F467942

General Info

Members Datasets Scaffolds Average Seq Length
600 240 598 380

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100003487|Ga0070683_1000034877
Length 428
Sequence MCVYVPMFLYGEKNGTLRPFHGRTIFPHNPFLNPINHGSSLYCIMSDYLNISDFLSPVNFNEISQDEGYRDGQIGQAISVYKSLKYPAKKFPELDDAQIVIVGCGEQRGSGLIHGQSEAPDLVRRQLYSLYYWHKDVKIADIGNIMAGSLYTDSYAALKTVVHELINDGKTVIILGGSHDLTLAQYGAYVENEKAIEASCVDALIDLNIDSPFRHENFLMEMLTSEPNYIRHYNHIAFQSFYVHPQMLETMDKLRFDCYRVGTVKETIEEMEPVIRNSSLFSFDISALAHAYAPAKSVSPNGLNGEEACVLMRYAGMSPNVNSIGIYGFDSAHDKDELTAKQVAHMIWYVLDGRSRGRKEVELNQRDSFNEYHIAFAEVETTFLQSKKTGRWWMQLPDKNFIACSYKDYLLASSNEIPERWLRAQERN

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
159 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
169 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
170 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
171 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
172 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
213 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
214 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
219 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
230 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
231 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
232 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
233 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
238 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
239 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.17
Nodule 0
Rhizoplane 0.33
Rhizosphere 93.5
Stem 0
Stem Tuber 0
Unclassified 3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10004971 3300002459 Bacteria 2710
2 JGI25406J46586_10010213 3300003203 Bacteria 4173
3 rootH1_10101916 3300003316 Bacteria 2694
4 rootH1_10101916 3300003323 Bacteria 3008
5 rootH2_10115690 3300003320 Bacteria 3922
6 rootL2_10077433 3300003322 Unclassified 1242
7 rootL2_10096474 3300003322 Bacteria 2887
8 rootL2_10277670 3300003322 Bacteria 3245
9 rootL2_10305125 3300003322 Bacteria 5569
10 rootH1_10007189 3300003323 Bacteria 65578
11 rootH1_10035284 3300003323 Bacteria 47456
12 rootH1_10087635 3300003323 Bacteria 3663
13 Ga0065712_10000434 3300005290 Bacteria 11955
14 Ga0065712_10002062 3300005290 Bacteria 4904
15 Ga0065712_10101391 3300005290 Bacteria 2036
16 Ga0065712_10107718 3300005290 Bacteria 1890
17 Ga0065715_10002214 3300005293 Bacteria 4974
18 Ga0065715_10209021 3300005293 Bacteria 1323
19 Ga0065707_10089933 3300005295 Unclassified 4248
20 Ga0070658_10008688 3300005327 Bacteria 8159
21 Ga0070676_10001941 3300005328 Bacteria 10514
22 Ga0070676_10006102 3300005328 Bacteria 6434
23 Ga0070676_10020891 3300005328 Unclassified 3661
24 Ga0070683_100003487 3300005329 Bacteria 12787
25 Ga0070683_100110751 3300005329 Bacteria 2590
26 Ga0070690_100009903 3300005330 Bacteria 5529
27 Ga0070670_100023966 3300005331 Bacteria 5250
28 Ga0070670_100029246 3300005331 Bacteria 4741
29 Ga0070670_100049547 3300005331 Bacteria 3611
30 Ga0070670_100053970 3300005331 Unclassified 3450
31 Ga0070670_100206252 3300005331 Bacteria 1708
32 Ga0070670_100231078 3300005331 Bacteria 1610
33 Ga0070670_100298612 3300005331 Unclassified 1408
34 Ga0070677_10031246 3300005333 Bacteria 2034
35 Ga0068869_100001625 3300005334 Bacteria 13378
36 Ga0068869_100007430 3300005334 Bacteria 7004
37 Ga0068869_100008048 3300005334 Bacteria 6773
38 Ga0068869_100015864 3300005334 Bacteria 5067
39 Ga0068869_100086155 3300005334 Bacteria 2354
40 Ga0068869_100168340 3300005334 Bacteria 1710
41 Ga0070666_10005771 3300005335 Bacteria 7605
42 Ga0070666_10117435 3300005335 Bacteria 1843
43 Ga0070680_100012142 3300005336 Bacteria 6689
44 Ga0070680_100152052 3300005336 Unclassified 1943
45 Ga0070682_100177623 3300005337 Bacteria 1485
46 Ga0068868_100003840 3300005338 Bacteria 10491
47 Ga0068868_100003978 3300005338 Bacteria 10317
48 Ga0068868_100080390 3300005338 Bacteria 2612
49 Ga0068868_100127492 3300005338 Unclassified 2080
50 Ga0068868_100230554 3300005338 Unclassified 1553
51 Ga0070660_100259647 3300005339 Bacteria 1418
52 Ga0070689_100010915 3300005340 Bacteria 6491
53 Ga0070689_100122192 3300005340 Bacteria 2080
54 Ga0070689_100128807 3300005340 Unclassified 2028
55 Ga0070691_10005362 3300005341 Bacteria 5833
56 Ga0070661_100012988 3300005344 Bacteria 5838
57 Ga0070661_100014515 3300005344 Bacteria 5550
58 Ga0070661_100068703 3300005344 Bacteria 2604
59 Ga0070661_100098889 3300005344 Bacteria 2167
60 Ga0070668_100009954 3300005347 Bacteria 7042
61 Ga0070668_100083519 3300005347 Bacteria 2507
62 Ga0070668_100278131 3300005347 Bacteria 1397
63 Ga0070669_100001433 3300005353 Bacteria 17250
64 Ga0070669_100054679 3300005353 Bacteria 2924
65 Ga0070669_100060136 3300005353 Unclassified 2791
66 Ga0070669_100092891 3300005353 Bacteria 2265
67 Ga0070675_100012708 3300005354 Bacteria 6603
68 Ga0070675_100035837 3300005354 Bacteria 4034
69 Ga0070675_100050307 3300005354 Bacteria 3422
70 Ga0070675_100110467 3300005354 Bacteria 2325
71 Ga0070671_100020125 3300005355 Bacteria 5438
72 Ga0070671_100057848 3300005355 Unclassified 3227
73 Ga0070674_100004213 3300005356 Bacteria 8173
74 Ga0070674_100041129 3300005356 Bacteria 3130
75 Ga0070674_100043851 3300005356 Bacteria 3045
76 Ga0070674_100262208 3300005356 Bacteria 1362
77 Ga0070673_100001998 3300005364 Bacteria 12304
78 Ga0070673_100003313 3300005364 Bacteria 10002
79 Ga0070673_100017110 3300005364 Bacteria 5145
80 Ga0070673_100080282 3300005364 Bacteria 2643
81 Ga0070673_100148135 3300005364 Bacteria 1986
82 Ga0070688_100004162 3300005365 Bacteria 7507
83 Ga0070688_100007875 3300005365 Bacteria 5758
84 Ga0070688_100071829 3300005365 Bacteria 2216
85 Ga0070688_100128453 3300005365 Unclassified 1707
86 Ga0070688_100137251 3300005365 Unclassified 1657
87 Ga0070659_100005954 3300005366 Bacteria 8790
88 Ga0070667_100013188 3300005367 Bacteria 6832
89 Ga0070667_100023752 3300005367 Bacteria 5089
90 Ga0070667_100036043 3300005367 Bacteria 4146
91 Ga0070667_100049482 3300005367 Bacteria 3540
92 Ga0070667_100064406 3300005367 Bacteria 3110
93 Ga0070667_100087236 3300005367 Bacteria 2678
94 Ga0070667_100128969 3300005367 Bacteria 2206
95 Ga0070667_100131801 3300005367 Bacteria 2182
96 Ga0070667_100144510 3300005367 Bacteria 2085
97 Ga0070701_10014567 3300005438 Unclassified 3609
98 Ga0070678_100129205 3300005456 Bacteria 2005
99 Ga0070678_100131792 3300005456 Bacteria 1987
100 Ga0068867_100014436 3300005459 Bacteria 5598
101 Ga0068867_100018934 3300005459 Bacteria 4900
102 Ga0068867_100021622 3300005459 Unclassified 4592
103 Ga0068867_100274761 3300005459 Unclassified 1379
104 Ga0070685_10001538 3300005466 Bacteria 12167
105 Ga0070685_10038662 3300005466 Bacteria 2707
106 Ga0070685_10121272 3300005466 Bacteria 1624
107 Ga0070698_100001254 3300005471 Bacteria 28366
108 Ga0070698_100060091 3300005471 Unclassified 3836
109 Ga0070684_100002978 3300005535 Bacteria 12605
110 Ga0070684_100023965 3300005535 Bacteria 5113
111 Ga0068853_100001650 3300005539 Bacteria 16317
112 Ga0068853_100032217 3300005539 Bacteria 4439
113 Ga0068853_100173025 3300005539 Bacteria 1954
114 Ga0070672_100014495 3300005543 Bacteria 5589
115 Ga0070672_100041604 3300005543 Bacteria 3534
116 Ga0070672_100090896 3300005543 Bacteria 2463
117 Ga0070672_100124493 3300005543 Unclassified 2113
118 Ga0070686_100021403 3300005544 Bacteria 3844
119 Ga0070686_100021460 3300005544 Bacteria 3840
120 Ga0070686_100033898 3300005544 Bacteria 3141
121 Ga0070693_100205962 3300005547 Bacteria 1280
122 Ga0070665_100032974 3300005548 Bacteria 5211
123 Ga0070665_100077899 3300005548 Bacteria 3321
124 Ga0068855_100002787 3300005563 Bacteria 21515
125 Ga0068855_100086514 3300005563 Bacteria 3625
126 Ga0070664_100024111 3300005564 Bacteria 5030
127 Ga0070664_100036554 3300005564 Bacteria 4126
128 Ga0070664_100133242 3300005564 Bacteria 2183
129 Ga0068857_100002193 3300005577 Bacteria 15892
130 Ga0068857_100059529 3300005577 Bacteria 3393
131 Ga0068857_100116199 3300005577 Bacteria 2407
132 Ga0068854_100081230 3300005578 Bacteria 2394
133 Ga0068856_100055301 3300005614 Bacteria 3916
134 Ga0068856_100450810 3300005614 Unclassified 1307
135 Ga0070702_100011994 3300005615 Bacteria 4327
136 Ga0070702_100179336 3300005615 Unclassified 1385
137 Ga0068852_100016882 3300005616 Bacteria 5710
138 Ga0068852_100021477 3300005616 Bacteria 5156
139 Ga0068852_100024905 3300005616 Bacteria 4842
140 Ga0068852_100107838 3300005616 Bacteria 2527
141 Ga0068852_100123759 3300005616 Bacteria 2372
142 Ga0068852_100218054 3300005616 Bacteria 1813
143 Ga0068852_100310938 3300005616 Bacteria 1528
144 Ga0068859_100000006 3300005617 Bacteria 421509
145 Ga0068859_100004048 3300005617 Bacteria 14943
146 Ga0068859_100032162 3300005617 Bacteria 5270
147 Ga0068859_100047939 3300005617 Bacteria 4292
148 Ga0068859_100094016 3300005617 Unclassified 3049
149 Ga0068859_100154063 3300005617 Bacteria 2375
150 Ga0068859_100210746 3300005617 Bacteria 2029
151 Ga0068864_100017629 3300005618 Bacteria 5953
152 Ga0068864_100054938 3300005618 Unclassified 3437
153 Ga0068864_100060749 3300005618 Bacteria 3272
154 Ga0068864_100070541 3300005618 Bacteria 3040
155 Ga0068864_100075470 3300005618 Bacteria 2943
156 Ga0068864_100218739 3300005618 Unclassified 1757
157 Ga0068866_10006389 3300005718 Bacteria 4908
158 Ga0068866_10015504 3300005718 Unclassified 3386
159 Ga0068866_10106990 3300005718 Bacteria 1553
160 Ga0068861_100015974 3300005719 Bacteria 5301
161 Ga0068861_100025908 3300005719 Bacteria 4258
162 Ga0068861_100084769 3300005719 Bacteria 2488
163 Ga0068851_10043079 3300005834 Unclassified 2274
164 Ga0068851_10048221 3300005834 Bacteria 2159
165 Ga0068851_10097447 3300005834 Unclassified 1556
166 Ga0068870_10005637 3300005840 Bacteria 5476
167 Ga0068863_100001827 3300005841 Bacteria 21152
168 Ga0068863_100005104 3300005841 Bacteria 12952
169 Ga0068863_100006901 3300005841 Bacteria 11127
170 Ga0068863_100016212 3300005841 Bacteria 7149
171 Ga0068863_100026858 3300005841 Bacteria 5491
172 Ga0068863_100054119 3300005841 Bacteria 3803
173 Ga0068863_100115510 3300005841 Bacteria 2557
174 Ga0068858_100000978 3300005842 Bacteria 29516
175 Ga0068858_100005962 3300005842 Bacteria 11898
176 Ga0068858_100018759 3300005842 Bacteria 6470
177 Ga0068858_100104633 3300005842 Bacteria 2641
178 Ga0068858_100152130 3300005842 Bacteria 2176
179 Ga0068860_100001713 3300005843 Bacteria 23427
180 Ga0068860_100001937 3300005843 Bacteria 21898
181 Ga0068860_100009424 3300005843 Bacteria 9703
182 Ga0068860_100050621 3300005843 Bacteria 3953
183 Ga0068860_100068298 3300005843 Unclassified 3377
184 Ga0068860_100119490 3300005843 Bacteria 2523
185 Ga0068860_100148607 3300005843 Bacteria 2255
186 Ga0068860_100222009 3300005843 Bacteria 1835
187 Ga0068862_100007369 3300005844 Bacteria 9127
188 Ga0068862_100087521 3300005844 Bacteria 2709
189 Ga0068862_100133346 3300005844 Unclassified 2199
190 Ga0068862_100174190 3300005844 Bacteria 1927
191 Ga0081539_10000524 3300005985 Bacteria 79740
192 Ga0081539_10024411 3300005985 Bacteria 3922
193 Ga0075366_10045471 3300006195 Bacteria 2602
194 Ga0075366_10121840 3300006195 Bacteria 1572
195 Ga0097621_100006400 3300006237 Bacteria 8358
196 Ga0097621_100023550 3300006237 Bacteria 4795
197 Ga0097621_100090247 3300006237 Unclassified 2564
198 Ga0097621_100169656 3300006237 Bacteria 1880
199 Ga0068871_100004492 3300006358 Bacteria 9715
200 Ga0068871_100119991 3300006358 Bacteria 2220
201 Ga0068871_100126635 3300006358 Bacteria 2162
202 Ga0075428_100018105 3300006844 Bacteria 7784
203 Ga0075430_100015148 3300006846 Bacteria 6564
204 Ga0075430_100052787 3300006846 Bacteria 3424
205 Ga0075431_100207726 3300006847 Bacteria 2001
206 Ga0075434_100091222 3300006871 Bacteria 3049
207 Ga0075429_100041932 3300006880 Bacteria 3984
208 Ga0075429_100100922 3300006880 Unclassified 2519
209 Ga0075429_100115602 3300006880 Bacteria 2345
210 Ga0068865_100047257 3300006881 Bacteria 2956
211 Ga0097620_100000006 3300006931 Bacteria 421509
212 Ga0097620_100004048 3300006931 Bacteria 14943
213 Ga0097620_100032162 3300006931 Bacteria 5270
214 Ga0097620_100047939 3300006931 Bacteria 4292
215 Ga0097620_100094016 3300006931 Unclassified 3049
216 Ga0097620_100154050 3300006931 Bacteria 2375
217 Ga0097620_100210736 3300006931 Bacteria 2029
218 Ga0105240_10074304 3300009093 Bacteria 4197
219 Ga0105240_10092853 3300009093 Bacteria 3684
220 Ga0111539_10005159 3300009094 Bacteria 16933
221 Ga0111539_10049141 3300009094 Bacteria 5033
222 Ga0111539_10135256 3300009094 Unclassified 2887
223 Ga0105245_10045110 3300009098 Bacteria 3936
224 Ga0105247_10000312 3300009101 Bacteria 43730
225 Ga0105247_10018426 3300009101 Bacteria 4187
226 Ga0105247_10108745 3300009101 Bacteria 1782
227 Ga0114129_10010099 3300009147 Bacteria 13459
228 Ga0114129_10091782 3300009147 Bacteria 4207
229 Ga0105243_10144257 3300009148 Unclassified 2035
230 Ga0105243_10188156 3300009148 Unclassified 1801
231 Ga0105243_10211744 3300009148 Bacteria 1707
232 Ga0105241_10003261 3300009174 Bacteria 12073
233 Ga0105241_10108956 3300009174 Bacteria 2214
234 Ga0105241_10118500 3300009174 Bacteria 2129
235 Ga0105241_10125883 3300009174 Bacteria 2069
236 Ga0105241_10192014 3300009174 Bacteria 1700
237 Ga0105242_10002533 3300009176 Bacteria 14345
238 Ga0105242_10030627 3300009176 Bacteria 4297
239 Ga0105242_10037443 3300009176 Unclassified 3897
240 Ga0105242_10063078 3300009176 Bacteria 3051
241 Ga0105242_10269422 3300009176 Bacteria 1542
242 Ga0105237_10009282 3300009545 Bacteria 10539
243 Ga0105237_10009309 3300009545 Bacteria 10522
244 Ga0105237_10096207 3300009545 Bacteria 2952
245 Ga0105249_10002054 3300009553 Bacteria 17468
246 Ga0105249_10005038 3300009553 Bacteria 11383
247 Ga0105249_10010745 3300009553 Bacteria 8043
248 Ga0105249_10019466 3300009553 Bacteria 6057
249 Ga0105249_10023676 3300009553 Bacteria 5513
250 Ga0105249_10031101 3300009553 Bacteria 4826
251 Ga0105249_10038455 3300009553 Bacteria 4342
252 Ga0105239_10004591 3300010375 Bacteria 16454
253 Ga0105239_10013556 3300010375 Bacteria 9050
254 Ga0105239_10027328 3300010375 Bacteria 6281
255 Ga0105239_10085379 3300010375 Bacteria 3478
256 Ga0105239_10250619 3300010375 Bacteria 1989
257 Ga0105246_10015478 3300011119 Bacteria 4821
258 Ga0105246_10024009 3300011119 Bacteria 3954
259 Ga0105246_10084483 3300011119 Bacteria 2271
260 Ga0157371_10119656 3300013102 Bacteria 1872
261 Ga0157371_10163444 3300013102 Bacteria 1590
262 Ga0157370_10017464 3300013104 Bacteria 7239
263 Ga0157370_10088674 3300013104 Bacteria 2905
264 Ga0157374_10003783 3300013296 Bacteria 12734
265 Ga0157374_10010915 3300013296 Bacteria 7842
266 Ga0157374_10013640 3300013296 Bacteria 7099
267 Ga0157374_10054655 3300013296 Unclassified 3725
268 Ga0157374_10155804 3300013296 Unclassified 2223
269 Ga0157374_10163362 3300013296 Bacteria 2170
270 Ga0157374_10221565 3300013296 Bacteria 1856
271 Ga0157374_10238111 3300013296 Bacteria 1789
272 Ga0157374_10280465 3300013296 Unclassified 1645
273 Ga0157378_10002733 3300013297 Bacteria 15712
274 Ga0157378_10005036 3300013297 Bacteria 11601
275 Ga0157378_10006318 3300013297 Bacteria 10380
276 Ga0157378_10084137 3300013297 Bacteria 2880
277 Ga0157378_10114140 3300013297 Bacteria 2481
278 Ga0157378_10121851 3300013297 Bacteria 2405
279 Ga0163162_10000112 3300013306 Bacteria 72032
280 Ga0163162_10000131 3300013306 Bacteria 67924
281 Ga0163162_10004410 3300013306 Bacteria 13542
282 Ga0163162_10010071 3300013306 Bacteria 9190
283 Ga0163162_10028572 3300013306 Bacteria 5519
284 Ga0163162_10323274 3300013306 Unclassified 1675
285 Ga0163162_10328213 3300013306 Bacteria 1663
286 Ga0157372_10306417 3300013307 Bacteria 1848
287 Ga0157372_10416385 3300013307 Bacteria 1566
288 Ga0157372_10584835 3300013307 Bacteria 1301
289 Ga0157375_10022049 3300013308 Bacteria 5857
290 Ga0157375_10022627 3300013308 Bacteria 5787
291 Ga0157375_10035324 3300013308 Bacteria 4770
292 Ga0157375_10042985 3300013308 Bacteria 4378
293 Ga0157375_10054488 3300013308 Bacteria 3939
294 Ga0157375_10082417 3300013308 Bacteria 3259
295 Ga0157375_10091908 3300013308 Bacteria 3097
296 Ga0157375_10110988 3300013308 Bacteria 2841
297 Ga0163163_10000591 3300014325 Bacteria 31919
298 Ga0163163_10009405 3300014325 Bacteria 8726
299 Ga0163163_10034704 3300014325 Bacteria 4888
300 Ga0163163_10066537 3300014325 Bacteria 3579
301 Ga0163163_10082757 3300014325 Bacteria 3214
302 Ga0163163_10124034 3300014325 Bacteria 2619
303 Ga0163163_10416645 3300014325 Unclassified 1402
304 Ga0157380_10001068 3300014326 Bacteria 17581
305 Ga0157380_10001169 3300014326 Bacteria 17017
306 Ga0157380_10010298 3300014326 Bacteria 6722
307 Ga0157380_10015019 3300014326 Bacteria 5681
308 Ga0157380_10118022 3300014326 Bacteria 2242
309 Ga0157377_10008303 3300014745 Bacteria 5060
310 Ga0157377_10013064 3300014745 Unclassified 4193
311 Ga0157377_10018573 3300014745 Bacteria 3616
312 Ga0157377_10031212 3300014745 Unclassified 2894
313 Ga0157379_10003004 3300014968 Bacteria 14237
314 Ga0157379_10018533 3300014968 Bacteria 6140
315 Ga0157379_10035414 3300014968 Bacteria 4451
316 Ga0157379_10090101 3300014968 Bacteria 2752
317 Ga0157376_10010354 3300014969 Bacteria 6815
318 Ga0157376_10020219 3300014969 Bacteria 5146
319 Ga0157376_10062072 3300014969 Bacteria 3144
320 Ga0157376_10105580 3300014969 Unclassified 2470
321 Ga0157376_10401953 3300014969 Bacteria 1325
322 Ga0163161_10004241 3300017792 Bacteria 9999
323 Ga0163161_10058603 3300017792 Bacteria 2799
324 Ga0209646_1001982 3300025246 Bacteria 4923
325 Ga0207697_10012253 3300025315 Bacteria 3600
326 Ga0207656_10050111 3300025321 Bacteria 1802
327 Ga0207682_10041656 3300025893 Bacteria 1875
328 Ga0207642_10027615 3300025899 Unclassified 2325
329 Ga0207710_10000279 3300025900 Bacteria 41660
330 Ga0207688_10011957 3300025901 Bacteria 4725
331 Ga0207680_10000137 3300025903 Bacteria 34668
332 Ga0207680_10022126 3300025903 Bacteria 3452
333 Ga0207645_10001948 3300025907 Bacteria 16635
334 Ga0207645_10003345 3300025907 Bacteria 12223
335 Ga0207645_10043300 3300025907 Bacteria 2881
336 Ga0207643_10013845 3300025908 Bacteria 4376
337 Ga0207643_10028936 3300025908 Bacteria 3080
338 Ga0207705_10104108 3300025909 Bacteria 2091
339 Ga0207654_10007840 3300025911 Bacteria 5383
340 Ga0207707_10006847 3300025912 Bacteria 9940
341 Ga0207695_10004034 3300025913 Bacteria 20201
342 Ga0207695_10065684 3300025913 Bacteria 3729
343 Ga0207671_10000453 3300025914 Bacteria 56447
344 Ga0207671_10006236 3300025914 Bacteria 10686
345 Ga0207671_10018798 3300025914 Bacteria 5294
346 Ga0207671_10134858 3300025914 Bacteria 1897
347 Ga0207662_10038647 3300025918 Bacteria 2797
348 Ga0207649_10008437 3300025920 Bacteria 5620
349 Ga0207649_10008998 3300025920 Bacteria 5456
350 Ga0207652_10004343 3300025921 Bacteria 11552
351 Ga0207681_10057308 3300025923 Unclassified 2662
352 Ga0207681_10058375 3300025923 Bacteria 2642
353 Ga0207681_10125639 3300025923 Bacteria 1888
354 Ga0207650_10008101 3300025925 Bacteria 7163
355 Ga0207650_10079084 3300025925 Bacteria 2489
356 Ga0207650_10191081 3300025925 Bacteria 1636
357 Ga0207659_10007864 3300025926 Bacteria 6590
358 Ga0207659_10047490 3300025926 Bacteria 3037
359 Ga0207659_10051737 3300025926 Bacteria 2923
360 Ga0207644_10073269 3300025931 Unclassified 2511
361 Ga0207644_10078668 3300025931 Unclassified 2431
362 Ga0207690_10026828 3300025932 Bacteria 3632
363 Ga0207706_10005211 3300025933 Bacteria 12133
364 Ga0207706_10014054 3300025933 Bacteria 7260
365 Ga0207706_10082129 3300025933 Bacteria 2832
366 Ga0207686_10000464 3300025934 Bacteria 26868
367 Ga0207686_10194764 3300025934 Bacteria 1447
368 Ga0207670_10016024 3300025936 Bacteria 4495
369 Ga0207670_10016473 3300025936 Bacteria 4442
370 Ga0207670_10082442 3300025936 Unclassified 2254
371 Ga0207669_10006414 3300025937 Bacteria 5375
372 Ga0207704_10025768 3300025938 Bacteria 3214
373 Ga0207704_10046840 3300025938 Unclassified 2580
374 Ga0207704_10077336 3300025938 Bacteria 2136
375 Ga0207691_10001320 3300025940 Bacteria 24748
376 Ga0207691_10004686 3300025940 Bacteria 13245
377 Ga0207691_10045795 3300025940 Bacteria 4021
378 Ga0207691_10071665 3300025940 Unclassified 3126
379 Ga0207691_10092187 3300025940 Bacteria 2713
380 Ga0207691_10094622 3300025940 Unclassified 2673
381 Ga0207691_10195119 3300025940 Bacteria 1764
382 Ga0207689_10001798 3300025942 Bacteria 20241
383 Ga0207689_10002434 3300025942 Bacteria 17330
384 Ga0207689_10002915 3300025942 Bacteria 15788
385 Ga0207689_10009375 3300025942 Bacteria 8460
386 Ga0207689_10024634 3300025942 Bacteria 5047
387 Ga0207689_10028720 3300025942 Bacteria 4651
388 Ga0207689_10090483 3300025942 Bacteria 2514
389 Ga0207661_10092106 3300025944 Bacteria 2526
390 Ga0207661_10277826 3300025944 Unclassified 1496
391 Ga0207679_10005681 3300025945 Bacteria 7821
392 Ga0207679_10014791 3300025945 Bacteria 5139
393 Ga0207679_10039082 3300025945 Bacteria 3386
394 Ga0207679_10243433 3300025945 Bacteria 1525
395 Ga0207679_10283069 3300025945 Unclassified 1423
396 Ga0207679_10401226 3300025945 Bacteria 1206
397 Ga0207667_10009381 3300025949 Bacteria 11531
398 Ga0207651_10006759 3300025960 Bacteria 6043
399 Ga0207651_10020541 3300025960 Bacteria 3989
400 Ga0207651_10026913 3300025960 Unclassified 3602
401 Ga0207651_10075460 3300025960 Unclassified 2406
402 Ga0207651_10137454 3300025960 Bacteria 1882
403 Ga0207651_10184037 3300025960 Unclassified 1660
404 Ga0207651_10185472 3300025960 Bacteria 1655
405 Ga0207712_10000590 3300025961 Bacteria 29093
406 Ga0207712_10001092 3300025961 Bacteria 18944
407 Ga0207712_10032445 3300025961 Bacteria 3526
408 Ga0207712_10074620 3300025961 Bacteria 2449
409 Ga0207712_10133079 3300025961 Bacteria 1898
410 Ga0207712_10202688 3300025961 Bacteria 1574
411 Ga0207712_10247960 3300025961 Unclassified 1438
412 Ga0207668_10039134 3300025972 Bacteria 3188
413 Ga0207640_10080847 3300025981 Bacteria 2220
414 Ga0207658_10011788 3300025986 Bacteria 5955
415 Ga0207658_10051266 3300025986 Bacteria 3040
416 Ga0207658_10200741 3300025986 Bacteria 1665
417 Ga0207677_10007353 3300026023 Bacteria 6084
418 Ga0207677_10017478 3300026023 Bacteria 4277
419 Ga0207677_10173663 3300026023 Bacteria 1688
420 Ga0207677_10209533 3300026023 Viruses 1555
421 Ga0207677_10252239 3300026023 Unclassified 1434
422 Ga0207703_10037381 3300026035 Bacteria 3867
423 Ga0207703_10079871 3300026035 Bacteria 2723
424 Ga0207703_10136275 3300026035 Bacteria 2125
425 Ga0207703_10176717 3300026035 Unclassified 1881
426 Ga0207639_10004327 3300026041 Bacteria 9571
427 Ga0207639_10009858 3300026041 Bacteria 6598
428 Ga0207639_10116282 3300026041 Unclassified 2189
429 Ga0207702_10109159 3300026078 Bacteria 2456
430 Ga0207641_10000058 3300026088 Bacteria 166385
431 Ga0207641_10000345 3300026088 Bacteria 55589
432 Ga0207641_10012313 3300026088 Bacteria 7017
433 Ga0207641_10014255 3300026088 Bacteria 6514
434 Ga0207641_10036406 3300026088 Bacteria 4108
435 Ga0207641_10077862 3300026088 Unclassified 2870
436 Ga0207648_10002473 3300026089 Bacteria 19851
437 Ga0207648_10004802 3300026089 Bacteria 13797
438 Ga0207648_10018575 3300026089 Bacteria 6292
439 Ga0207648_10048456 3300026089 Bacteria 3719
440 Ga0207648_10112184 3300026089 Bacteria 2394
441 Ga0207648_10112809 3300026089 Bacteria 2387
442 Ga0207676_10003311 3300026095 Bacteria 11435
443 Ga0207676_10006391 3300026095 Bacteria 8324
444 Ga0207676_10010776 3300026095 Bacteria 6520
445 Ga0207676_10011595 3300026095 Bacteria 6303
446 Ga0207676_10028927 3300026095 Bacteria 4144
447 Ga0207676_10036053 3300026095 Bacteria 3760
448 Ga0207674_10005452 3300026116 Bacteria 15110
449 Ga0207674_10008699 3300026116 Bacteria 11687
450 Ga0207674_10012614 3300026116 Bacteria 9445
451 Ga0207674_10060388 3300026116 Bacteria 3834
452 Ga0207674_10110249 3300026116 Bacteria 2728
453 Ga0207675_100000654 3300026118 Bacteria 34117
454 Ga0207675_100008245 3300026118 Bacteria 9815
455 Ga0207675_100034833 3300026118 Bacteria 4695
456 Ga0207675_100095832 3300026118 Bacteria 2793
457 Ga0207683_10031493 3300026121 Bacteria 4603
458 Ga0207698_10007968 3300026142 Bacteria 6673
459 Ga0207698_10011810 3300026142 Bacteria 5683
460 Ga0207698_10045087 3300026142 Bacteria 3319
461 Ga0209974_10056407 3300027876 Bacteria 1326
462 Ga0268266_10023923 3300028379 Bacteria 5198
463 Ga0268265_10108306 3300028380 Bacteria 2262
464 Ga0268265_10114447 3300028380 Bacteria 2209
465 Ga0268264_10000726 3300028381 Bacteria 37807
466 Ga0268264_10001477 3300028381 Bacteria 21934
467 Ga0268264_10013813 3300028381 Bacteria 6642
468 Ga0268264_10034869 3300028381 Bacteria 4141
469 Ga0268264_10090055 3300028381 Bacteria 2643
470 Ga0268264_10174123 3300028381 Bacteria 1949
471 Ga0268264_10208557 3300028381 Bacteria 1792
472 Ga0307511_10000201 3300030521 Bacteria 60079
473 Ga0265327_10003381 3300031251 Bacteria 15346
474 Ga0307513_10103067 3300031456 Bacteria 2871
475 Ga0307513_10127709 3300031456 Bacteria 2494
476 Ga0307513_10322613 3300031456 Bacteria 1302
477 Ga0307509_10006019 3300031507 Bacteria 16547
478 Ga0265313_10038535 3300031595 Bacteria 2379
479 Ga0307518_10126541 3300031838 Bacteria 1802
480 Ga0307412_10246506 3300031911 Bacteria 1385
481 Ga0307411_10065335 3300032005 Bacteria 2440
482 Ga0373955_0033706 3300035172 Bacteria 2699
483 Ga0373947_0058653 3300035725 Bacteria 2333
484 Ga0373937_0068785 3300036401 Bacteria 3264
485 Ga0373925_0127703 3300037068 Unclassified 1980
486 Ga0395898_0324575 3300037466 Bacteria 1468
487 Ga0395901_0319478 3300038443 Bacteria 1607
488 Ga0439436_0001370 3300041404 Bacteria 7018
489 Ga0439457_001422 3300042014 Bacteria 7198
490 Ga0439457_011054 3300042014 Bacteria 2061
491 Ga0439462_0000821 3300042015 Bacteria 6481
492 Ga0450894_003919 3300042131 Bacteria 1945
493 Ga0439434_0045710 3300042435 Bacteria 1351
494 Ga0451577_0109640 3300042876 Bacteria 2469
495 Ga0466969_0000305 3300044656 Bacteria 27063
496 Ga0466972_0000021 3300044658 Bacteria 196266
497 Ga0466972_0000082 3300044658 Bacteria 88592
498 Ga0466970_0001020 3300044765 Bacteria 13511
499 Ga0466957_0001775 3300044842 Bacteria 11360
500 Ga0466957_0003562 3300044842 Bacteria 8578
501 Ga0466960_0038464 3300044901 Bacteria 2250
502 Ga0466959_0000030 3300045049 Bacteria 111343
503 Ga0466959_0120689 3300045049 Bacteria 1864
504 Ga0495650_0020127 3300046471 Bacteria 3262
505 Ga0495606_0003421 3300046507 Bacteria 16858
506 Ga0495628_0023355 3300046516 Bacteria 5077
507 Ga0495643_0094987 3300046522 Bacteria 1534
508 Ga0495586_0179023 3300046535 Bacteria 1199
509 Ga0495621_0013991 3300046539 Bacteria 2532
510 Ga0495645_0112732 3300046543 Bacteria 1923
511 Ga0495668_0000138 3300046616 Bacteria 109654
512 Ga0495625_0051485 3300046660 Bacteria 2952
513 Ga0495635_0069854 3300046663 Bacteria 2408
514 Ga0495674_0056647 3300047319 Bacteria 3432
515 Ga0495672_0009999 3300047320 Bacteria 6803
516 Ga0495672_0015776 3300047320 Bacteria 5117
517 Ga0495672_0020143 3300047320 Bacteria 4379
518 Ga0495676_0143435 3300047321 Bacteria 1709
519 Ga0495680_0071733 3300047322 Bacteria 2636
520 Ga0495684_0028946 3300047471 Bacteria 4251
521 Ga0495686_0000005 3300047472 Bacteria 827143
522 Ga0495686_0000542 3300047472 Bacteria 54039
523 Ga0495686_0002945 3300047472 Bacteria 15232
524 Ga0495686_0038459 3300047472 Unclassified 3060
525 Ga0496109_0036583 3300048912 Bacteria 4432
526 Ga0496115_0199450 3300048918 Bacteria 1653
527 Ga0501031_0002148 3300049568 Bacteria 12437
528 Ga0501034_0061110 3300049571 Bacteria 3784
529 Ga0501034_0186807 3300049571 Bacteria 2036
530 Ga0501034_0319574 3300049571 Bacteria 1485
531 Ga0501034_0328241 3300049571 Unclassified 1462
532 Ga0501036_0002123 3300049572 Bacteria 15472
533 Ga0501036_0089608 3300049572 Unclassified 2599
534 Ga0501037_0014511 3300049573 Bacteria 5795
535 Ga0501037_0149684 3300049573 Bacteria 1669
536 Ga0501038_0052625 3300049574 Bacteria 3509
537 Ga0501038_0096589 3300049574 Unclassified 2466
538 Ga0501043_0012496 3300049579 Bacteria 6644
539 Ga0501043_0090359 3300049579 Bacteria 2408
540 Ga0501043_0091945 3300049579 Unclassified 2385
541 Ga0501043_0300319 3300049579 Bacteria 1227
542 Ga0501046_0038503 3300049580 Bacteria 3837
543 Ga0501046_0159053 3300049580 Bacteria 1700
544 Ga0501047_0014624 3300049581 Bacteria 7468
545 Ga0501047_0019274 3300049581 Bacteria 6545
546 Ga0501047_0066710 3300049581 Bacteria 3469
547 Ga0501047_0163517 3300049581 Bacteria 2097
548 Ga0501048_0087842 3300049582 Unclassified 2193
549 Ga0501068_0095123 3300049584 Unclassified 1842
550 Ga0501069_0058826 3300049585 Bacteria 2144
551 Ga0501072_0054864 3300049588 Bacteria 3141
552 Ga0501072_0269529 3300049588 Unclassified 1355
553 Ga0501073_0015925 3300049589 Bacteria 5449
554 Ga0501073_0098562 3300049589 Unclassified 2029
555 Ga0501074_0023249 3300049590 Bacteria 4508
556 Ga0501202_018154 3300049652 Unclassified 1379
557 Ga0501207_005371 3300049654 Bacteria 1772
558 Ga0501217_012635 3300049661 Unclassified 1884
559 Ga0501225_0004896 3300049705 Bacteria 3959
560 Ga0501225_0005429 3300049705 Bacteria 3745
561 Ga0501079_0117900 3300049741 Bacteria 2064
562 Ga0501083_0045247 3300049744 Unclassified 2978
563 Ga0501268_016128 3300049765 Bacteria 1234
564 Ga0501269_000723 3300049766 Bacteria 5413
565 Ga0501035_0104156 3300049822 Unclassified 2488
566 Ga0501035_0151259 3300049822 Bacteria 2014
567 Ga0501044_0025802 3300049823 Bacteria 6230
568 Ga0501044_0049426 3300049823 Bacteria 4342
569 Ga0501044_0054121 3300049823 Bacteria 4127
570 Ga0501044_0062075 3300049823 Bacteria 3821
571 Ga0501044_0169391 3300049823 Bacteria 2156
572 Ga0501284_00017 3300050005 Bacteria 96362
573 nmdc:mga0k408_119517_c1 3300050493 Bacteria 1560
574 nmdc:mga0k408_121199_c1 3300050493 Unclassified 1549
575 nmdc:mga05p37_587277_c1 3300050507 Unclassified 1260
576 nmdc:mga09592_130990_c1 3300050508 Unclassified 2157
577 nmdc:mga09592_36345_c1 3300050508 Bacteria 4125
578 nmdc:mga09592_40984_c1 3300050508 Unclassified 3892
579 nmdc:mga06r32_43140_c1 3300050510 Bacteria 4291
580 nmdc:mga08y16_16036_c1 3300050511 Bacteria 7876
581 nmdc:mga08y16_91606_c1 3300050511 Bacteria 3168
582 nmdc:mga0n895_22446_c1 3300050512 Bacteria 5917
583 Ga0500578_0000063 3300053086 Bacteria 117869
584 Ga0500583_0000076 3300053092 Bacteria 59162
585 Ga0500583_0004906 3300053092 Bacteria 4423
586 Ga0500583_0014860 3300053092 Bacteria 3063
587 Ga0500641_0005430 3300053096 Bacteria 4518
588 Ga0500554_060007 3300053102 Bacteria 1218
589 Ga0500658_0001708 3300053134 Bacteria 8688
590 Ga0500568_0006829 3300053139 Bacteria 5684
591 Ga0500588_0013219 3300053146 Bacteria 2067
592 Ga0500616_0002086 3300053153 Bacteria 17471
593 Ga0500616_0018217 3300053153 Unclassified 3973
594 Ga0500616_0019248 3300053153 Bacteria 3849
595 Ga0500622_0019706 3300053156 Bacteria 3581
596 Ga0500633_0000808 3300053160 Bacteria 5360
597 Ga0500611_000016 3300053727 Bacteria 118185
598 Ga0501082_0090286 3300060353 Bacteria 2645

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10115690 rootH2_101156905 344
2 3300049654 Ga0501207_005371 Ga0501207_005371_44_1099 351
3 3300005290 Ga0065712_10107718 Ga0065712_101077181 358
4 3300005331 Ga0070670_100053970 Ga0070670_1000539702 358
5 3300005339 Ga0070660_100259647 Ga0070660_1002596471 358
6 3300005466 Ga0070685_10121272 Ga0070685_101212722 358
7 3300005616 Ga0068852_100218054 Ga0068852_1002180542 358
8 3300005834 Ga0068851_10048221 Ga0068851_100482211 358
9 3300009545 Ga0105237_10096207 Ga0105237_100962073 358
10 3300025914 Ga0207671_10134858 Ga0207671_101348582 358
11 3300025925 Ga0207650_10008101 Ga0207650_100081018 358
12 3300025945 Ga0207679_10039082 Ga0207679_100390821 358
13 3300025960 Ga0207651_10185472 Ga0207651_101854722 358
14 3300026023 Ga0207677_10173663 Ga0207677_101736631 358
15 3300027876 Ga0209974_10056407 Ga0209974_100564071 358
16 3300031595 Ga0265313_10038535 Ga0265313_100385352 358
17 3300049579 Ga0501043_0090359 Ga0501043_0090359_93_1220 358
18 3300013296 Ga0157374_10163362 Ga0157374_101633623 359
19 3300025246 Ga0209646_1001982 Ga0209646_10019824 360
20 3300031456 Ga0307513_10103067 Ga0307513_101030672 360
21 3300044842 Ga0466957_0003562 Ga0466957_0003562_3537_4625 360
22 3300049581 Ga0501047_0014624 Ga0501047_0014624_1738_2826 360
23 3300049823 Ga0501044_0025802 Ga0501044_0025802_2969_4057 360
24 3300053102 Ga0500554_060007 Ga0500554_060007_83_1171 360
25 3300003322 rootL2_10096474 rootL2_100964742 361
26 3300003323 rootH1_10007189 rootH1_1000718924 361
27 3300005563 Ga0068855_100002787 Ga0068855_10000278722 361
28 3300006195 Ga0075366_10121840 Ga0075366_101218402 361
29 3300010375 Ga0105239_10013556 Ga0105239_100135561 361
30 3300025949 Ga0207667_10009381 Ga0207667_100093811 361
31 3300031456 Ga0307513_10322613 Ga0307513_103226131 361
32 3300031507 Ga0307509_10006019 Ga0307509_100060192 361
33 3300049705 Ga0501225_0004896 Ga0501225_0004896_2742_3833 361
34 3300050493 nmdc:mga0k408_119517_c1 nmdc:mga0k408_119517_c1_32_1120 361
35 3300053092 Ga0500583_0000076 Ga0500583_0000076_50236_51324 361
36 3300053092 Ga0500583_0014860 Ga0500583_0014860_924_2012 361
37 3300005331 Ga0070670_100206252 Ga0070670_1002062521 362
38 3300005338 Ga0068868_100080390 Ga0068868_1000803902 362
39 3300005353 Ga0070669_100060136 Ga0070669_1000601361 362
40 3300005356 Ga0070674_100041129 Ga0070674_1000411293 362
41 3300005367 Ga0070667_100131801 Ga0070667_1001318011 362
42 3300005459 Ga0068867_100274761 Ga0068867_1002747612 362
43 3300005577 Ga0068857_100059529 Ga0068857_1000595292 362
44 3300005617 Ga0068859_100094016 Ga0068859_1000940165 362
45 3300005718 Ga0068866_10006389 Ga0068866_100063893 362
46 3300005840 Ga0068870_10005637 Ga0068870_100056372 362
47 3300005843 Ga0068860_100148607 Ga0068860_1001486071 362
48 3300005844 Ga0068862_100087521 Ga0068862_1000875213 362
49 3300006881 Ga0068865_100047257 Ga0068865_1000472573 362
50 3300006931 Ga0097620_100094016 Ga0097620_1000940165 362
51 3300009176 Ga0105242_10063078 Ga0105242_100630783 362
52 3300011119 Ga0105246_10015478 Ga0105246_100154785 362
53 3300013296 Ga0157374_10155804 Ga0157374_101558043 362
54 3300013297 Ga0157378_10121851 Ga0157378_101218511 362
55 3300025901 Ga0207688_10011957 Ga0207688_100119573 362
56 3300025907 Ga0207645_10043300 Ga0207645_100433004 362
57 3300025908 Ga0207643_10013845 Ga0207643_100138452 362
58 3300025923 Ga0207681_10057308 Ga0207681_100573083 362
59 3300026023 Ga0207677_10017478 Ga0207677_100174785 362
60 3300026116 Ga0207674_10060388 Ga0207674_100603884 362
61 3300026118 Ga0207675_100008245 Ga0207675_10000824510 362
62 3300028381 Ga0268264_10090055 Ga0268264_100900552 362
63 3300049579 Ga0501043_0300319 Ga0501043_0300319_83_1177 364
64 3300031911 Ga0307412_10246506 Ga0307412_102465061 366
65 3300032005 Ga0307411_10065335 Ga0307411_100653352 366
66 3300047320 Ga0495672_0015776 Ga0495672_0015776_3136_4272 367
67 3300009553 Ga0105249_10038455 Ga0105249_100384553 369
68 3300025961 Ga0207712_10074620 Ga0207712_100746202 369
69 iso_pu_bacteria 2881955468 2881958299 371
70 3300010375 Ga0105239_10004591 Ga0105239_100045916 373
71 iso_pu_bacteria 2738541278 2738725643 374
72 iso_pu_bacteria 2818991442 2819574985 374
73 3300003322 rootL2_10305125 rootL2_103051253 375
74 3300003323 rootH1_10035284 rootH1_1003528420 375
75 3300003323 rootH1_10087635 rootH1_100876354 375
76 3300005354 Ga0070675_100110467 Ga0070675_1001104672 375
77 3300005614 Ga0068856_100450810 Ga0068856_1004508101 375
78 3300005616 Ga0068852_100310938 Ga0068852_1003109382 375
79 3300013102 Ga0157371_10119656 Ga0157371_101196561 375
80 3300037466 Ga0395898_0324575 Ga0395898_0324575_256_1383 375
81 3300038443 Ga0395901_0319478 Ga0395901_0319478_77_1204 375
82 3300045049 Ga0466959_0120689 Ga0466959_0120689_306_1433 375
83 3300046616 Ga0495668_0000138 Ga0495668_0000138_58228_59361 375
84 3300047472 Ga0495686_0000542 Ga0495686_0000542_13100_14233 375
85 3300049765 Ga0501268_016128 Ga0501268_016128_31_1158 375
86 3300049766 Ga0501269_000723 Ga0501269_000723_786_1919 375
87 3300053153 Ga0500616_0002086 Ga0500616_0002086_11377_12510 375
88 3300003203 JGI25406J46586_10010213 JGI25406J46586_100102132 376
89 3300005290 Ga0065712_10101391 Ga0065712_101013911 376
90 3300005333 Ga0070677_10031246 Ga0070677_100312462 376
91 3300005354 Ga0070675_100035837 Ga0070675_1000358372 376
92 3300005985 Ga0081539_10000524 Ga0081539_1000052454 376
93 3300013102 Ga0157371_10163444 Ga0157371_101634441 376
94 3300014326 Ga0157380_10015019 Ga0157380_100150195 376
95 3300025893 Ga0207682_10041656 Ga0207682_100416562 376
96 3300025926 Ga0207659_10047490 Ga0207659_100474905 376
97 3300042014 Ga0439457_011054 Ga0439457_011054_841_1971 376
98 3300049661 Ga0501217_012635 Ga0501217_012635_20_1150 376
99 3300005327 Ga0070658_10008688 Ga0070658_100086885 377
100 3300005328 Ga0070676_10006102 Ga0070676_100061025 377
101 3300005335 Ga0070666_10005771 Ga0070666_100057716 377
102 3300005337 Ga0070682_100177623 Ga0070682_1001776231 377
103 3300005338 Ga0068868_100003978 Ga0068868_1000039786 377
104 3300005344 Ga0070661_100098889 Ga0070661_1000988891 377
105 3300005347 Ga0070668_100083519 Ga0070668_1000835192 377
106 3300005347 Ga0070668_100278131 Ga0070668_1002781312 377
107 3300005354 Ga0070675_100050307 Ga0070675_1000503072 377
108 3300005364 Ga0070673_100003313 Ga0070673_1000033135 377
109 3300005364 Ga0070673_100080282 Ga0070673_1000802822 377
110 3300005367 Ga0070667_100049482 Ga0070667_1000494822 377
111 3300005367 Ga0070667_100087236 Ga0070667_1000872362 377
112 3300005459 Ga0068867_100014436 Ga0068867_1000144362 377
113 3300005459 Ga0068867_100018934 Ga0068867_1000189343 377
114 3300005543 Ga0070672_100014495 Ga0070672_1000144955 377
115 3300005548 Ga0070665_100032974 Ga0070665_1000329745 377
116 3300005616 Ga0068852_100024905 Ga0068852_1000249055 377
117 3300005618 Ga0068864_100060749 Ga0068864_1000607492 377
118 3300005718 Ga0068866_10015504 Ga0068866_100155042 377
119 3300005719 Ga0068861_100025908 Ga0068861_1000259083 377
120 3300005834 Ga0068851_10097447 Ga0068851_100974472 377
121 3300005841 Ga0068863_100001827 Ga0068863_1000018276 377
122 3300005841 Ga0068863_100026858 Ga0068863_1000268584 377
123 3300005842 Ga0068858_100005962 Ga0068858_1000059625 377
124 3300005843 Ga0068860_100001937 Ga0068860_1000019379 377
125 3300005843 Ga0068860_100009424 Ga0068860_1000094246 377
126 3300005843 Ga0068860_100222009 Ga0068860_1002220091 377
127 3300005985 Ga0081539_10024411 Ga0081539_100244113 377
128 3300006237 Ga0097621_100006400 Ga0097621_1000064002 377
129 3300006237 Ga0097621_100090247 Ga0097621_1000902472 377
130 3300006237 Ga0097621_100169656 Ga0097621_1001696561 377
131 3300006358 Ga0068871_100004492 Ga0068871_1000044922 377
132 3300009093 Ga0105240_10092853 Ga0105240_100928533 377
133 3300009094 Ga0111539_10049141 Ga0111539_100491412 377
134 3300009148 Ga0105243_10144257 Ga0105243_101442572 377
135 3300009176 Ga0105242_10037443 Ga0105242_100374432 377
136 3300010375 Ga0105239_10250619 Ga0105239_102506192 377
137 3300011119 Ga0105246_10024009 Ga0105246_100240092 377
138 3300013296 Ga0157374_10013640 Ga0157374_100136405 377
139 3300013296 Ga0157374_10238111 Ga0157374_102381111 377
140 3300013297 Ga0157378_10006318 Ga0157378_100063186 377
141 3300013306 Ga0163162_10000131 Ga0163162_1000013166 377
142 3300013306 Ga0163162_10010071 Ga0163162_100100716 377
143 3300013306 Ga0163162_10328213 Ga0163162_103282131 377
144 3300013308 Ga0157375_10042985 Ga0157375_100429852 377
145 3300013308 Ga0157375_10091908 Ga0157375_100919083 377
146 3300014325 Ga0163163_10009405 Ga0163163_100094056 377
147 3300014326 Ga0157380_10118022 Ga0157380_101180222 377
148 3300014968 Ga0157379_10003004 Ga0157379_100030043 377
149 3300014969 Ga0157376_10020219 Ga0157376_100202195 377
150 3300014969 Ga0157376_10062072 Ga0157376_100620722 377
151 3300014969 Ga0157376_10401953 Ga0157376_104019531 377
152 3300025315 Ga0207697_10012253 Ga0207697_100122532 377
153 3300025321 Ga0207656_10050111 Ga0207656_100501112 377
154 3300025899 Ga0207642_10027615 Ga0207642_100276152 377
155 3300025903 Ga0207680_10022126 Ga0207680_100221263 377
156 3300025907 Ga0207645_10003345 Ga0207645_100033452 377
157 3300025909 Ga0207705_10104108 Ga0207705_101041082 377
158 3300025913 Ga0207695_10065684 Ga0207695_100656842 377
159 3300025926 Ga0207659_10051737 Ga0207659_100517372 377
160 3300025938 Ga0207704_10025768 Ga0207704_100257681 377
161 3300025938 Ga0207704_10046840 Ga0207704_100468402 377
162 3300025940 Ga0207691_10001320 Ga0207691_1000132011 377
163 3300025940 Ga0207691_10092187 Ga0207691_100921872 377
164 3300025960 Ga0207651_10006759 Ga0207651_100067592 377
165 3300025960 Ga0207651_10137454 Ga0207651_101374542 377
166 3300025972 Ga0207668_10039134 Ga0207668_100391342 377
167 3300025986 Ga0207658_10051266 Ga0207658_100512662 377
168 3300026023 Ga0207677_10007353 Ga0207677_100073535 377
169 3300026035 Ga0207703_10037381 Ga0207703_100373812 377
170 3300026088 Ga0207641_10014255 Ga0207641_100142553 377
171 3300026088 Ga0207641_10036406 Ga0207641_100364062 377
172 3300026089 Ga0207648_10002473 Ga0207648_100024733 377
173 3300026089 Ga0207648_10004802 Ga0207648_100048027 377
174 3300026089 Ga0207648_10048456 Ga0207648_100484561 377
175 3300026095 Ga0207676_10028927 Ga0207676_100289274 377
176 3300026118 Ga0207675_100034833 Ga0207675_1000348333 377
177 3300026142 Ga0207698_10011810 Ga0207698_100118105 377
178 3300028379 Ga0268266_10023923 Ga0268266_100239232 377
179 3300028381 Ga0268264_10001477 Ga0268264_100014778 377
180 3300028381 Ga0268264_10013813 Ga0268264_100138133 377
181 3300028381 Ga0268264_10174123 Ga0268264_101741232 377
182 3300044658 Ga0466972_0000082 Ga0466972_0000082_42827_43966 377
183 3300047320 Ga0495672_0020143 Ga0495672_0020143_1018_2154 377
184 3300048912 Ga0496109_0036583 Ga0496109_0036583_399_1532 377
185 3300049571 Ga0501034_0186807 Ga0501034_0186807_739_1872 377
186 3300049571 Ga0501034_0328241 Ga0501034_0328241_256_1392 377
187 3300049572 Ga0501036_0089608 Ga0501036_0089608_556_1689 377
188 3300049573 Ga0501037_0149684 Ga0501037_0149684_144_1277 377
189 3300049581 Ga0501047_0066710 Ga0501047_0066710_1732_2865 377
190 3300049588 Ga0501072_0054864 Ga0501072_0054864_181_1335 377
191 3300049652 Ga0501202_018154 Ga0501202_018154_104_1237 377
192 3300049705 Ga0501225_0005429 Ga0501225_0005429_1369_2502 377
193 3300049822 Ga0501035_0151259 Ga0501035_0151259_696_1829 377
194 3300049823 Ga0501044_0062075 Ga0501044_0062075_1967_3100 377
195 3300050507 nmdc:mga05p37_587277_c1 nmdc:mga05p37_587277_c1_39_1175 377
196 3300050508 nmdc:mga09592_40984_c1 nmdc:mga09592_40984_c1_444_1580 377
197 3300050510 nmdc:mga06r32_43140_c1 nmdc:mga06r32_43140_c1_2440_3576 377
198 3300050511 nmdc:mga08y16_91606_c1 nmdc:mga08y16_91606_c1_679_1815 377
199 3300053086 Ga0500578_0000063 Ga0500578_0000063_97403_98542 377
200 3300053096 Ga0500641_0005430 Ga0500641_0005430_2084_3220 377
201 3300053139 Ga0500568_0006829 Ga0500568_0006829_1682_2818 377
202 3300002459 JGI24751J29686_10004971 JGI24751J29686_100049713 378
203 3300003316 rootH1_10101916 rootH1_101019162 378
204 3300003322 rootL2_10077433 rootL2_100774331 378
205 3300003322 rootL2_10277670 rootL2_102776702 378
206 3300005290 Ga0065712_10000434 Ga0065712_100004344 378
207 3300005290 Ga0065712_10002062 Ga0065712_100020622 378
208 3300005293 Ga0065715_10002214 Ga0065715_100022142 378
209 3300005293 Ga0065715_10209021 Ga0065715_102090211 378
210 3300005295 Ga0065707_10089933 Ga0065707_100899332 378
211 3300005328 Ga0070676_10001941 Ga0070676_1000194112 378
212 3300005328 Ga0070676_10020891 Ga0070676_100208912 378
213 3300005329 Ga0070683_100003487 Ga0070683_1000034877 378
214 3300005329 Ga0070683_100110751 Ga0070683_1001107512 378
215 3300005330 Ga0070690_100009903 Ga0070690_1000099033 378
216 3300005331 Ga0070670_100023966 Ga0070670_1000239661 378
217 3300005331 Ga0070670_100029246 Ga0070670_1000292461 378
218 3300005331 Ga0070670_100049547 Ga0070670_1000495472 378
219 3300005331 Ga0070670_100231078 Ga0070670_1002310781 378
220 3300005331 Ga0070670_100298612 Ga0070670_1002986121 378
221 3300005334 Ga0068869_100001625 Ga0068869_1000016257 378
222 3300005334 Ga0068869_100007430 Ga0068869_1000074306 378
223 3300005334 Ga0068869_100008048 Ga0068869_1000080482 378
224 3300005334 Ga0068869_100015864 Ga0068869_1000158644 378
225 3300005334 Ga0068869_100086155 Ga0068869_1000861552 378
226 3300005334 Ga0068869_100168340 Ga0068869_1001683401 378
227 3300005335 Ga0070666_10117435 Ga0070666_101174352 378
228 3300005336 Ga0070680_100012142 Ga0070680_1000121426 378
229 3300005336 Ga0070680_100152052 Ga0070680_1001520522 378
230 3300005338 Ga0068868_100003840 Ga0068868_10000384012 378
231 3300005338 Ga0068868_100127492 Ga0068868_1001274921 378
232 3300005338 Ga0068868_100230554 Ga0068868_1002305542 378
233 3300005340 Ga0070689_100010915 Ga0070689_1000109154 378
234 3300005340 Ga0070689_100122192 Ga0070689_1001221921 378
235 3300005340 Ga0070689_100128807 Ga0070689_1001288071 378
236 3300005341 Ga0070691_10005362 Ga0070691_100053624 378
237 3300005344 Ga0070661_100012988 Ga0070661_1000129886 378
238 3300005344 Ga0070661_100014515 Ga0070661_1000145154 378
239 3300005344 Ga0070661_100068703 Ga0070661_1000687032 378
240 3300005347 Ga0070668_100009954 Ga0070668_1000099542 378
241 3300005353 Ga0070669_100001433 Ga0070669_1000014337 378
242 3300005353 Ga0070669_100054679 Ga0070669_1000546793 378
243 3300005353 Ga0070669_100092891 Ga0070669_1000928911 378
244 3300005354 Ga0070675_100012708 Ga0070675_1000127084 378
245 3300005355 Ga0070671_100020125 Ga0070671_1000201254 378
246 3300005355 Ga0070671_100057848 Ga0070671_1000578482 378
247 3300005356 Ga0070674_100004213 Ga0070674_1000042132 378
248 3300005356 Ga0070674_100043851 Ga0070674_1000438512 378
249 3300005356 Ga0070674_100262208 Ga0070674_1002622081 378
250 3300005364 Ga0070673_100001998 Ga0070673_1000019984 378
251 3300005364 Ga0070673_100017110 Ga0070673_1000171105 378
252 3300005364 Ga0070673_100148135 Ga0070673_1001481351 378
253 3300005365 Ga0070688_100004162 Ga0070688_1000041624 378
254 3300005365 Ga0070688_100007875 Ga0070688_1000078752 378
255 3300005365 Ga0070688_100071829 Ga0070688_1000718292 378
256 3300005365 Ga0070688_100128453 Ga0070688_1001284532 378
257 3300005365 Ga0070688_100137251 Ga0070688_1001372511 378
258 3300005366 Ga0070659_100005954 Ga0070659_1000059543 378
259 3300005367 Ga0070667_100013188 Ga0070667_1000131885 378
260 3300005367 Ga0070667_100023752 Ga0070667_1000237523 378
261 3300005367 Ga0070667_100036043 Ga0070667_1000360433 378
262 3300005367 Ga0070667_100064406 Ga0070667_1000644062 378
263 3300005367 Ga0070667_100128969 Ga0070667_1001289692 378
264 3300005367 Ga0070667_100144510 Ga0070667_1001445101 378
265 3300005438 Ga0070701_10014567 Ga0070701_100145672 378
266 3300005456 Ga0070678_100129205 Ga0070678_1001292052 378
267 3300005456 Ga0070678_100131792 Ga0070678_1001317923 378
268 3300005459 Ga0068867_100021622 Ga0068867_1000216223 378
269 3300005466 Ga0070685_10001538 Ga0070685_100015384 378
270 3300005466 Ga0070685_10038662 Ga0070685_100386622 378
271 3300005471 Ga0070698_100001254 Ga0070698_1000012543 378
272 3300005471 Ga0070698_100060091 Ga0070698_1000600912 378
273 3300005535 Ga0070684_100002978 Ga0070684_10000297810 378
274 3300005535 Ga0070684_100023965 Ga0070684_1000239652 378
275 3300005539 Ga0068853_100001650 Ga0068853_1000016504 378
276 3300005539 Ga0068853_100032217 Ga0068853_1000322173 378
277 3300005539 Ga0068853_100173025 Ga0068853_1001730252 378
278 3300005543 Ga0070672_100041604 Ga0070672_1000416042 378
279 3300005543 Ga0070672_100090896 Ga0070672_1000908962 378
280 3300005543 Ga0070672_100124493 Ga0070672_1001244933 378
281 3300005544 Ga0070686_100021403 Ga0070686_1000214032 378
282 3300005544 Ga0070686_100021460 Ga0070686_1000214604 378
283 3300005544 Ga0070686_100033898 Ga0070686_1000338982 378
284 3300005547 Ga0070693_100205962 Ga0070693_1002059621 378
285 3300005548 Ga0070665_100077899 Ga0070665_1000778993 378
286 3300005563 Ga0068855_100086514 Ga0068855_1000865141 378
287 3300005564 Ga0070664_100024111 Ga0070664_1000241113 378
288 3300005564 Ga0070664_100036554 Ga0070664_1000365542 378
289 3300005564 Ga0070664_100133242 Ga0070664_1001332422 378
290 3300005577 Ga0068857_100002193 Ga0068857_10000219310 378
291 3300005577 Ga0068857_100116199 Ga0068857_1001161992 378
292 3300005578 Ga0068854_100081230 Ga0068854_1000812302 378
293 3300005614 Ga0068856_100055301 Ga0068856_1000553014 378
294 3300005615 Ga0070702_100011994 Ga0070702_1000119944 378
295 3300005615 Ga0070702_100179336 Ga0070702_1001793362 378
296 3300005616 Ga0068852_100016882 Ga0068852_1000168824 378
297 3300005616 Ga0068852_100021477 Ga0068852_1000214773 378
298 3300005616 Ga0068852_100107838 Ga0068852_1001078382 378
299 3300005616 Ga0068852_100123759 Ga0068852_1001237592 378
300 3300005617 Ga0068859_100000006 Ga0068859_10000000647 378
301 3300005617 Ga0068859_100004048 Ga0068859_1000040485 378
302 3300005617 Ga0068859_100032162 Ga0068859_1000321626 378
303 3300005617 Ga0068859_100047939 Ga0068859_1000479393 378
304 3300005617 Ga0068859_100154063 Ga0068859_1001540632 378
305 3300005617 Ga0068859_100210746 Ga0068859_1002107462 378
306 3300005618 Ga0068864_100017629 Ga0068864_1000176293 378
307 3300005618 Ga0068864_100054938 Ga0068864_1000549382 378
308 3300005618 Ga0068864_100070541 Ga0068864_1000705412 378
309 3300005618 Ga0068864_100075470 Ga0068864_1000754703 378
310 3300005618 Ga0068864_100218739 Ga0068864_1002187392 378
311 3300005718 Ga0068866_10106990 Ga0068866_101069901 378
312 3300005719 Ga0068861_100015974 Ga0068861_1000159743 378
313 3300005719 Ga0068861_100084769 Ga0068861_1000847692 378
314 3300005834 Ga0068851_10043079 Ga0068851_100430792 378
315 3300005841 Ga0068863_100005104 Ga0068863_1000051049 378
316 3300005841 Ga0068863_100006901 Ga0068863_1000069018 378
317 3300005841 Ga0068863_100016212 Ga0068863_1000162124 378
318 3300005841 Ga0068863_100054119 Ga0068863_1000541193 378
319 3300005841 Ga0068863_100115510 Ga0068863_1001155102 378
320 3300005842 Ga0068858_100000978 Ga0068858_1000009787 378
321 3300005842 Ga0068858_100018759 Ga0068858_1000187592 378
322 3300005842 Ga0068858_100104633 Ga0068858_1001046332 378
323 3300005842 Ga0068858_100152130 Ga0068858_1001521301 378
324 3300005843 Ga0068860_100001713 Ga0068860_10000171310 378
325 3300005843 Ga0068860_100050621 Ga0068860_1000506212 378
326 3300005843 Ga0068860_100068298 Ga0068860_1000682982 378
327 3300005843 Ga0068860_100119490 Ga0068860_1001194901 378
328 3300005844 Ga0068862_100007369 Ga0068862_1000073692 378
329 3300005844 Ga0068862_100133346 Ga0068862_1001333462 378
330 3300005844 Ga0068862_100174190 Ga0068862_1001741901 378
331 3300006195 Ga0075366_10045471 Ga0075366_100454712 378
332 3300006237 Ga0097621_100023550 Ga0097621_1000235504 378
333 3300006358 Ga0068871_100119991 Ga0068871_1001199912 378
334 3300006358 Ga0068871_100126635 Ga0068871_1001266352 378
335 3300006844 Ga0075428_100018105 Ga0075428_1000181051 378
336 3300006846 Ga0075430_100015148 Ga0075430_1000151483 378
337 3300006846 Ga0075430_100052787 Ga0075430_1000527871 378
338 3300006847 Ga0075431_100207726 Ga0075431_1002077263 378
339 3300006871 Ga0075434_100091222 Ga0075434_1000912222 378
340 3300006880 Ga0075429_100041932 Ga0075429_1000419322 378
341 3300006880 Ga0075429_100100922 Ga0075429_1001009223 378
342 3300006880 Ga0075429_100115602 Ga0075429_1001156023 378
343 3300006931 Ga0097620_100000006 Ga0097620_10000000647 378
344 3300006931 Ga0097620_100004048 Ga0097620_1000040488 378
345 3300006931 Ga0097620_100032162 Ga0097620_1000321626 378
346 3300006931 Ga0097620_100047939 Ga0097620_1000479393 378
347 3300006931 Ga0097620_100154050 Ga0097620_1001540502 378
348 3300006931 Ga0097620_100210736 Ga0097620_1002107362 378
349 3300009093 Ga0105240_10074304 Ga0105240_100743044 378
350 3300009094 Ga0111539_10005159 Ga0111539_100051591 378
351 3300009094 Ga0111539_10135256 Ga0111539_101352562 378
352 3300009098 Ga0105245_10045110 Ga0105245_100451103 378
353 3300009101 Ga0105247_10000312 Ga0105247_1000031219 378
354 3300009101 Ga0105247_10018426 Ga0105247_100184262 378
355 3300009101 Ga0105247_10108745 Ga0105247_101087452 378
356 3300009147 Ga0114129_10010099 Ga0114129_1001009912 378
357 3300009147 Ga0114129_10091782 Ga0114129_100917823 378
358 3300009148 Ga0105243_10188156 Ga0105243_101881562 378
359 3300009148 Ga0105243_10211744 Ga0105243_102117442 378
360 3300009174 Ga0105241_10003261 Ga0105241_100032616 378
361 3300009174 Ga0105241_10108956 Ga0105241_101089562 378
362 3300009174 Ga0105241_10118500 Ga0105241_101185002 378
363 3300009174 Ga0105241_10125883 Ga0105241_101258831 378
364 3300009174 Ga0105241_10192014 Ga0105241_101920142 378
365 3300009176 Ga0105242_10002533 Ga0105242_1000253310 378
366 3300009176 Ga0105242_10030627 Ga0105242_100306273 378
367 3300009176 Ga0105242_10269422 Ga0105242_102694222 378
368 3300009545 Ga0105237_10009282 Ga0105237_100092825 378
369 3300009545 Ga0105237_10009309 Ga0105237_100093092 378
370 3300009553 Ga0105249_10002054 Ga0105249_1000205419 378
371 3300009553 Ga0105249_10005038 Ga0105249_100050389 378
372 3300009553 Ga0105249_10010745 Ga0105249_100107454 378
373 3300009553 Ga0105249_10019466 Ga0105249_100194662 378
374 3300009553 Ga0105249_10023676 Ga0105249_100236763 378
375 3300009553 Ga0105249_10031101 Ga0105249_100311014 378
376 3300010375 Ga0105239_10027328 Ga0105239_100273286 378
377 3300010375 Ga0105239_10085379 Ga0105239_100853792 378
378 3300011119 Ga0105246_10084483 Ga0105246_100844832 378
379 3300013104 Ga0157370_10017464 Ga0157370_100174644 378
380 3300013104 Ga0157370_10088674 Ga0157370_100886743 378
381 3300013296 Ga0157374_10003783 Ga0157374_100037833 378
382 3300013296 Ga0157374_10010915 Ga0157374_100109156 378
383 3300013296 Ga0157374_10054655 Ga0157374_100546552 378
384 3300013296 Ga0157374_10221565 Ga0157374_102215652 378
385 3300013296 Ga0157374_10280465 Ga0157374_102804652 378
386 3300013297 Ga0157378_10002733 Ga0157378_100027335 378
387 3300013297 Ga0157378_10005036 Ga0157378_100050366 378
388 3300013297 Ga0157378_10084137 Ga0157378_100841373 378
389 3300013297 Ga0157378_10114140 Ga0157378_101141402 378
390 3300013306 Ga0163162_10000112 Ga0163162_1000011259 378
391 3300013306 Ga0163162_10004410 Ga0163162_1000441010 378
392 3300013306 Ga0163162_10028572 Ga0163162_100285725 378
393 3300013306 Ga0163162_10323274 Ga0163162_103232741 378
394 3300013307 Ga0157372_10306417 Ga0157372_103064171 378
395 3300013307 Ga0157372_10416385 Ga0157372_104163851 378
396 3300013307 Ga0157372_10584835 Ga0157372_105848351 378
397 3300013308 Ga0157375_10022049 Ga0157375_100220493 378
398 3300013308 Ga0157375_10022627 Ga0157375_100226273 378
399 3300013308 Ga0157375_10035324 Ga0157375_100353242 378
400 3300013308 Ga0157375_10054488 Ga0157375_100544882 378
401 3300013308 Ga0157375_10082417 Ga0157375_100824172 378
402 3300013308 Ga0157375_10110988 Ga0157375_101109882 378
403 3300014325 Ga0163163_10000591 Ga0163163_1000059116 378
404 3300014325 Ga0163163_10034704 Ga0163163_100347043 378
405 3300014325 Ga0163163_10066537 Ga0163163_100665372 378
406 3300014325 Ga0163163_10082757 Ga0163163_100827572 378
407 3300014325 Ga0163163_10124034 Ga0163163_101240342 378
408 3300014325 Ga0163163_10416645 Ga0163163_104166452 378
409 3300014326 Ga0157380_10001068 Ga0157380_100010683 378
410 3300014326 Ga0157380_10001169 Ga0157380_100011691 378
411 3300014326 Ga0157380_10010298 Ga0157380_100102984 378
412 3300014745 Ga0157377_10008303 Ga0157377_100083033 378
413 3300014745 Ga0157377_10013064 Ga0157377_100130644 378
414 3300014745 Ga0157377_10018573 Ga0157377_100185731 378
415 3300014745 Ga0157377_10031212 Ga0157377_100312122 378
416 3300014968 Ga0157379_10018533 Ga0157379_100185333 378
417 3300014968 Ga0157379_10035414 Ga0157379_100354143 378
418 3300014968 Ga0157379_10090101 Ga0157379_100901012 378
419 3300014969 Ga0157376_10010354 Ga0157376_100103544 378
420 3300014969 Ga0157376_10105580 Ga0157376_101055802 378
421 3300017792 Ga0163161_10004241 Ga0163161_1000424111 378
422 3300017792 Ga0163161_10058603 Ga0163161_100586032 378
423 3300025900 Ga0207710_10000279 Ga0207710_100002799 378
424 3300025903 Ga0207680_10000137 Ga0207680_1000013722 378
425 3300025907 Ga0207645_10001948 Ga0207645_100019484 378
426 3300025908 Ga0207643_10028936 Ga0207643_100289362 378
427 3300025911 Ga0207654_10007840 Ga0207654_100078404 378
428 3300025912 Ga0207707_10006847 Ga0207707_100068472 378
429 3300025913 Ga0207695_10004034 Ga0207695_1000403413 378
430 3300025914 Ga0207671_10000453 Ga0207671_1000045319 378
431 3300025914 Ga0207671_10006236 Ga0207671_100062362 378
432 3300025914 Ga0207671_10018798 Ga0207671_100187982 378
433 3300025918 Ga0207662_10038647 Ga0207662_100386472 378
434 3300025920 Ga0207649_10008437 Ga0207649_100084375 378
435 3300025920 Ga0207649_10008998 Ga0207649_100089983 378
436 3300025921 Ga0207652_10004343 Ga0207652_100043432 378
437 3300025923 Ga0207681_10058375 Ga0207681_100583751 378
438 3300025923 Ga0207681_10125639 Ga0207681_101256391 378
439 3300025925 Ga0207650_10079084 Ga0207650_100790842 378
440 3300025925 Ga0207650_10191081 Ga0207650_101910811 378
441 3300025926 Ga0207659_10007864 Ga0207659_100078645 378
442 3300025931 Ga0207644_10073269 Ga0207644_100732692 378
443 3300025931 Ga0207644_10078668 Ga0207644_100786682 378
444 3300025932 Ga0207690_10026828 Ga0207690_100268283 378
445 3300025933 Ga0207706_10005211 Ga0207706_100052113 378
446 3300025933 Ga0207706_10014054 Ga0207706_100140544 378
447 3300025933 Ga0207706_10082129 Ga0207706_100821293 378
448 3300025934 Ga0207686_10000464 Ga0207686_1000046411 378
449 3300025934 Ga0207686_10194764 Ga0207686_101947642 378
450 3300025936 Ga0207670_10016024 Ga0207670_100160242 378
451 3300025936 Ga0207670_10016473 Ga0207670_100164734 378
452 3300025936 Ga0207670_10082442 Ga0207670_100824422 378
453 3300025937 Ga0207669_10006414 Ga0207669_100064142 378
454 3300025938 Ga0207704_10077336 Ga0207704_100773362 378
455 3300025940 Ga0207691_10004686 Ga0207691_1000468612 378
456 3300025940 Ga0207691_10045795 Ga0207691_100457952 378
457 3300025940 Ga0207691_10071665 Ga0207691_100716653 378
458 3300025940 Ga0207691_10094622 Ga0207691_100946222 378
459 3300025940 Ga0207691_10195119 Ga0207691_101951192 378
460 3300025942 Ga0207689_10001798 Ga0207689_1000179815 378
461 3300025942 Ga0207689_10002434 Ga0207689_1000243410 378
462 3300025942 Ga0207689_10002915 Ga0207689_1000291512 378
463 3300025942 Ga0207689_10009375 Ga0207689_100093754 378
464 3300025942 Ga0207689_10024634 Ga0207689_100246342 378
465 3300025942 Ga0207689_10028720 Ga0207689_100287202 378
466 3300025942 Ga0207689_10090483 Ga0207689_100904832 378
467 3300025944 Ga0207661_10092106 Ga0207661_100921062 378
468 3300025944 Ga0207661_10277826 Ga0207661_102778261 378
469 3300025945 Ga0207679_10005681 Ga0207679_100056815 378
470 3300025945 Ga0207679_10014791 Ga0207679_100147915 378
471 3300025945 Ga0207679_10243433 Ga0207679_102434332 378
472 3300025945 Ga0207679_10283069 Ga0207679_102830692 378
473 3300025945 Ga0207679_10401226 Ga0207679_104012261 378
474 3300025960 Ga0207651_10020541 Ga0207651_100205412 378
475 3300025960 Ga0207651_10026913 Ga0207651_100269132 378
476 3300025960 Ga0207651_10075460 Ga0207651_100754601 378
477 3300025960 Ga0207651_10184037 Ga0207651_101840372 378
478 3300025961 Ga0207712_10000590 Ga0207712_1000059016 378
479 3300025961 Ga0207712_10001092 Ga0207712_1000109211 378
480 3300025961 Ga0207712_10032445 Ga0207712_100324453 378
481 3300025961 Ga0207712_10133079 Ga0207712_101330792 378
482 3300025961 Ga0207712_10202688 Ga0207712_102026882 378
483 3300025961 Ga0207712_10247960 Ga0207712_102479601 378
484 3300025981 Ga0207640_10080847 Ga0207640_100808472 378
485 3300025986 Ga0207658_10011788 Ga0207658_100117885 378
486 3300025986 Ga0207658_10200741 Ga0207658_102007411 378
487 3300026023 Ga0207677_10209533 Ga0207677_102095332 378
488 3300026023 Ga0207677_10252239 Ga0207677_102522391 378
489 3300026035 Ga0207703_10079871 Ga0207703_100798712 378
490 3300026035 Ga0207703_10136275 Ga0207703_101362752 378
491 3300026035 Ga0207703_10176717 Ga0207703_101767172 378
492 3300026041 Ga0207639_10004327 Ga0207639_100043276 378
493 3300026041 Ga0207639_10009858 Ga0207639_100098587 378
494 3300026041 Ga0207639_10116282 Ga0207639_101162822 378
495 3300026078 Ga0207702_10109159 Ga0207702_101091592 378
496 3300026088 Ga0207641_10000058 Ga0207641_1000005827 378
497 3300026088 Ga0207641_10000345 Ga0207641_100003452 378
498 3300026088 Ga0207641_10012313 Ga0207641_100123134 378
499 3300026088 Ga0207641_10077862 Ga0207641_100778622 378
500 3300026089 Ga0207648_10018575 Ga0207648_100185759 378
501 3300026089 Ga0207648_10112184 Ga0207648_101121841 378
502 3300026089 Ga0207648_10112809 Ga0207648_101128092 378
503 3300026095 Ga0207676_10003311 Ga0207676_100033113 378
504 3300026095 Ga0207676_10006391 Ga0207676_100063914 378
505 3300026095 Ga0207676_10010776 Ga0207676_100107762 378
506 3300026095 Ga0207676_10011595 Ga0207676_100115952 378
507 3300026095 Ga0207676_10036053 Ga0207676_100360531 378
508 3300026116 Ga0207674_10005452 Ga0207674_100054524 378
509 3300026116 Ga0207674_10008699 Ga0207674_1000869915 378
510 3300026116 Ga0207674_10012614 Ga0207674_100126148 378
511 3300026116 Ga0207674_10110249 Ga0207674_101102493 378
512 3300026118 Ga0207675_100000654 Ga0207675_1000006544 378
513 3300026118 Ga0207675_100095832 Ga0207675_1000958322 378
514 3300026121 Ga0207683_10031493 Ga0207683_100314932 378
515 3300026142 Ga0207698_10007968 Ga0207698_100079687 378
516 3300026142 Ga0207698_10045087 Ga0207698_100450872 378
517 3300028380 Ga0268265_10108306 Ga0268265_101083062 378
518 3300028380 Ga0268265_10114447 Ga0268265_101144471 378
519 3300028381 Ga0268264_10000726 Ga0268264_1000072612 378
520 3300028381 Ga0268264_10034869 Ga0268264_100348692 378
521 3300028381 Ga0268264_10208557 Ga0268264_102085571 378
522 3300030521 Ga0307511_10000201 Ga0307511_1000020136 378
523 3300031251 Ga0265327_10003381 Ga0265327_100033817 378
524 3300031456 Ga0307513_10127709 Ga0307513_101277092 378
525 3300031838 Ga0307518_10126541 Ga0307518_101265412 378
526 3300035172 Ga0373955_0033706 Ga0373955_0033706_529_1683 378
527 3300035725 Ga0373947_0058653 Ga0373947_0058653_470_1624 378
528 3300036401 Ga0373937_0068785 Ga0373937_0068785_1369_2523 378
529 3300037068 Ga0373925_0127703 Ga0373925_0127703_414_1568 378
530 3300041404 Ga0439436_0001370 Ga0439436_0001370_1504_2643 378
531 3300042014 Ga0439457_001422 Ga0439457_001422_3274_4413 378
532 3300042015 Ga0439462_0000821 Ga0439462_0000821_545_1684 378
533 3300042131 Ga0450894_003919 Ga0450894_003919_469_1674 378
534 3300042435 Ga0439434_0045710 Ga0439434_0045710_113_1249 378
535 3300042876 Ga0451577_0109640 Ga0451577_0109640_889_2025 378
536 3300044656 Ga0466969_0000305 Ga0466969_0000305_12750_13889 378
537 3300044658 Ga0466972_0000021 Ga0466972_0000021_141408_142694 378
538 3300044765 Ga0466970_0001020 Ga0466970_0001020_4850_6136 378
539 3300044842 Ga0466957_0001775 Ga0466957_0001775_3082_4221 378
540 3300044901 Ga0466960_0038464 Ga0466960_0038464_439_1575 378
541 3300045049 Ga0466959_0000030 Ga0466959_0000030_10584_11723 378
542 3300046471 Ga0495650_0020127 Ga0495650_0020127_1543_2685 378
543 3300046507 Ga0495606_0003421 Ga0495606_0003421_8271_9407 378
544 3300046516 Ga0495628_0023355 Ga0495628_0023355_2113_3267 378
545 3300046522 Ga0495643_0094987 Ga0495643_0094987_388_1524 378
546 3300046535 Ga0495586_0179023 Ga0495586_0179023_20_1174 378
547 3300046539 Ga0495621_0013991 Ga0495621_0013991_201_1343 378
548 3300046543 Ga0495645_0112732 Ga0495645_0112732_666_1820 378
549 3300046660 Ga0495625_0051485 Ga0495625_0051485_736_1875 378
550 3300046663 Ga0495635_0069854 Ga0495635_0069854_54_1208 378
551 3300047319 Ga0495674_0056647 Ga0495674_0056647_949_2103 378
552 3300047320 Ga0495672_0009999 Ga0495672_0009999_4841_5977 378
553 3300047321 Ga0495676_0143435 Ga0495676_0143435_352_1506 378
554 3300047322 Ga0495680_0071733 Ga0495680_0071733_207_1361 378
555 3300047471 Ga0495684_0028946 Ga0495684_0028946_1673_2827 378
556 3300047472 Ga0495686_0000005 Ga0495686_0000005_510146_511282 378
557 3300047472 Ga0495686_0002945 Ga0495686_0002945_7247_8383 378
558 3300047472 Ga0495686_0038459 Ga0495686_0038459_1871_3007 378
559 3300048918 Ga0496115_0199450 Ga0496115_0199450_209_1345 378
560 3300049568 Ga0501031_0002148 Ga0501031_0002148_6868_8004 378
561 3300049571 Ga0501034_0061110 Ga0501034_0061110_955_2091 378
562 3300049571 Ga0501034_0319574 Ga0501034_0319574_40_1176 378
563 3300049572 Ga0501036_0002123 Ga0501036_0002123_2195_3331 378
564 3300049573 Ga0501037_0014511 Ga0501037_0014511_496_1632 378
565 3300049574 Ga0501038_0052625 Ga0501038_0052625_2043_3179 378
566 3300049574 Ga0501038_0096589 Ga0501038_0096589_238_1374 378
567 3300049579 Ga0501043_0012496 Ga0501043_0012496_3257_4393 378
568 3300049579 Ga0501043_0091945 Ga0501043_0091945_1167_2303 378
569 3300049580 Ga0501046_0038503 Ga0501046_0038503_799_1935 378
570 3300049580 Ga0501046_0159053 Ga0501046_0159053_121_1257 378
571 3300049581 Ga0501047_0019274 Ga0501047_0019274_2428_3564 378
572 3300049581 Ga0501047_0163517 Ga0501047_0163517_332_1468 378
573 3300049582 Ga0501048_0087842 Ga0501048_0087842_1016_2182 378
574 3300049584 Ga0501068_0095123 Ga0501068_0095123_498_1634 378
575 3300049585 Ga0501069_0058826 Ga0501069_0058826_254_1390 378
576 3300049588 Ga0501072_0269529 Ga0501072_0269529_202_1338 378
577 3300049589 Ga0501073_0015925 Ga0501073_0015925_528_1664 378
578 3300049589 Ga0501073_0098562 Ga0501073_0098562_83_1219 378
579 3300049590 Ga0501074_0023249 Ga0501074_0023249_616_1752 378
580 3300049741 Ga0501079_0117900 Ga0501079_0117900_207_1343 378
581 3300049744 Ga0501083_0045247 Ga0501083_0045247_1058_2194 378
582 3300049822 Ga0501035_0104156 Ga0501035_0104156_1120_2256 378
583 3300049823 Ga0501044_0049426 Ga0501044_0049426_1470_2606 378
584 3300049823 Ga0501044_0054121 Ga0501044_0054121_809_1945 378
585 3300049823 Ga0501044_0169391 Ga0501044_0169391_642_1778 378
586 3300050005 Ga0501284_00017 Ga0501284_00017_62283_63419 378
587 3300050493 nmdc:mga0k408_121199_c1 nmdc:mga0k408_121199_c1_234_1373 378
588 3300050508 nmdc:mga09592_130990_c1 nmdc:mga09592_130990_c1_652_1788 378
589 3300050508 nmdc:mga09592_36345_c1 nmdc:mga09592_36345_c1_2626_3768 378
590 3300050511 nmdc:mga08y16_16036_c1 nmdc:mga08y16_16036_c1_6648_7784 378
591 3300050512 nmdc:mga0n895_22446_c1 nmdc:mga0n895_22446_c1_2444_3598 378
592 3300053092 Ga0500583_0004906 Ga0500583_0004906_561_1700 378
593 3300053134 Ga0500658_0001708 Ga0500658_0001708_4234_5373 378
594 3300053146 Ga0500588_0013219 Ga0500588_0013219_261_1400 378
595 3300053153 Ga0500616_0018217 Ga0500616_0018217_1083_2222 378
596 3300053153 Ga0500616_0019248 Ga0500616_0019248_352_1491 378
597 3300053156 Ga0500622_0019706 Ga0500622_0019706_2213_3352 378
598 3300053160 Ga0500633_0000808 Ga0500633_0000808_3430_4569 378
599 3300053727 Ga0500611_000016 Ga0500611_000016_116613_117749 378
600 3300060353 Ga0501082_0090286 Ga0501082_0090286_868_2004 378

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00491

Arginase

Arginase family

97

352

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m1r-assembly2.cif.gz_A the crystal structure of formimidoylglutamase from bacillus subtilis subsp. subtilis str. 168 0.8626 23 306
3m1r-assembly1.cif.gz_D the crystal structure of formimidoylglutamase from bacillus subtilis subsp. subtilis str. 168 0.8568 23 305
4myn-assembly1.cif.gz_A crystal structure of trypanosoma cruzi formiminoglutamase n114h variant with mn2+2 0.8558 45 305
4myk-assembly1.cif.gz_A crystal structure of trypanosoma cruzi formiminoglutamase (oxidized) with mn2+2 at ph 8.5 0.8554 45 305
4mxr-assembly1.cif.gz_A crystal structure of trypanosoma cruzi formiminoglutamase with mn2+2 0.8532 45 305
ID Description Score Start End Superfamily
3m1rA01 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8495 47 304 3.40.800.10
af_A0A1D6NUT9_1_148_2.80.10.50 Mainly Beta;Trefoil;Trefoil (Acidic Fibroblast Growth Factor, subunit A); 0.837 319 343 2.80.10.50
af_Q4DW57_236_365_2.30.29.170 Mainly Beta;Roll;PH-domain like; 0.8107 314 345 2.30.29.170
af_Q2FVT2_2_311_3.40.800.10 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8095 12 300 3.40.800.10
1gq7A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Ureohydrolase domain 0.8071 26 307 3.40.800.10
ID Description Score Start End GO Terms
AF-A0A4Q5Y355-F1-model_v4 Arginase 0.9872 4 313 GO:0008783
GO:0033389
GO:0046872
AF-A0A4Q6A534-F1-model_v4 Arginase 0.9843 5 280 GO:0008783
GO:0033389
GO:0046872
AF-A0A4Q5Y355-F1-model_v4 Arginase 0.9778 4 313 GO:0008783
GO:0033389
GO:0046872
AF-A0A258YJ83-F1-model_v4 Arginase 0.9746 1 378 GO:0008783
GO:0033389
GO:0046872
AF-A0A4Q6A534-F1-model_v4 Arginase 0.9738 5 280 GO:0008783
GO:0033389
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.42 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map