ga0105240_10009770	Ga0105240_1000977011	141
549	3300009093	Ga0105240_10462652	Ga0105240_104626522	141
550	3300009093	Ga0105240_10701000	Ga0105240_107010001	141
551	3300009174	Ga0105241_10011602	Ga0105241_100116026	141
552	3300009174	Ga0105241_10014012	Ga0105241_100140123	141
553	3300009176	Ga0105242_10062478	Ga0105242_100624782	141
554	3300009545	Ga0105237_10001888	Ga0105237_100018882	141
555	3300009545	Ga0105237_10013533	Ga0105237_100135339	141
556	3300009545	Ga0105237_10663752	Ga0105237_106637522	141
557	3300009551	Ga0105238_10009373	Ga0105238_100093736	141
558	3300010375	Ga0105239_10111206	Ga0105239_101112062	141
559	3300010375	Ga0105239_10682195	Ga0105239_106821952	141
560	3300011119	Ga0105246_10050501	Ga0105246_100505012	141
561	3300011119	Ga0105246_12108071	Ga0105246_121080711	141
562	3300013100	Ga0157373_10068879	Ga0157373_100688792	141
563	3300013104	Ga0157370_10466252	Ga0157370_104662521	141
564	3300013105	Ga0157369_10380423	Ga0157369_103804231	141
565	3300013296	Ga0157374_10000360	Ga0157374_100003606	141
566	3300013296	Ga0157374_10004643	Ga0157374_100046436	141
567	3300013297	Ga0157378_10068857	Ga0157378_100688574	141
568	3300013306	Ga0163162_10000013	Ga0163162_10000013136	141
569	3300013306	Ga0163162_10008405	Ga0163162_100084058	141
570	3300013307	Ga0157372_10497337	Ga0157372_104973372	141
571	3300013308	Ga0157375_10630899	Ga0157375_106308992	141
572	3300014745	Ga0157377_10445013	Ga0157377_104450131	141
573	3300025321	Ga0207656_10284317	Ga0207656_102843172	141
574	3300025899	Ga0207642_10014545	Ga0207642_100145454	141
575	3300025904	Ga0207647_10000453	Ga0207647_1000045322	141
576	3300025907	Ga0207645_10000205	Ga0207645_100002058	141
577	3300025911	Ga0207654_10001957	Ga0207654_100019579	141
578	3300025911	Ga0207654_10005664	Ga0207654_100056643	141
579	3300025913	Ga0207695_10054113	Ga0207695_100541136	141
580	3300025913	Ga0207695_10089703	Ga0207695_100897032	141
581	3300025914	Ga0207671_10000799	Ga0207671_1000079916	141
582	3300025914	Ga0207671_10011797	Ga0207671_100117977	141
583	3300025919	Ga0207657_10066872	Ga0207657_100668722	141
584	3300025924	Ga0207694_10010693	Ga0207694_100106932	141
585	3300025931	Ga0207644_10666833	Ga0207644_106668331	141
586	3300025932	Ga0207690_10037188	Ga0207690_100371882	141
587	3300025933	Ga0207706_10000466	Ga0207706_100004664	141
588	3300025934	Ga0207686_10036258	Ga0207686_100362582	141
589	3300025938	Ga0207704_10000151	Ga0207704_1000015123	141
590	3300025940	Ga0207691_10230408	Ga0207691_102304082	141
591	3300025949	Ga0207667_10066766	Ga0207667_100667662	141
592	3300025960	Ga0207651_10104747	Ga0207651_101047472	141
593	3300025981	Ga0207640_11216633	Ga0207640_112166331	141
594	3300026035	Ga0207703_10421441	Ga0207703_104214412	141
595	3300026041	Ga0207639_10020583	Ga0207639_100205833	141
596	3300026089	Ga0207648_10007310	Ga0207648_100073107	141
597	3300026121	Ga0207683_10003532	Ga0207683_1000353210	141
598	3300026142	Ga0207698_10024015	Ga0207698_100240156	141
599	3300026142	Ga0207698_10670931	Ga0207698_106709312	141
600	3300028379	Ga0268266_10000080	Ga0268266_10000080157	141
601	3300046471	Ga0495650_0096685	Ga0495650_0096685_583_1017	141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00436

SSB

Single-strand binding protein family

4

106

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3tqy-assembly1.cif.gz_D	structure of a single-stranded dna-binding protein (ssb), from coxiella burnetii	0.9667	3	107
5odn-assembly1.cif.gz_H	salinibacter ruber single-strand binding protein	0.9572	1	106
5odn-assembly1.cif.gz_C	salinibacter ruber single-strand binding protein	0.9516	1	106
8gw5-assembly1.cif.gz_B-2	crystal structure of sassba complexed with glycerol	0.9513	4	107
6bhw-assembly2.cif.gz_G	b. subtilis ssba	0.9482	4	107

ID	Description	Score	Start	End	Superfamily
5odnH00	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9572	1	106	2.40.50.140
6bhwF00	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9348	4	104	2.40.50.140
5odnH00	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9293	1	106	2.40.50.140
2vw9B00	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9283	4	107	2.40.50.140
2cwaA01	Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins	0.9173	3	107	2.40.50.140

ID	Description	Score	Start	End	GO Terms
AF-A0A2E9IVH4-F1-model_v4	Single-stranded DNA-binding protein (SSB)	0.9509	4	108	GO:0003697 GO:0006260 GO:0009295
AF-A0A1H1MGB8-F1-model_v4	Single-stranded DNA-binding protein (SSB)	0.9443	1	113	GO:0003697 GO:0006260 GO:0009295
AF-A0A1F3IVI4-F1-model_v4	Single-stranded DNA-binding protein	0.9407	4	108	GO:0003697 GO:0006260 GO:0009295
AF-A0A1S6TP42-F1-model_v4	deleted	0.9394	4	110
AF-A0A2H0SJT5-F1-model_v4	Single-stranded DNA-binding protein	0.9386	3	109	GO:0003697 GO:0006260 GO:0009295

Feature Viewer

pLDDT	pTM	Quality
79.44	0.65	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F468054

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00436

SSB

Single-strand binding protein family

4

106

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map