F467796
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 598 | 409 | 1196 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300027471|Ga0209995_1011499|Ga0209995_10114991 |
| Length | 292 |
| Sequence | MMFRQLRFEHSCKSACNQFGKVAVAKDLCSYSMPVRNLQSSGPCDTHIVAVIEFRKVNKWFGPLQVLKDIDLTVDAGNVVVVCGPSGSGKSTLIRCINRLETIQSGDIIVDGRSVCDARLDAASLRANVGMVFQSFNLYPHMTVLDNITLAPLKVKRLSSAEAQKIATGLLDRVGIPDKANAYPANLSGGQQQRVAIARALAMKPKIMLFDEPTSALDPEMINEVLEVMTDLARDGMTMVVVTHEMGFARRVADRVVFMDQGQIIEANKPENFFAAPESPRAQQFLSKILSH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 59 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 74 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 75 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 167 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 188 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 189 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 195 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 200 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 201 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 202 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 203 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 204 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 205 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 206 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 209 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 265 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 267 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 268 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 269 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 270 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 271 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 272 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 273 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 274 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 275 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 276 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 277 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 278 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 303 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 311 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 312 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 314 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 315 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 324 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 325 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 326 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 327 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 328 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 331 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 332 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 333 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 334 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 335 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 336 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 337 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 338 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 339 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 340 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 341 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 342 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 343 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 344 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 345 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 346 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 347 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 348 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 349 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 350 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 351 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 352 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 353 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 354 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 355 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 356 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 357 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 358 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 359 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 360 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 361 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 362 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 363 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 364 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 365 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 366 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 367 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 368 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 369 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 370 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 371 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 372 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 373 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 374 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 375 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 376 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 377 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 378 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 379 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 380 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 381 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 382 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 383 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 384 | 2941479691 | |||
| 385 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 386 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 387 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 388 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 389 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 390 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 391 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 392 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 393 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 394 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 395 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 396 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 397 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 398 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 399 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 400 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 401 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 402 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 403 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 404 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 405 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 406 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 407 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 408 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 409 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.79 |
| Metatranscriptomes | 0 |
| Isolates | 14.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.35 |
| Nodule | 2.01 |
| Rhizoplane | 4.01 |
| Rhizosphere | 74.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0209995_1011499 | 3300027471 | Bacteria | 1439 |
| 2 | JGI25155J39150_1000229 | 3300002704 | Bacteria | 22119 |
| 3 | JGI25156J39149_1003302 | 3300002705 | Bacteria | 5339 |
| 4 | JGI25154J39366_1000511 | 3300002738 | Bacteria | 19768 |
| 5 | JGI25157J39369_1004131 | 3300002741 | Bacteria | 2717 |
| 6 | JGI25151J46595_10000095 | 3300003187 | Bacteria | 118630 |
| 7 | JGI25151J46595_10000318 | 3300003187 | Bacteria | 52064 |
| 8 | Ga0055538_1000024 | 3300003751 | Bacteria | 241526 |
| 9 | Ga0055526_1000249 | 3300003771 | Bacteria | 45798 |
| 10 | Ga0055524_1000043 | 3300003775 | Bacteria | 152518 |
| 11 | Ga0065714_10067678 | 3300005288 | Bacteria | 5290 |
| 12 | Ga0065704_10013198 | 3300005289 | Bacteria | 2076 |
| 13 | Ga0065715_10000426 | 3300005293 | Bacteria | 19372 |
| 14 | Ga0065715_10009394 | 3300005293 | Bacteria | 5401 |
| 15 | Ga0065707_10098051 | 3300005295 | Bacteria | 3117 |
| 16 | Ga0070690_100001728 | 3300005330 | Bacteria | 11534 |
| 17 | Ga0070670_100000241 | 3300005331 | Bacteria | 49604 |
| 18 | Ga0068869_100065337 | 3300005334 | Bacteria | 2678 |
| 19 | Ga0070666_10006590 | 3300005335 | Bacteria | 7137 |
| 20 | Ga0070666_10023588 | 3300005335 | Bacteria | 4005 |
| 21 | Ga0070666_10330185 | 3300005335 | Bacteria | 1089 |
| 22 | Ga0070680_100055288 | 3300005336 | Bacteria | 3243 |
| 23 | Ga0070682_100027582 | 3300005337 | Bacteria | 3409 |
| 24 | Ga0068868_100032140 | 3300005338 | Bacteria | 4036 |
| 25 | Ga0070691_10003903 | 3300005341 | Bacteria | 6747 |
| 26 | Ga0070687_100140713 | 3300005343 | Bacteria | 1405 |
| 27 | Ga0070661_100064324 | 3300005344 | Bacteria | 2695 |
| 28 | Ga0070661_100108327 | 3300005344 | Bacteria | 2073 |
| 29 | Ga0070661_100298825 | 3300005344 | Bacteria | 1253 |
| 30 | Ga0070668_100280882 | 3300005347 | Bacteria | 1390 |
| 31 | Ga0070669_100062838 | 3300005353 | Bacteria | 2731 |
| 32 | Ga0070675_100015962 | 3300005354 | Bacteria | 5950 |
| 33 | Ga0070671_100003162 | 3300005355 | Bacteria | 12839 |
| 34 | Ga0070671_100123386 | 3300005355 | Bacteria | 2180 |
| 35 | Ga0070671_100606094 | 3300005355 | Bacteria | 946 |
| 36 | Ga0070673_100009896 | 3300005364 | Bacteria | 6424 |
| 37 | Ga0070673_100016661 | 3300005364 | Bacteria | 5204 |
| 38 | Ga0070673_100169713 | 3300005364 | Bacteria | 1861 |
| 39 | Ga0070673_100602672 | 3300005364 | Bacteria | 1002 |
| 40 | Ga0070667_100009817 | 3300005367 | Bacteria | 7934 |
| 41 | Ga0070667_100038018 | 3300005367 | Bacteria | 4036 |
| 42 | Ga0070667_100386595 | 3300005367 | Bacteria | 1272 |
| 43 | Ga0070714_100068229 | 3300005435 | Bacteria | 3068 |
| 44 | Ga0070713_100118514 | 3300005436 | Bacteria | 2318 |
| 45 | Ga0070700_100093866 | 3300005441 | Bacteria | 1964 |
| 46 | Ga0070663_100019625 | 3300005455 | Bacteria | 4461 |
| 47 | Ga0070663_100050570 | 3300005455 | Bacteria | 2957 |
| 48 | Ga0070678_100094092 | 3300005456 | Bacteria | 2306 |
| 49 | Ga0070681_10007675 | 3300005458 | Bacteria | 10552 |
| 50 | Ga0070681_10019365 | 3300005458 | Bacteria | 6811 |
| 51 | Ga0068867_100226451 | 3300005459 | Bacteria | 1509 |
| 52 | Ga0068867_100249872 | 3300005459 | Bacteria | 1442 |
| 53 | Ga0070706_100126446 | 3300005467 | Bacteria | 2384 |
| 54 | Ga0070707_100011228 | 3300005468 | Bacteria | 8347 |
| 55 | Ga0070707_100025476 | 3300005468 | Bacteria | 5611 |
| 56 | Ga0070679_100050772 | 3300005530 | Bacteria | 4131 |
| 57 | Ga0070679_100088679 | 3300005530 | Bacteria | 3080 |
| 58 | Ga0070679_100419173 | 3300005530 | Bacteria | 1284 |
| 59 | Ga0070697_100031141 | 3300005536 | Bacteria | 4289 |
| 60 | Ga0070672_100043746 | 3300005543 | Bacteria | 3456 |
| 61 | Ga0070672_100055242 | 3300005543 | Bacteria | 3110 |
| 62 | Ga0070672_100073479 | 3300005543 | Bacteria | 2725 |
| 63 | Ga0070686_100069349 | 3300005544 | Bacteria | 2303 |
| 64 | Ga0070686_100317162 | 3300005544 | Bacteria | 1161 |
| 65 | Ga0070695_100017441 | 3300005545 | Bacteria | 4353 |
| 66 | Ga0070696_100031376 | 3300005546 | Bacteria | 3641 |
| 67 | Ga0070665_100003905 | 3300005548 | Bacteria | 15758 |
| 68 | Ga0068855_100000235 | 3300005563 | Bacteria | 70600 |
| 69 | Ga0068855_100005884 | 3300005563 | Bacteria | 14957 |
| 70 | Ga0068855_100045149 | 3300005563 | Bacteria | 5211 |
| 71 | Ga0068855_100336100 | 3300005563 | Bacteria | 1666 |
| 72 | Ga0070664_100001253 | 3300005564 | Bacteria | 20319 |
| 73 | Ga0070664_100037578 | 3300005564 | Bacteria | 4071 |
| 74 | Ga0068857_100321719 | 3300005577 | Bacteria | 1429 |
| 75 | Ga0068854_100033253 | 3300005578 | Bacteria | 3595 |
| 76 | Ga0068854_100049200 | 3300005578 | Bacteria | 3010 |
| 77 | Ga0068856_100007513 | 3300005614 | Bacteria | 10641 |
| 78 | Ga0070702_100168334 | 3300005615 | Bacteria | 1423 |
| 79 | Ga0068866_10158450 | 3300005718 | Bacteria | 1318 |
| 80 | Ga0068866_10307548 | 3300005718 | Bacteria | 992 |
| 81 | Ga0068851_10116864 | 3300005834 | Bacteria | 1430 |
| 82 | Ga0068863_100662197 | 3300005841 | Bacteria | 1036 |
| 83 | Ga0068858_100052331 | 3300005842 | Bacteria | 3778 |
| 84 | Ga0068860_100078904 | 3300005843 | Bacteria | 3131 |
| 85 | Ga0075365_10313104 | 3300006038 | Bacteria | 1105 |
| 86 | Ga0075368_10018116 | 3300006042 | Bacteria | 2643 |
| 87 | Ga0075363_100133742 | 3300006048 | Bacteria | 1392 |
| 88 | Ga0075364_10041702 | 3300006051 | Bacteria | 2981 |
| 89 | Ga0075432_10003120 | 3300006058 | Bacteria | 5599 |
| 90 | Ga0070716_100154194 | 3300006173 | Bacteria | 1481 |
| 91 | Ga0075369_10035098 | 3300006186 | Bacteria | 2130 |
| 92 | Ga0075366_10002900 | 3300006195 | Bacteria | 8906 |
| 93 | Ga0075366_10026350 | 3300006195 | Bacteria | 3404 |
| 94 | Ga0097621_100257266 | 3300006237 | Bacteria | 1531 |
| 95 | Ga0075370_10039197 | 3300006353 | Bacteria | 2668 |
| 96 | Ga0075428_100434147 | 3300006844 | Bacteria | 1407 |
| 97 | Ga0075431_100026024 | 3300006847 | Bacteria | 5998 |
| 98 | Ga0075431_100195359 | 3300006847 | Bacteria | 2072 |
| 99 | Ga0075431_100282471 | 3300006847 | Bacteria | 1680 |
| 100 | Ga0075433_10084026 | 3300006852 | Bacteria | 2810 |
| 101 | Ga0075433_10132243 | 3300006852 | Bacteria | 2217 |
| 102 | Ga0075433_10187925 | 3300006852 | Bacteria | 1838 |
| 103 | Ga0075434_100000912 | 3300006871 | Bacteria | 23726 |
| 104 | Ga0075434_100003395 | 3300006871 | Bacteria | 14264 |
| 105 | Ga0075434_100053087 | 3300006871 | Bacteria | 4028 |
| 106 | Ga0075434_100113809 | 3300006871 | Bacteria | 2718 |
| 107 | Ga0068865_100072944 | 3300006881 | Bacteria | 2440 |
| 108 | Ga0075436_100005072 | 3300006914 | Bacteria | 9064 |
| 109 | Ga0075436_100137224 | 3300006914 | Bacteria | 1718 |
| 110 | Ga0099826_10000111 | 3300006948 | Bacteria | 38073 |
| 111 | Ga0099794_10218042 | 3300007265 | Bacteria | 979 |
| 112 | Ga0105251_10001709 | 3300009011 | Bacteria | 18381 |
| 113 | Ga0105244_10085698 | 3300009036 | Bacteria | 1554 |
| 114 | Ga0105250_10059492 | 3300009092 | Bacteria | 1534 |
| 115 | Ga0105250_10079229 | 3300009092 | Bacteria | 1331 |
| 116 | Ga0111539_10254829 | 3300009094 | Bacteria | 2043 |
| 117 | Ga0111539_10601240 | 3300009094 | Bacteria | 1281 |
| 118 | Ga0105245_10028254 | 3300009098 | Bacteria | 4945 |
| 119 | Ga0105245_10256027 | 3300009098 | Bacteria | 1702 |
| 120 | Ga0114129_10046851 | 3300009147 | Bacteria | 6076 |
| 121 | Ga0114129_10117245 | 3300009147 | Bacteria | 3669 |
| 122 | Ga0105243_10025532 | 3300009148 | Bacteria | 4516 |
| 123 | Ga0105241_10009789 | 3300009174 | Bacteria | 7044 |
| 124 | Ga0105242_10038460 | 3300009176 | Bacteria | 3847 |
| 125 | Ga0105242_10252814 | 3300009176 | Bacteria | 1589 |
| 126 | Ga0105248_10001597 | 3300009177 | Bacteria | 25193 |
| 127 | Ga0105248_10029885 | 3300009177 | Bacteria | 6081 |
| 128 | Ga0105248_10201612 | 3300009177 | Bacteria | 2242 |
| 129 | Ga0105248_10581094 | 3300009177 | Bacteria | 1264 |
| 130 | Ga0105237_10039387 | 3300009545 | Bacteria | 4771 |
| 131 | Ga0105237_10111120 | 3300009545 | Bacteria | 2732 |
| 132 | Ga0105237_10593508 | 3300009545 | Bacteria | 1114 |
| 133 | Ga0105238_10000113 | 3300009551 | Bacteria | 89675 |
| 134 | Ga0105238_10058573 | 3300009551 | Bacteria | 3860 |
| 135 | Ga0105238_10105126 | 3300009551 | Bacteria | 2805 |
| 136 | Ga0105238_10299803 | 3300009551 | Bacteria | 1591 |
| 137 | Ga0105249_10073334 | 3300009553 | Bacteria | 3167 |
| 138 | Ga0105249_10447338 | 3300009553 | Bacteria | 1330 |
| 139 | Ga0105239_10001563 | 3300010375 | Bacteria | 30254 |
| 140 | Ga0105239_10017697 | 3300010375 | Bacteria | 7885 |
| 141 | Ga0105239_10262397 | 3300010375 | Bacteria | 1941 |
| 142 | Ga0105246_10010742 | 3300011119 | Bacteria | 5674 |
| 143 | Ga0105246_10018015 | 3300011119 | Bacteria | 4498 |
| 144 | Ga0105246_10152400 | 3300011119 | Bacteria | 1751 |
| 145 | Ga0157319_1001881 | 3300012497 | Bacteria | 1141 |
| 146 | Ga0157373_10092948 | 3300013100 | Bacteria | 2124 |
| 147 | Ga0157373_10161683 | 3300013100 | Bacteria | 1576 |
| 148 | Ga0157371_10166634 | 3300013102 | Bacteria | 1573 |
| 149 | Ga0157370_10284202 | 3300013104 | Bacteria | 1528 |
| 150 | Ga0171462_1012 | 3300013250 | Bacteria | 208216 |
| 151 | Ga0157378_10187876 | 3300013297 | Bacteria | 1947 |
| 152 | Ga0163162_10001128 | 3300013306 | Bacteria | 24861 |
| 153 | Ga0163162_10017943 | 3300013306 | Bacteria | 6925 |
| 154 | Ga0163162_10115131 | 3300013306 | Bacteria | 2789 |
| 155 | Ga0163162_10233793 | 3300013306 | Bacteria | 1969 |
| 156 | Ga0157372_10032766 | 3300013307 | Bacteria | 5701 |
| 157 | Ga0157372_10047601 | 3300013307 | Bacteria | 4765 |
| 158 | Ga0157375_10001058 | 3300013308 | Bacteria | 23752 |
| 159 | Ga0157375_10107199 | 3300013308 | Bacteria | 2887 |
| 160 | Ga0157375_10219956 | 3300013308 | Bacteria | 2057 |
| 161 | Ga0157380_10005138 | 3300014326 | Bacteria | 9145 |
| 162 | Ga0157376_10010980 | 3300014969 | Bacteria | 6654 |
| 163 | Ga0182006_1000245 | 3300015261 | Bacteria | 50641 |
| 164 | Ga0182007_10001008 | 3300015262 | Bacteria | 15430 |
| 165 | Ga0209435_100124 | 3300025206 | Bacteria | 27904 |
| 166 | Ga0209646_1000238 | 3300025246 | Bacteria | 57384 |
| 167 | Ga0209026_1003975 | 3300025250 | Bacteria | 4614 |
| 168 | Ga0209759_1000921 | 3300025256 | Bacteria | 21615 |
| 169 | Ga0209130_1001190 | 3300025284 | Bacteria | 18542 |
| 170 | Ga0209676_1008189 | 3300025292 | Bacteria | 4717 |
| 171 | Ga0209025_1000429 | 3300025294 | Bacteria | 83306 |
| 172 | Ga0209564_1000041 | 3300025295 | Bacteria | 405199 |
| 173 | Ga0209564_1008314 | 3300025295 | Bacteria | 5142 |
| 174 | Ga0209758_1002010 | 3300025297 | Bacteria | 21870 |
| 175 | Ga0209050_1001827 | 3300025298 | Bacteria | 20722 |
| 176 | Ga0209050_1016676 | 3300025298 | Bacteria | 2987 |
| 177 | Ga0209256_1000014 | 3300025299 | Bacteria | 687409 |
| 178 | Ga0207426_1000085 | 3300025302 | Bacteria | 293171 |
| 179 | Ga0209051_1009097 | 3300025303 | Bacteria | 5160 |
| 180 | Ga0207697_10008134 | 3300025315 | Bacteria | 4618 |
| 181 | Ga0207697_10022284 | 3300025315 | Bacteria | 2594 |
| 182 | Ga0207656_10086379 | 3300025321 | Bacteria | 1417 |
| 183 | Ga0207656_10135133 | 3300025321 | Bacteria | 1158 |
| 184 | Ga0207696_1099331 | 3300025711 | Bacteria | 793 |
| 185 | Ga0207713_1003781 | 3300025735 | Bacteria | 10149 |
| 186 | Ga0207642_10250366 | 3300025899 | Bacteria | 1005 |
| 187 | Ga0207688_10004542 | 3300025901 | Bacteria | 7557 |
| 188 | Ga0207688_10014828 | 3300025901 | Bacteria | 4229 |
| 189 | Ga0207680_10003765 | 3300025903 | Bacteria | 7140 |
| 190 | Ga0207680_10207096 | 3300025903 | Bacteria | 1339 |
| 191 | Ga0207647_10045724 | 3300025904 | Bacteria | 2730 |
| 192 | Ga0207647_10232048 | 3300025904 | Bacteria | 1062 |
| 193 | Ga0207645_10020234 | 3300025907 | Bacteria | 4359 |
| 194 | Ga0207707_10032009 | 3300025912 | Bacteria | 4604 |
| 195 | Ga0207695_10002110 | 3300025913 | Bacteria | 30178 |
| 196 | Ga0207671_10001053 | 3300025914 | Bacteria | 33415 |
| 197 | Ga0207671_10124001 | 3300025914 | Bacteria | 1977 |
| 198 | Ga0207693_10154107 | 3300025915 | Bacteria | 1808 |
| 199 | Ga0207660_10025398 | 3300025917 | Bacteria | 4020 |
| 200 | Ga0207657_10002201 | 3300025919 | Bacteria | 21128 |
| 201 | Ga0207649_10186349 | 3300025920 | Bacteria | 1456 |
| 202 | Ga0207649_10297588 | 3300025920 | Bacteria | 1179 |
| 203 | Ga0207652_10052510 | 3300025921 | Bacteria | 3499 |
| 204 | Ga0207652_10362267 | 3300025921 | Bacteria | 1309 |
| 205 | Ga0207646_10065881 | 3300025922 | Bacteria | 3233 |
| 206 | Ga0207681_10022576 | 3300025923 | Bacteria | 4015 |
| 207 | Ga0207681_10485962 | 3300025923 | Bacteria | 1009 |
| 208 | Ga0207694_10000075 | 3300025924 | Bacteria | 114693 |
| 209 | Ga0207694_10100159 | 3300025924 | Bacteria | 2295 |
| 210 | Ga0207694_10402529 | 3300025924 | Bacteria | 1138 |
| 211 | Ga0207650_10001805 | 3300025925 | Bacteria | 15135 |
| 212 | Ga0207659_10208975 | 3300025926 | Bacteria | 1563 |
| 213 | Ga0207687_10393465 | 3300025927 | Bacteria | 1138 |
| 214 | Ga0207664_10104432 | 3300025929 | Bacteria | 2346 |
| 215 | Ga0207690_10012404 | 3300025932 | Bacteria | 5096 |
| 216 | Ga0207706_10002107 | 3300025933 | Bacteria | 19464 |
| 217 | Ga0207686_10175927 | 3300025934 | Bacteria | 1513 |
| 218 | Ga0207669_10184266 | 3300025937 | Bacteria | 1500 |
| 219 | Ga0207665_10124210 | 3300025939 | Bacteria | 1826 |
| 220 | Ga0207691_10008329 | 3300025940 | Bacteria | 9957 |
| 221 | Ga0207691_10061325 | 3300025940 | Bacteria | 3417 |
| 222 | Ga0207711_10005820 | 3300025941 | Bacteria | 10412 |
| 223 | Ga0207711_10015929 | 3300025941 | Bacteria | 6235 |
| 224 | Ga0207689_10056084 | 3300025942 | Bacteria | 3242 |
| 225 | Ga0207679_10016389 | 3300025945 | Bacteria | 4921 |
| 226 | Ga0207667_10000110 | 3300025949 | Bacteria | 131872 |
| 227 | Ga0207667_10006885 | 3300025949 | Bacteria | 13735 |
| 228 | Ga0207667_10018717 | 3300025949 | Bacteria | 7758 |
| 229 | Ga0207667_10480648 | 3300025949 | Bacteria | 1261 |
| 230 | Ga0207651_10134326 | 3300025960 | Bacteria | 1900 |
| 231 | Ga0207712_10358754 | 3300025961 | Bacteria | 1214 |
| 232 | Ga0207640_10009174 | 3300025981 | Bacteria | 5526 |
| 233 | Ga0207658_10244664 | 3300025986 | Bacteria | 1521 |
| 234 | Ga0207658_10323656 | 3300025986 | Bacteria | 1335 |
| 235 | Ga0207677_10414542 | 3300026023 | Bacteria | 1145 |
| 236 | Ga0207703_10274227 | 3300026035 | Bacteria | 1529 |
| 237 | Ga0207703_10544347 | 3300026035 | Bacteria | 1094 |
| 238 | Ga0207678_10006728 | 3300026067 | Bacteria | 10191 |
| 239 | Ga0207678_10103002 | 3300026067 | Bacteria | 2437 |
| 240 | Ga0207678_10107857 | 3300026067 | Bacteria | 2375 |
| 241 | Ga0207708_10023099 | 3300026075 | Bacteria | 4698 |
| 242 | Ga0207708_10027482 | 3300026075 | Bacteria | 4308 |
| 243 | Ga0207702_10016597 | 3300026078 | Bacteria | 6093 |
| 244 | Ga0207702_10082368 | 3300026078 | Bacteria | 2797 |
| 245 | Ga0207702_10308948 | 3300026078 | Bacteria | 1503 |
| 246 | Ga0207674_10058955 | 3300026116 | Bacteria | 3887 |
| 247 | Ga0207683_10001733 | 3300026121 | Bacteria | 19431 |
| 248 | Ga0207683_10022161 | 3300026121 | Bacteria | 5451 |
| 249 | Ga0209973_1013537 | 3300027252 | Bacteria | 1007 |
| 250 | Ga0209982_1000864 | 3300027552 | Bacteria | 3975 |
| 251 | Ga0209970_1005183 | 3300027614 | Bacteria | 2153 |
| 252 | Ga0210002_1001446 | 3300027617 | Bacteria | 3348 |
| 253 | Ga0209983_1006509 | 3300027665 | Bacteria | 2397 |
| 254 | Ga0209282_1000732 | 3300027666 | Bacteria | 16518 |
| 255 | Ga0209998_10003754 | 3300027717 | Bacteria | 3287 |
| 256 | Ga0209974_10003272 | 3300027876 | Bacteria | 5857 |
| 257 | Ga0209974_10005507 | 3300027876 | Bacteria | 4450 |
| 258 | Ga0209974_10007787 | 3300027876 | Bacteria | 3682 |
| 259 | Ga0207428_10020006 | 3300027907 | Bacteria | 5701 |
| 260 | Ga0268266_10005433 | 3300028379 | Bacteria | 11880 |
| 261 | Ga0268266_10616305 | 3300028379 | Bacteria | 1043 |
| 262 | Ga0268264_10074017 | 3300028381 | Bacteria | 2892 |
| 263 | Ga0265330_10017135 | 3300031235 | Bacteria | 3339 |
| 264 | Ga0265325_10015182 | 3300031241 | Bacteria | 4337 |
| 265 | Ga0265339_10013765 | 3300031249 | Bacteria | 4896 |
| 266 | Ga0307408_100180746 | 3300031548 | Bacteria | 1691 |
| 267 | Ga0307408_100457746 | 3300031548 | Bacteria | 1108 |
| 268 | Ga0265342_10067903 | 3300031712 | Bacteria | 2085 |
| 269 | Ga0316576_10001641 | 3300031727 | Bacteria | 12249 |
| 270 | Ga0307405_10080630 | 3300031731 | Bacteria | 2125 |
| 271 | Ga0307405_10472443 | 3300031731 | Bacteria | 999 |
| 272 | Ga0307413_10015212 | 3300031824 | Bacteria | 3936 |
| 273 | Ga0307413_10045836 | 3300031824 | Bacteria | 2595 |
| 274 | Ga0307410_10045319 | 3300031852 | Bacteria | 2927 |
| 275 | Ga0307410_10064110 | 3300031852 | Bacteria | 2524 |
| 276 | Ga0307410_10508339 | 3300031852 | Bacteria | 992 |
| 277 | Ga0307406_10022045 | 3300031901 | Bacteria | 3775 |
| 278 | Ga0307406_10219947 | 3300031901 | Bacteria | 1411 |
| 279 | Ga0307407_10041710 | 3300031903 | Bacteria | 2568 |
| 280 | Ga0307407_10079086 | 3300031903 | Bacteria | 1983 |
| 281 | Ga0307407_10125158 | 3300031903 | Bacteria | 1636 |
| 282 | Ga0307412_10007247 | 3300031911 | Bacteria | 6287 |
| 283 | Ga0307412_10025051 | 3300031911 | Bacteria | 3690 |
| 284 | Ga0307412_10061814 | 3300031911 | Bacteria | 2519 |
| 285 | Ga0307412_10209542 | 3300031911 | Bacteria | 1486 |
| 286 | Ga0307409_100014522 | 3300031995 | Bacteria | 5128 |
| 287 | Ga0307409_100054396 | 3300031995 | Bacteria | 3082 |
| 288 | Ga0307409_100288192 | 3300031995 | Bacteria | 1521 |
| 289 | Ga0307409_100508467 | 3300031995 | Bacteria | 1174 |
| 290 | Ga0307416_100069352 | 3300032002 | Bacteria | 2917 |
| 291 | Ga0307416_100375443 | 3300032002 | Bacteria | 1450 |
| 292 | Ga0307414_10047790 | 3300032004 | Bacteria | 2948 |
| 293 | Ga0307415_100009625 | 3300032126 | Bacteria | 5431 |
| 294 | Ga0316580_10097353 | 3300032139 | Bacteria | 901 |
| 295 | Ga0373940_0072746 | 3300035088 | Bacteria | 1004 |
| 296 | Ga0373956_0043945 | 3300035119 | Bacteria | 1990 |
| 297 | Ga0373931_0222278 | 3300035691 | Bacteria | 1137 |
| 298 | Ga0373927_0371959 | 3300035695 | Bacteria | 942 |
| 299 | Ga0373937_0317772 | 3300036401 | Bacteria | 1473 |
| 300 | Ga0316582_0002253 | 3300036647 | Bacteria | 8981 |
| 301 | Ga0316582_0059315 | 3300036647 | Bacteria | 2450 |
| 302 | Ga0316584_0004012 | 3300036712 | Bacteria | 9688 |
| 303 | Ga0316584_0061397 | 3300036712 | Bacteria | 2814 |
| 304 | Ga0316584_0173116 | 3300036712 | Bacteria | 1600 |
| 305 | Ga0395900_0003258 | 3300037418 | Bacteria | 17580 |
| 306 | Ga0395905_0125367 | 3300037471 | Bacteria | 2415 |
| 307 | Ga0395901_0462636 | 3300038443 | Bacteria | 1296 |
| 308 | Ga0439431_0017370 | 3300041997 | Bacteria | 1691 |
| 309 | Ga0439452_000046 | 3300042010 | Bacteria | 130842 |
| 310 | Ga0439456_013399 | 3300042013 | Bacteria | 1706 |
| 311 | Ga0439434_0005016 | 3300042435 | Bacteria | 3871 |
| 312 | Ga0450901_000920 | 3300042533 | Bacteria | 3443 |
| 313 | Ga0451577_0000068 | 3300042876 | Bacteria | 241923 |
| 314 | Ga0451577_0621428 | 3300042876 | Bacteria | 980 |
| 315 | Ga0466972_0146165 | 3300044658 | Bacteria | 1112 |
| 316 | Ga0466965_0305061 | 3300044683 | Bacteria | 865 |
| 317 | Ga0451576_0049550 | 3300045051 | Bacteria | 4408 |
| 318 | Ga0451576_0062156 | 3300045051 | Bacteria | 3894 |
| 319 | Ga0451576_0654731 | 3300045051 | Bacteria | 1104 |
| 320 | Ga0451576_0762095 | 3300045051 | Bacteria | 1016 |
| 321 | Ga0466967_0277776 | 3300045976 | Bacteria | 1606 |
| 322 | Ga0466967_0340526 | 3300045976 | Bacteria | 1450 |
| 323 | Ga0495627_014592 | 3300046453 | Bacteria | 2737 |
| 324 | Ga0495590_0002665 | 3300046457 | Bacteria | 7378 |
| 325 | Ga0495591_000144 | 3300046458 | Bacteria | 75817 |
| 326 | Ga0495629_0217576 | 3300046459 | Bacteria | 1318 |
| 327 | Ga0495653_0003314 | 3300046463 | Bacteria | 12931 |
| 328 | Ga0495605_0005803 | 3300046474 | Bacteria | 7144 |
| 329 | Ga0495605_0170437 | 3300046474 | Bacteria | 962 |
| 330 | Ga0495584_0094867 | 3300046491 | Bacteria | 1506 |
| 331 | Ga0495596_0112154 | 3300046500 | Bacteria | 1059 |
| 332 | Ga0495607_0002089 | 3300046501 | Bacteria | 16681 |
| 333 | Ga0495607_0004246 | 3300046501 | Bacteria | 10621 |
| 334 | Ga0495607_0010943 | 3300046501 | Bacteria | 6068 |
| 335 | Ga0495606_0000990 | 3300046507 | Bacteria | 41399 |
| 336 | Ga0495606_0032733 | 3300046507 | Bacteria | 3597 |
| 337 | Ga0495610_0007209 | 3300046512 | Bacteria | 7462 |
| 338 | Ga0495610_0008769 | 3300046512 | Bacteria | 6493 |
| 339 | Ga0495610_0011039 | 3300046512 | Bacteria | 5553 |
| 340 | Ga0495620_0000065 | 3300046515 | Bacteria | 90842 |
| 341 | Ga0495620_0005571 | 3300046515 | Bacteria | 7018 |
| 342 | Ga0495628_0002680 | 3300046516 | Bacteria | 15934 |
| 343 | Ga0495630_0001625 | 3300046517 | Bacteria | 15627 |
| 344 | Ga0495632_0000421 | 3300046519 | Bacteria | 40149 |
| 345 | Ga0495637_0029051 | 3300046520 | Bacteria | 2464 |
| 346 | Ga0495643_0002355 | 3300046522 | Bacteria | 15142 |
| 347 | Ga0495642_0005038 | 3300046528 | Bacteria | 5089 |
| 348 | Ga0495652_0001468 | 3300046529 | Bacteria | 26039 |
| 349 | Ga0495652_0263252 | 3300046529 | Bacteria | 1272 |
| 350 | Ga0495654_0092122 | 3300046530 | Bacteria | 1405 |
| 351 | Ga0495665_0000184 | 3300046531 | Bacteria | 31944 |
| 352 | Ga0495587_0012602 | 3300046536 | Bacteria | 5317 |
| 353 | Ga0495597_0006750 | 3300046542 | Bacteria | 5908 |
| 354 | Ga0495597_0054633 | 3300046542 | Bacteria | 1753 |
| 355 | Ga0495645_0011832 | 3300046543 | Bacteria | 6147 |
| 356 | Ga0495635_0007577 | 3300046663 | Bacteria | 7574 |
| 357 | Ga0495661_0000047 | 3300046665 | Bacteria | 146326 |
| 358 | Ga0495588_0305420 | 3300046674 | Bacteria | 837 |
| 359 | Ga0495599_0169126 | 3300046678 | Bacteria | 1349 |
| 360 | Ga0495623_0001022 | 3300046679 | Bacteria | 18934 |
| 361 | Ga0495669_0023296 | 3300046684 | Bacteria | 2694 |
| 362 | Ga0495669_0102548 | 3300046684 | Bacteria | 1330 |
| 363 | Ga0495670_0003366 | 3300046691 | Bacteria | 7866 |
| 364 | Ga0495649_0292364 | 3300046694 | Bacteria | 831 |
| 365 | Ga0495589_0000669 | 3300046794 | Bacteria | 22466 |
| 366 | Ga0495589_0001077 | 3300046794 | Bacteria | 16294 |
| 367 | Ga0495600_0078820 | 3300046809 | Bacteria | 2151 |
| 368 | Ga0495600_0109330 | 3300046809 | Bacteria | 1800 |
| 369 | Ga0495660_0048800 | 3300046810 | Bacteria | 2314 |
| 370 | Ga0495581_0070940 | 3300047315 | Bacteria | 2016 |
| 371 | Ga0495604_0002912 | 3300047317 | Bacteria | 13721 |
| 372 | Ga0495674_0024236 | 3300047319 | Bacteria | 5579 |
| 373 | Ga0495680_0020202 | 3300047322 | Bacteria | 5609 |
| 374 | Ga0495683_0001566 | 3300047323 | Bacteria | 14818 |
| 375 | Ga0495687_000005 | 3300047443 | Bacteria | 610401 |
| 376 | Ga0495675_0014062 | 3300047444 | Bacteria | 5059 |
| 377 | Ga0495679_000674 | 3300047446 | Bacteria | 22384 |
| 378 | Ga0495679_020367 | 3300047446 | Bacteria | 2311 |
| 379 | Ga0495685_033324 | 3300047447 | Bacteria | 1770 |
| 380 | Ga0495673_0098907 | 3300047469 | Bacteria | 1182 |
| 381 | Ga0495681_0001120 | 3300047470 | Bacteria | 20319 |
| 382 | Ga0495681_0008370 | 3300047470 | Bacteria | 6493 |
| 383 | Ga0495681_0009690 | 3300047470 | Bacteria | 5905 |
| 384 | Ga0495593_0005628 | 3300047673 | Bacteria | 7395 |
| 385 | Ga0495602_0001075 | 3300048088 | Bacteria | 26813 |
| 386 | Ga0495626_0130360 | 3300048091 | Bacteria | 1074 |
| 387 | Ga0496100_0040757 | 3300048903 | Bacteria | 2957 |
| 388 | Ga0496100_0252008 | 3300048903 | Bacteria | 1306 |
| 389 | Ga0496101_0006058 | 3300048904 | Bacteria | 7760 |
| 390 | Ga0496102_0002576 | 3300048905 | Bacteria | 15461 |
| 391 | Ga0496102_0368929 | 3300048905 | Bacteria | 1351 |
| 392 | Ga0496103_0053703 | 3300048906 | Bacteria | 2497 |
| 393 | Ga0496103_0065993 | 3300048906 | Bacteria | 2258 |
| 394 | Ga0496104_0025327 | 3300048907 | Bacteria | 5469 |
| 395 | Ga0496104_0489109 | 3300048907 | Bacteria | 1142 |
| 396 | Ga0496105_0245484 | 3300048908 | Bacteria | 1452 |
| 397 | Ga0496105_0284961 | 3300048908 | Bacteria | 1331 |
| 398 | Ga0496107_0022464 | 3300048910 | Bacteria | 4458 |
| 399 | Ga0496107_0164597 | 3300048910 | Bacteria | 1644 |
| 400 | Ga0496108_0588166 | 3300048911 | Bacteria | 970 |
| 401 | Ga0496110_0003254 | 3300048913 | Bacteria | 12382 |
| 402 | Ga0496111_0516318 | 3300048914 | Bacteria | 879 |
| 403 | Ga0496112_0002364 | 3300048915 | Bacteria | 15157 |
| 404 | Ga0496112_0069699 | 3300048915 | Bacteria | 3473 |
| 405 | Ga0496113_0001917 | 3300048916 | Bacteria | 11882 |
| 406 | Ga0496113_0178186 | 3300048916 | Bacteria | 1685 |
| 407 | Ga0496115_0027633 | 3300048918 | Bacteria | 4441 |
| 408 | Ga0496115_0128763 | 3300048918 | Bacteria | 2086 |
| 409 | Ga0496116_0002577 | 3300048919 | Bacteria | 18879 |
| 410 | Ga0496116_0020483 | 3300048919 | Bacteria | 5021 |
| 411 | Ga0496116_0149677 | 3300048919 | Bacteria | 1299 |
| 412 | Ga0496117_0018750 | 3300048920 | Bacteria | 5714 |
| 413 | Ga0496118_0145091 | 3300048921 | Bacteria | 1496 |
| 414 | Ga0496121_0000100 | 3300048924 | Bacteria | 198641 |
| 415 | Ga0496121_0011781 | 3300048924 | Bacteria | 9644 |
| 416 | Ga0496121_0040642 | 3300048924 | Bacteria | 4076 |
| 417 | Ga0496121_0095257 | 3300048924 | Bacteria | 2314 |
| 418 | Ga0496121_0102919 | 3300048924 | Bacteria | 2198 |
| 419 | Ga0496122_0004972 | 3300048925 | Bacteria | 16086 |
| 420 | Ga0496122_0006588 | 3300048925 | Bacteria | 13254 |
| 421 | Ga0496122_0194543 | 3300048925 | Bacteria | 1193 |
| 422 | Ga0496123_0003372 | 3300048926 | Bacteria | 18061 |
| 423 | Ga0496124_0002797 | 3300048927 | Bacteria | 22104 |
| 424 | Ga0496124_0004561 | 3300048927 | Bacteria | 16098 |
| 425 | Ga0496124_0050893 | 3300048927 | Bacteria | 3526 |
| 426 | Ga0496125_0005929 | 3300048928 | Bacteria | 13386 |
| 427 | Ga0496125_0011406 | 3300048928 | Bacteria | 8890 |
| 428 | Ga0496125_0013098 | 3300048928 | Bacteria | 8177 |
| 429 | Ga0496125_0050941 | 3300048928 | Bacteria | 3421 |
| 430 | Ga0496126_0001145 | 3300048929 | Bacteria | 44005 |
| 431 | Ga0496126_0048630 | 3300048929 | Bacteria | 3874 |
| 432 | Ga0496126_0085248 | 3300048929 | Bacteria | 2785 |
| 433 | Ga0501033_0068078 | 3300049570 | Bacteria | 2618 |
| 434 | Ga0501033_0070443 | 3300049570 | Bacteria | 2569 |
| 435 | Ga0501034_0205845 | 3300049571 | Bacteria | 1924 |
| 436 | Ga0501034_0218713 | 3300049571 | Bacteria | 1858 |
| 437 | Ga0501034_0273426 | 3300049571 | Bacteria | 1630 |
| 438 | Ga0501036_0047235 | 3300049572 | Bacteria | 3646 |
| 439 | Ga0501036_0364544 | 3300049572 | Bacteria | 1206 |
| 440 | Ga0501037_0015751 | 3300049573 | Bacteria | 5564 |
| 441 | Ga0501038_0002511 | 3300049574 | Bacteria | 17093 |
| 442 | Ga0501039_0001556 | 3300049575 | Bacteria | 16876 |
| 443 | Ga0501040_0003219 | 3300049576 | Bacteria | 10561 |
| 444 | Ga0501041_0000212 | 3300049577 | Bacteria | 26965 |
| 445 | Ga0501042_0000098 | 3300049578 | Bacteria | 34576 |
| 446 | Ga0501043_0188310 | 3300049579 | Bacteria | 1606 |
| 447 | Ga0501043_0196687 | 3300049579 | Bacteria | 1566 |
| 448 | Ga0501046_0015300 | 3300049580 | Bacteria | 6451 |
| 449 | Ga0501047_0089084 | 3300049581 | Bacteria | 2963 |
| 450 | Ga0501048_0004806 | 3300049582 | Bacteria | 10296 |
| 451 | Ga0501069_0063037 | 3300049585 | Bacteria | 2070 |
| 452 | Ga0501070_0017605 | 3300049586 | Bacteria | 5999 |
| 453 | Ga0501070_0531285 | 3300049586 | Bacteria | 943 |
| 454 | Ga0501071_0000452 | 3300049587 | Bacteria | 20662 |
| 455 | Ga0501072_0044935 | 3300049588 | Bacteria | 3472 |
| 456 | Ga0501072_0255965 | 3300049588 | Bacteria | 1394 |
| 457 | Ga0501073_0013088 | 3300049589 | Bacteria | 6052 |
| 458 | Ga0501073_0034857 | 3300049589 | Bacteria | 3580 |
| 459 | Ga0501073_0176678 | 3300049589 | Bacteria | 1478 |
| 460 | Ga0501073_0219077 | 3300049589 | Bacteria | 1315 |
| 461 | Ga0501074_0004506 | 3300049590 | Bacteria | 9974 |
| 462 | Ga0501074_0023654 | 3300049590 | Bacteria | 4465 |
| 463 | Ga0501075_0000095 | 3300049591 | Bacteria | 40804 |
| 464 | Ga0501076_0000386 | 3300049592 | Bacteria | 27579 |
| 465 | Ga0501077_0000670 | 3300049593 | Bacteria | 20698 |
| 466 | Ga0501217_076390 | 3300049661 | Bacteria | 920 |
| 467 | Ga0501079_0001514 | 3300049741 | Bacteria | 16455 |
| 468 | Ga0501080_0097373 | 3300049742 | Bacteria | 2731 |
| 469 | Ga0501081_0000063 | 3300049743 | Bacteria | 41530 |
| 470 | Ga0501083_0007185 | 3300049744 | Bacteria | 7908 |
| 471 | Ga0501035_0118540 | 3300049822 | Bacteria | 2316 |
| 472 | Ga0501044_0026894 | 3300049823 | Bacteria | 6089 |
| 473 | Ga0501044_0079262 | 3300049823 | Bacteria | 3328 |
| 474 | Ga0501045_0000186 | 3300049824 | Bacteria | 34725 |
| 475 | nmdc:mga03n38_132249_c1 | 3300050490 | Bacteria | 1238 |
| 476 | nmdc:mga00v17_13505_c2 | 3300050491 | Bacteria | 4157 |
| 477 | nmdc:mga0yw44_282733_c1 | 3300050492 | Bacteria | 1109 |
| 478 | nmdc:mga0yw44_306779_c1 | 3300050492 | Bacteria | 1064 |
| 479 | nmdc:mga0k408_40516_c1 | 3300050493 | Bacteria | 2680 |
| 480 | nmdc:mga0k408_5235_c1 | 3300050493 | Bacteria | 6887 |
| 481 | nmdc:mga07m45_14313_c1 | 3300050496 | Bacteria | 4223 |
| 482 | nmdc:mga05p37_113218_c1 | 3300050507 | Bacteria | 3336 |
| 483 | nmdc:mga05p37_643123_c1 | 3300050507 | Bacteria | 1189 |
| 484 | nmdc:mga09592_306117_c1 | 3300050508 | Bacteria | 1377 |
| 485 | nmdc:mga06r32_262154_c1 | 3300050510 | Bacteria | 1716 |
| 486 | nmdc:mga06r32_473266_c1 | 3300050510 | Bacteria | 1231 |
| 487 | nmdc:mga08y16_100368_c1 | 3300050511 | Bacteria | 3013 |
| 488 | nmdc:mga08y16_404359_c1 | 3300050511 | Bacteria | 1397 |
| 489 | nmdc:mga08y16_94837_c1 | 3300050511 | Bacteria | 3108 |
| 490 | nmdc:mga0n895_25810_c1 | 3300050512 | Bacteria | 5556 |
| 491 | nmdc:mga0n895_31767_c1 | 3300050512 | Bacteria | 5059 |
| 492 | nmdc:mga0n895_377049_c1 | 3300050512 | Bacteria | 1436 |
| 493 | nmdc:mga0n895_613_c1 | 3300050512 | Bacteria | 24760 |
| 494 | nmdc:mga0n895_659914_c1 | 3300050512 | Bacteria | 1044 |
| 495 | nmdc:mga0rr50_61810_c1 | 3300050513 | Bacteria | 2823 |
| 496 | nmdc:mga0rr50_94600_c1 | 3300050513 | Bacteria | 2334 |
| 497 | nmdc:mga08x19_114342_c1 | 3300050514 | Bacteria | 1803 |
| 498 | nmdc:mga08x19_21028_c1 | 3300050514 | Bacteria | 4025 |
| 499 | nmdc:mga08x19_352653_c1 | 3300050514 | Bacteria | 1027 |
| 500 | nmdc:mga0a205_17778_c1 | 3300050515 | Bacteria | 6671 |
| 501 | nmdc:mga0a205_229939_c1 | 3300050515 | Bacteria | 1738 |
| 502 | nmdc:mga0a205_258328_c1 | 3300050515 | Bacteria | 1620 |
| 503 | nmdc:mga0a205_46558_c1 | 3300050515 | Bacteria | 4183 |
| 504 | nmdc:mga0sz30_47029_c1 | 3300050516 | Bacteria | 1823 |
| 505 | Ga0500643_008152 | 3300053087 | Bacteria | 4144 |
| 506 | Ga0500566_0000210 | 3300053094 | Bacteria | 30847 |
| 507 | Ga0500568_0000048 | 3300053139 | Bacteria | 119025 |
| 508 | Ga0500568_0020221 | 3300053139 | Bacteria | 2883 |
| 509 | Ga0500568_0022641 | 3300053139 | Bacteria | 2684 |
| 510 | Ga0500616_0055893 | 3300053153 | Bacteria | 2062 |
| 511 | Ga0501084_0000662 | 3300054114 | Bacteria | 26273 |
| 512 | Ga0501082_0000921 | 3300060353 | Bacteria | 25918 |
| 513 | Ga0530510_0381796 | 3300061734 | Bacteria | 1060 |
| 514 | 2509078542 | 2508501114 | Bacteria | 7082538 |
| 515 | 2511391173 | 2511231027 | Bacteria | 5013807 |
| 516 | 2511700415 | 2511231119 | Bacteria | 4019861 |
| 517 | 2521560528 | 2521172590 | Bacteria | 5047645 |
| 518 | 2599905929 | 2599185292 | Bacteria | 6290804 |
| 519 | 2599907820 | 2599185292 | Bacteria | 6290804 |
| 520 | 2643845765 | 2643221565 | Bacteria | 6216018 |
| 521 | 2643859083 | 2643221569 | Bacteria | 6064337 |
| 522 | 2643859890 | 2643221569 | Bacteria | 6064337 |
| 523 | 2643979180 | 2643221594 | Bacteria | 5811388 |
| 524 | 2643980087 | 2643221594 | Bacteria | 5811388 |
| 525 | 2644121224 | 2643221621 | Bacteria | 6212786 |
| 526 | 2644122950 | 2643221621 | Bacteria | 6212786 |
| 527 | 2644153838 | 2643221627 | Bacteria | 6761570 |
| 528 | 2644492754 | 2643221688 | Bacteria | 5260751 |
| 529 | 2644743064 | 2643221736 | Bacteria | 6608466 |
| 530 | 2651531710 | 2648501850 | Bacteria | 3975476 |
| 531 | 2686997642 | 2684623153 | Bacteria | 3878815 |
| 532 | 2695628405 | 2695420354 | Bacteria | 3922431 |
| 533 | 2739612591 | 2739367655 | Bacteria | 4051151 |
| 534 | 2739613731 | 2739367655 | Bacteria | 4051151 |
| 535 | 2758638217 | 2758568016 | Bacteria | 5645291 |
| 536 | 2776266116 | 2775506901 | Bacteria | 9631051 |
| 537 | 2809033811 | 2808606395 | Bacteria | 6020352 |
| 538 | 2809036053 | 2808606395 | Bacteria | 6020352 |
| 539 | 2809055615 | 2808606399 | Bacteria | 4021018 |
| 540 | 2819617213 | 2818991449 | Bacteria | 5518009 |
| 541 | 2837681732 | 2837678835 | Bacteria | 5252418 |
| 542 | 2838079886 | 2838074704 | Bacteria | 6785777 |
| 543 | 2842874104 | 2842871566 | Bacteria | 4827117 |
| 544 | 2844322666 | 2844315083 | Bacteria | 8138177 |
| 545 | 2844535060 | 2844533157 | Bacteria | 7517899 |
| 546 | 2852392330 | 2852387548 | Bacteria | 8025568 |
| 547 | 2854896654 | 2854896431 | Bacteria | 5869725 |
| 548 | 2857533350 | 2857531043 | Bacteria | 6754041 |
| 549 | 2857539719 | 2857537821 | Bacteria | 5248181 |
| 550 | 2876378120 | 2876377896 | Bacteria | 6565995 |
| 551 | 2876766077 | 2876761206 | Bacteria | 10111113 |
| 552 | 2877771302 | 2877768649 | Bacteria | 3957164 |
| 553 | 2880172169 | 2880169592 | Bacteria | 3900066 |
| 554 | 2889298428 | 2889295896 | Bacteria | 4704906 |
| 555 | 2897112444 | 2897109615 | Bacteria | 4009619 |
| 556 | 2897809667 | 2897803580 | Bacteria | 7000062 |
| 557 | 2903734819 | 2903727486 | Bacteria | 8281579 |
| 558 | 2904442851 | 2904439833 | Bacteria | 5931679 |
| 559 | 2904534952 | 2904530477 | Bacteria | 5876334 |
| 560 | 2904588709 | 2904584206 | Bacteria | 6028872 |
| 561 | 2904594217 | 2904589729 | Bacteria | 6113573 |
| 562 | 2904604942 | 2904601388 | Bacteria | 5884906 |
| 563 | 2906604870 | 2906602504 | Bacteria | 8295279 |
| 564 | 2909047787 | 2909042592 | Bacteria | 6499737 |
| 565 | 2919048651 | 2919046199 | Bacteria | 5567169 |
| 566 | 2919055512 | 2919055335 | Bacteria | 3875751 |
| 567 | 2919083178 | 2919079590 | Bacteria | 5946433 |
| 568 | 2919728545 | 2919726948 | Bacteria | 3696050 |
| 569 | 2928133034 | 2928130867 | Bacteria | 5467269 |
| 570 | 2928525185 | 2928521798 | Bacteria | 4960112 |
| 571 | 2932404049 | 2932401849 | Bacteria | 4262978 |
| 572 | 2932801578 | 2932794094 | Bacteria | 7915132 |
| 573 | 2941484926 | |||
| 574 | 2945962943 | 2945961074 | Bacteria | 7342064 |
| 575 | 2954011275 | 2954011201 | Bacteria | 4762601 |
| 576 | 2981289175 | 2981284811 | Bacteria | 4641497 |
| 577 | 2981293991 | 2981289755 | Bacteria | 4641509 |
| 578 | 2981984754 | 2981980479 | Bacteria | 4641628 |
| 579 | 2981989682 | 2981985349 | Bacteria | 4641497 |
| 580 | 2995727661 | 2995726249 | Bacteria | 3470435 |
| 581 | 3002145492 | 3002141150 | Bacteria | 5254435 |
| 582 | 3005409946 | 3005409236 | Bacteria | 7188837 |
| 583 | 3005602740 | 3005594810 | Bacteria | 8716512 |
| 584 | 3005725212 | 3005718088 | Bacteria | 8283608 |
| 585 | 3006882443 | 3006879489 | Bacteria | 4064221 |
| 586 | 3006985803 | 3006984091 | Bacteria | 4207523 |
| 587 | 641641997 | 641522639 | Bacteria | 7737025 |
| 588 | 643601343 | 643348564 | Bacteria | 8839022 |
| 589 | 8002395602 | 8002392321 | Bacteria | 4159911 |
| 590 | 8022632043 | 8022630665 | Bacteria | 3886130 |
| 591 | 8022654559 | 8022653035 | Bacteria | 4035078 |
| 592 | 8045868898 | 8045864390 | Bacteria | 5043873 |
| 593 | 8046773407 | 8046767195 | Bacteria | 7547379 |
| 594 | 8048748705 | 8048746797 | Bacteria | 3557226 |
| 595 | 8054283859 | 8054280661 | Bacteria | 4232245 |
| 596 | 8055036369 | 8055034563 | Bacteria | 3562128 |
| 597 | 8056976675 | 8056967851 | Bacteria | 9038162 |
| 598 | 8057738649 | 8057733483 | Bacteria | 6578323 |
| 599 | Ga0209995_1011499 | |||
| 600 | JGI25155J39150_1000229 | |||
| 601 | JGI25156J39149_1003302 | |||
| 602 | JGI25154J39366_1000511 | |||
| 603 | JGI25157J39369_1004131 | |||
| 604 | JGI25151J46595_10000095 | |||
| 605 | JGI25151J46595_10000318 | |||
| 606 | Ga0055538_1000024 | |||
| 607 | Ga0055526_1000249 | |||
| 608 | Ga0055524_1000043 | |||
| 609 | Ga0065714_10067678 | |||
| 610 | Ga0065704_10013198 | |||
| 611 | Ga0065715_10000426 | |||
| 612 | Ga0065715_10009394 | |||
| 613 | Ga0065707_10098051 | |||
| 614 | Ga0070690_100001728 | |||
| 615 | Ga0070670_100000241 | |||
| 616 | Ga0068869_100065337 | |||
| 617 | Ga0070666_10006590 | |||
| 618 | Ga0070666_10023588 | |||
| 619 | Ga0070666_10330185 | |||
| 620 | Ga0070680_100055288 | |||
| 621 | Ga0070682_100027582 | |||
| 622 | Ga0068868_100032140 | |||
| 623 | Ga0070691_10003903 | |||
| 624 | Ga0070687_100140713 | |||
| 625 | Ga0070661_100064324 | |||
| 626 | Ga0070661_100108327 | |||
| 627 | Ga0070661_100298825 | |||
| 628 | Ga0070668_100280882 | |||
| 629 | Ga0070669_100062838 | |||
| 630 | Ga0070675_100015962 | |||
| 631 | Ga0070671_100003162 | |||
| 632 | Ga0070671_100123386 | |||
| 633 | Ga0070671_100606094 | |||
| 634 | Ga0070673_100009896 | |||
| 635 | Ga0070673_100016661 | |||
| 636 | Ga0070673_100169713 | |||
| 637 | Ga0070673_100602672 | |||
| 638 | Ga0070667_100009817 | |||
| 639 | Ga0070667_100038018 | |||
| 640 | Ga0070667_100386595 | |||
| 641 | Ga0070714_100068229 | |||
| 642 | Ga0070713_100118514 | |||
| 643 | Ga0070700_100093866 | |||
| 644 | Ga0070663_100019625 | |||
| 645 | Ga0070663_100050570 | |||
| 646 | Ga0070678_100094092 | |||
| 647 | Ga0070681_10007675 | |||
| 648 | Ga0070681_10019365 | |||
| 649 | Ga0068867_100226451 | |||
| 650 | Ga0068867_100249872 | |||
| 651 | Ga0070706_100126446 | |||
| 652 | Ga0070707_100011228 | |||
| 653 | Ga0070707_100025476 | |||
| 654 | Ga0070679_100050772 | |||
| 655 | Ga0070679_100088679 | |||
| 656 | Ga0070679_100419173 | |||
| 657 | Ga0070697_100031141 | |||
| 658 | Ga0070672_100043746 | |||
| 659 | Ga0070672_100055242 | |||
| 660 | Ga0070672_100073479 | |||
| 661 | Ga0070686_100069349 | |||
| 662 | Ga0070686_100317162 | |||
| 663 | Ga0070695_100017441 | |||
| 664 | Ga0070696_100031376 | |||
| 665 | Ga0070665_100003905 | |||
| 666 | Ga0068855_100000235 | |||
| 667 | Ga0068855_100005884 | |||
| 668 | Ga0068855_100045149 | |||
| 669 | Ga0068855_100336100 | |||
| 670 | Ga0070664_100001253 | |||
| 671 | Ga0070664_100037578 | |||
| 672 | Ga0068857_100321719 | |||
| 673 | Ga0068854_100033253 | |||
| 674 | Ga0068854_100049200 | |||
| 675 | Ga0068856_100007513 | |||
| 676 | Ga0070702_100168334 | |||
| 677 | Ga0068866_10158450 | |||
| 678 | Ga0068866_10307548 | |||
| 679 | Ga0068851_10116864 | |||
| 680 | Ga0068863_100662197 | |||
| 681 | Ga0068858_100052331 | |||
| 682 | Ga0068860_100078904 | |||
| 683 | Ga0075365_10313104 | |||
| 684 | Ga0075368_10018116 | |||
| 685 | Ga0075363_100133742 | |||
| 686 | Ga0075364_10041702 | |||
| 687 | Ga0075432_10003120 | |||
| 688 | Ga0070716_100154194 | |||
| 689 | Ga0075369_10035098 | |||
| 690 | Ga0075366_10002900 | |||
| 691 | Ga0075366_10026350 | |||
| 692 | Ga0097621_100257266 | |||
| 693 | Ga0075370_10039197 | |||
| 694 | Ga0075428_100434147 | |||
| 695 | Ga0075431_100026024 | |||
| 696 | Ga0075431_100195359 | |||
| 697 | Ga0075431_100282471 | |||
| 698 | Ga0075433_10084026 | |||
| 699 | Ga0075433_10132243 | |||
| 700 | Ga0075433_10187925 | |||
| 701 | Ga0075434_100000912 | |||
| 702 | Ga0075434_100003395 | |||
| 703 | Ga0075434_100053087 | |||
| 704 | Ga0075434_100113809 | |||
| 705 | Ga0068865_100072944 | |||
| 706 | Ga0075436_100005072 | |||
| 707 | Ga0075436_100137224 | |||
| 708 | Ga0099826_10000111 | |||
| 709 | Ga0099794_10218042 | |||
| 710 | Ga0105251_10001709 | |||
| 711 | Ga0105244_10085698 | |||
| 712 | Ga0105250_10059492 | |||
| 713 | Ga0105250_10079229 | |||
| 714 | Ga0111539_10254829 | |||
| 715 | Ga0111539_10601240 | |||
| 716 | Ga0105245_10028254 | |||
| 717 | Ga0105245_10256027 | |||
| 718 | Ga0114129_10046851 | |||
| 719 | Ga0114129_10117245 | |||
| 720 | Ga0105243_10025532 | |||
| 721 | Ga0105241_10009789 | |||
| 722 | Ga0105242_10038460 | |||
| 723 | Ga0105242_10252814 | |||
| 724 | Ga0105248_10001597 | |||
| 725 | Ga0105248_10029885 | |||
| 726 | Ga0105248_10201612 | |||
| 727 | Ga0105248_10581094 | |||
| 728 | Ga0105237_10039387 | |||
| 729 | Ga0105237_10111120 | |||
| 730 | Ga0105237_10593508 | |||
| 731 | Ga0105238_10000113 | |||
| 732 | Ga0105238_10058573 | |||
| 733 | Ga0105238_10105126 | |||
| 734 | Ga0105238_10299803 | |||
| 735 | Ga0105249_10073334 | |||
| 736 | Ga0105249_10447338 | |||
| 737 | Ga0105239_10001563 | |||
| 738 | Ga0105239_10017697 | |||
| 739 | Ga0105239_10262397 | |||
| 740 | Ga0105246_10010742 | |||
| 741 | Ga0105246_10018015 | |||
| 742 | Ga0105246_10152400 | |||
| 743 | Ga0157319_1001881 | |||
| 744 | Ga0157373_10092948 | |||
| 745 | Ga0157373_10161683 | |||
| 746 | Ga0157371_10166634 | |||
| 747 | Ga0157370_10284202 | |||
| 748 | Ga0171462_1012 | |||
| 749 | Ga0157378_10187876 | |||
| 750 | Ga0163162_10001128 | |||
| 751 | Ga0163162_10017943 | |||
| 752 | Ga0163162_10115131 | |||
| 753 | Ga0163162_10233793 | |||
| 754 | Ga0157372_10032766 | |||
| 755 | Ga0157372_10047601 | |||
| 756 | Ga0157375_10001058 | |||
| 757 | Ga0157375_10107199 | |||
| 758 | Ga0157375_10219956 | |||
| 759 | Ga0157380_10005138 | |||
| 760 | Ga0157376_10010980 | |||
| 761 | Ga0182006_1000245 | |||
| 762 | Ga0182007_10001008 | |||
| 763 | Ga0209435_100124 | |||
| 764 | Ga0209646_1000238 | |||
| 765 | Ga0209026_1003975 | |||
| 766 | Ga0209759_1000921 | |||
| 767 | Ga0209130_1001190 | |||
| 768 | Ga0209676_1008189 | |||
| 769 | Ga0209025_1000429 | |||
| 770 | Ga0209564_1000041 | |||
| 771 | Ga0209564_1008314 | |||
| 772 | Ga0209758_1002010 | |||
| 773 | Ga0209050_1001827 | |||
| 774 | Ga0209050_1016676 | |||
| 775 | Ga0209256_1000014 | |||
| 776 | Ga0207426_1000085 | |||
| 777 | Ga0209051_1009097 | |||
| 778 | Ga0207697_10008134 | |||
| 779 | Ga0207697_10022284 | |||
| 780 | Ga0207656_10086379 | |||
| 781 | Ga0207656_10135133 | |||
| 782 | Ga0207696_1099331 | |||
| 783 | Ga0207713_1003781 | |||
| 784 | Ga0207642_10250366 | |||
| 785 | Ga0207688_10004542 | |||
| 786 | Ga0207688_10014828 | |||
| 787 | Ga0207680_10003765 | |||
| 788 | Ga0207680_10207096 | |||
| 789 | Ga0207647_10045724 | |||
| 790 | Ga0207647_10232048 | |||
| 791 | Ga0207645_10020234 | |||
| 792 | Ga0207707_10032009 | |||
| 793 | Ga0207695_10002110 | |||
| 794 | Ga0207671_10001053 | |||
| 795 | Ga0207671_10124001 | |||
| 796 | Ga0207693_10154107 | |||
| 797 | Ga0207660_10025398 | |||
| 798 | Ga0207657_10002201 | |||
| 799 | Ga0207649_10186349 | |||
| 800 | Ga0207649_10297588 | |||
| 801 | Ga0207652_10052510 | |||
| 802 | Ga0207652_10362267 | |||
| 803 | Ga0207646_10065881 | |||
| 804 | Ga0207681_10022576 | |||
| 805 | Ga0207681_10485962 | |||
| 806 | Ga0207694_10000075 | |||
| 807 | Ga0207694_10100159 | |||
| 808 | Ga0207694_10402529 | |||
| 809 | Ga0207650_10001805 | |||
| 810 | Ga0207659_10208975 | |||
| 811 | Ga0207687_10393465 | |||
| 812 | Ga0207664_10104432 | |||
| 813 | Ga0207690_10012404 | |||
| 814 | Ga0207706_10002107 | |||
| 815 | Ga0207686_10175927 | |||
| 816 | Ga0207669_10184266 | |||
| 817 | Ga0207665_10124210 | |||
| 818 | Ga0207691_10008329 | |||
| 819 | Ga0207691_10061325 | |||
| 820 | Ga0207711_10005820 | |||
| 821 | Ga0207711_10015929 | |||
| 822 | Ga0207689_10056084 | |||
| 823 | Ga0207679_10016389 | |||
| 824 | Ga0207667_10000110 | |||
| 825 | Ga0207667_10006885 | |||
| 826 | Ga0207667_10018717 | |||
| 827 | Ga0207667_10480648 | |||
| 828 | Ga0207651_10134326 | |||
| 829 | Ga0207712_10358754 | |||
| 830 | Ga0207640_10009174 | |||
| 831 | Ga0207658_10244664 | |||
| 832 | Ga0207658_10323656 | |||
| 833 | Ga0207677_10414542 | |||
| 834 | Ga0207703_10274227 | |||
| 835 | Ga0207703_10544347 | |||
| 836 | Ga0207678_10006728 | |||
| 837 | Ga0207678_10103002 | |||
| 838 | Ga0207678_10107857 | |||
| 839 | Ga0207708_10023099 | |||
| 840 | Ga0207708_10027482 | |||
| 841 | Ga0207702_10016597 | |||
| 842 | Ga0207702_10082368 | |||
| 843 | Ga0207702_10308948 | |||
| 844 | Ga0207674_10058955 | |||
| 845 | Ga0207683_10001733 | |||
| 846 | Ga0207683_10022161 | |||
| 847 | Ga0209973_1013537 | |||
| 848 | Ga0209982_1000864 | |||
| 849 | Ga0209970_1005183 | |||
| 850 | Ga0210002_1001446 | |||
| 851 | Ga0209983_1006509 | |||
| 852 | Ga0209282_1000732 | |||
| 853 | Ga0209998_10003754 | |||
| 854 | Ga0209974_10003272 | |||
| 855 | Ga0209974_10005507 | |||
| 856 | Ga0209974_10007787 | |||
| 857 | Ga0207428_10020006 | |||
| 858 | Ga0268266_10005433 | |||
| 859 | Ga0268266_10616305 | |||
| 860 | Ga0268264_10074017 | |||
| 861 | Ga0265330_10017135 | |||
| 862 | Ga0265325_10015182 | |||
| 863 | Ga0265339_10013765 | |||
| 864 | Ga0307408_100180746 | |||
| 865 | Ga0307408_100457746 | |||
| 866 | Ga0265342_10067903 | |||
| 867 | Ga0316576_10001641 | |||
| 868 | Ga0307405_10080630 | |||
| 869 | Ga0307405_10472443 | |||
| 870 | Ga0307413_10015212 | |||
| 871 | Ga0307413_10045836 | |||
| 872 | Ga0307410_10045319 | |||
| 873 | Ga0307410_10064110 | |||
| 874 | Ga0307410_10508339 | |||
| 875 | Ga0307406_10022045 | |||
| 876 | Ga0307406_10219947 | |||
| 877 | Ga0307407_10041710 | |||
| 878 | Ga0307407_10079086 | |||
| 879 | Ga0307407_10125158 | |||
| 880 | Ga0307412_10007247 | |||
| 881 | Ga0307412_10025051 | |||
| 882 | Ga0307412_10061814 | |||
| 883 | Ga0307412_10209542 | |||
| 884 | Ga0307409_100014522 | |||
| 885 | Ga0307409_100054396 | |||
| 886 | Ga0307409_100288192 | |||
| 887 | Ga0307409_100508467 | |||
| 888 | Ga0307416_100069352 | |||
| 889 | Ga0307416_100375443 | |||
| 890 | Ga0307414_10047790 | |||
| 891 | Ga0307415_100009625 | |||
| 892 | Ga0316580_10097353 | |||
| 893 | Ga0373940_0072746 | |||
| 894 | Ga0373956_0043945 | |||
| 895 | Ga0373931_0222278 | |||
| 896 | Ga0373927_0371959 | |||
| 897 | Ga0373937_0317772 | |||
| 898 | Ga0316582_0002253 | |||
| 899 | Ga0316582_0059315 | |||
| 900 | Ga0316584_0004012 | |||
| 901 | Ga0316584_0061397 | |||
| 902 | Ga0316584_0173116 | |||
| 903 | Ga0395900_0003258 | |||
| 904 | Ga0395905_0125367 | |||
| 905 | Ga0395901_0462636 | |||
| 906 | Ga0439431_0017370 | |||
| 907 | Ga0439452_000046 | |||
| 908 | Ga0439456_013399 | |||
| 909 | Ga0439434_0005016 | |||
| 910 | Ga0450901_000920 | |||
| 911 | Ga0451577_0000068 | |||
| 912 | Ga0451577_0621428 | |||
| 913 | Ga0466972_0146165 | |||
| 914 | Ga0466965_0305061 | |||
| 915 | Ga0451576_0049550 | |||
| 916 | Ga0451576_0062156 | |||
| 917 | Ga0451576_0654731 | |||
| 918 | Ga0451576_0762095 | |||
| 919 | Ga0466967_0277776 | |||
| 920 | Ga0466967_0340526 | |||
| 921 | Ga0495627_014592 | |||
| 922 | Ga0495590_0002665 | |||
| 923 | Ga0495591_000144 | |||
| 924 | Ga0495629_0217576 | |||
| 925 | Ga0495653_0003314 | |||
| 926 | Ga0495605_0005803 | |||
| 927 | Ga0495605_0170437 | |||
| 928 | Ga0495584_0094867 | |||
| 929 | Ga0495596_0112154 | |||
| 930 | Ga0495607_0002089 | |||
| 931 | Ga0495607_0004246 | |||
| 932 | Ga0495607_0010943 | |||
| 933 | Ga0495606_0000990 | |||
| 934 | Ga0495606_0032733 | |||
| 935 | Ga0495610_0007209 | |||
| 936 | Ga0495610_0008769 | |||
| 937 | Ga0495610_0011039 | |||
| 938 | Ga0495620_0000065 | |||
| 939 | Ga0495620_0005571 | |||
| 940 | Ga0495628_0002680 | |||
| 941 | Ga0495630_0001625 | |||
| 942 | Ga0495632_0000421 | |||
| 943 | Ga0495637_0029051 | |||
| 944 | Ga0495643_0002355 | |||
| 945 | Ga0495642_0005038 | |||
| 946 | Ga0495652_0001468 | |||
| 947 | Ga0495652_0263252 | |||
| 948 | Ga0495654_0092122 | |||
| 949 | Ga0495665_0000184 | |||
| 950 | Ga0495587_0012602 | |||
| 951 | Ga0495597_0006750 | |||
| 952 | Ga0495597_0054633 | |||
| 953 | Ga0495645_0011832 | |||
| 954 | Ga0495635_0007577 | |||
| 955 | Ga0495661_0000047 | |||
| 956 | Ga0495588_0305420 | |||
| 957 | Ga0495599_0169126 | |||
| 958 | Ga0495623_0001022 | |||
| 959 | Ga0495669_0023296 | |||
| 960 | Ga0495669_0102548 | |||
| 961 | Ga0495670_0003366 | |||
| 962 | Ga0495649_0292364 | |||
| 963 | Ga0495589_0000669 | |||
| 964 | Ga0495589_0001077 | |||
| 965 | Ga0495600_0078820 | |||
| 966 | Ga0495600_0109330 | |||
| 967 | Ga0495660_0048800 | |||
| 968 | Ga0495581_0070940 | |||
| 969 | Ga0495604_0002912 | |||
| 970 | Ga0495674_0024236 | |||
| 971 | Ga0495680_0020202 | |||
| 972 | Ga0495683_0001566 | |||
| 973 | Ga0495687_000005 | |||
| 974 | Ga0495675_0014062 | |||
| 975 | Ga0495679_000674 | |||
| 976 | Ga0495679_020367 | |||
| 977 | Ga0495685_033324 | |||
| 978 | Ga0495673_0098907 | |||
| 979 | Ga0495681_0001120 | |||
| 980 | Ga0495681_0008370 | |||
| 981 | Ga0495681_0009690 | |||
| 982 | Ga0495593_0005628 | |||
| 983 | Ga0495602_0001075 | |||
| 984 | Ga0495626_0130360 | |||
| 985 | Ga0496100_0040757 | |||
| 986 | Ga0496100_0252008 | |||
| 987 | Ga0496101_0006058 | |||
| 988 | Ga0496102_0002576 | |||
| 989 | Ga0496102_0368929 | |||
| 990 | Ga0496103_0053703 | |||
| 991 | Ga0496103_0065993 | |||
| 992 | Ga0496104_0025327 | |||
| 993 | Ga0496104_0489109 | |||
| 994 | Ga0496105_0245484 | |||
| 995 | Ga0496105_0284961 | |||
| 996 | Ga0496107_0022464 | |||
| 997 | Ga0496107_0164597 | |||
| 998 | Ga0496108_0588166 | |||
| 999 | Ga0496110_0003254 | |||
| 1000 | Ga0496111_0516318 | |||
| 1001 | Ga0496112_0002364 | |||
| 1002 | Ga0496112_0069699 | |||
| 1003 | Ga0496113_0001917 | |||
| 1004 | Ga0496113_0178186 | |||
| 1005 | Ga0496115_0027633 | |||
| 1006 | Ga0496115_0128763 | |||
| 1007 | Ga0496116_0002577 | |||
| 1008 | Ga0496116_0020483 | |||
| 1009 | Ga0496116_0149677 | |||
| 1010 | Ga0496117_0018750 | |||
| 1011 | Ga0496118_0145091 | |||
| 1012 | Ga0496121_0000100 | |||
| 1013 | Ga0496121_0011781 | |||
| 1014 | Ga0496121_0040642 | |||
| 1015 | Ga0496121_0095257 | |||
| 1016 | Ga0496121_0102919 | |||
| 1017 | Ga0496122_0004972 | |||
| 1018 | Ga0496122_0006588 | |||
| 1019 | Ga0496122_0194543 | |||
| 1020 | Ga0496123_0003372 | |||
| 1021 | Ga0496124_0002797 | |||
| 1022 | Ga0496124_0004561 | |||
| 1023 | Ga0496124_0050893 | |||
| 1024 | Ga0496125_0005929 | |||
| 1025 | Ga0496125_0011406 | |||
| 1026 | Ga0496125_0013098 | |||
| 1027 | Ga0496125_0050941 | |||
| 1028 | Ga0496126_0001145 | |||
| 1029 | Ga0496126_0048630 | |||
| 1030 | Ga0496126_0085248 | |||
| 1031 | Ga0501033_0068078 | |||
| 1032 | Ga0501033_0070443 | |||
| 1033 | Ga0501034_0205845 | |||
| 1034 | Ga0501034_0218713 | |||
| 1035 | Ga0501034_0273426 | |||
| 1036 | Ga0501036_0047235 | |||
| 1037 | Ga0501036_0364544 | |||
| 1038 | Ga0501037_0015751 | |||
| 1039 | Ga0501038_0002511 | |||
| 1040 | Ga0501039_0001556 | |||
| 1041 | Ga0501040_0003219 | |||
| 1042 | Ga0501041_0000212 | |||
| 1043 | Ga0501042_0000098 | |||
| 1044 | Ga0501043_0188310 | |||
| 1045 | Ga0501043_0196687 | |||
| 1046 | Ga0501046_0015300 | |||
| 1047 | Ga0501047_0089084 | |||
| 1048 | Ga0501048_0004806 | |||
| 1049 | Ga0501069_0063037 | |||
| 1050 | Ga0501070_0017605 | |||
| 1051 | Ga0501070_0531285 | |||
| 1052 | Ga0501071_0000452 | |||
| 1053 | Ga0501072_0044935 | |||
| 1054 | Ga0501072_0255965 | |||
| 1055 | Ga0501073_0013088 | |||
| 1056 | Ga0501073_0034857 | |||
| 1057 | Ga0501073_0176678 | |||
| 1058 | Ga0501073_0219077 | |||
| 1059 | Ga0501074_0004506 | |||
| 1060 | Ga0501074_0023654 | |||
| 1061 | Ga0501075_0000095 | |||
| 1062 | Ga0501076_0000386 | |||
| 1063 | Ga0501077_0000670 | |||
| 1064 | Ga0501217_076390 | |||
| 1065 | Ga0501079_0001514 | |||
| 1066 | Ga0501080_0097373 | |||
| 1067 | Ga0501081_0000063 | |||
| 1068 | Ga0501083_0007185 | |||
| 1069 | Ga0501035_0118540 | |||
| 1070 | Ga0501044_0026894 | |||
| 1071 | Ga0501044_0079262 | |||
| 1072 | Ga0501045_0000186 | |||
| 1073 | nmdc:mga03n38_132249_c1 | |||
| 1074 | nmdc:mga00v17_13505_c2 | |||
| 1075 | nmdc:mga0yw44_282733_c1 | |||
| 1076 | nmdc:mga0yw44_306779_c1 | |||
| 1077 | nmdc:mga0k408_40516_c1 | |||
| 1078 | nmdc:mga0k408_5235_c1 | |||
| 1079 | nmdc:mga07m45_14313_c1 | |||
| 1080 | nmdc:mga05p37_113218_c1 | |||
| 1081 | nmdc:mga05p37_643123_c1 | |||
| 1082 | nmdc:mga09592_306117_c1 | |||
| 1083 | nmdc:mga06r32_262154_c1 | |||
| 1084 | nmdc:mga06r32_473266_c1 | |||
| 1085 | nmdc:mga08y16_100368_c1 | |||
| 1086 | nmdc:mga08y16_404359_c1 | |||
| 1087 | nmdc:mga08y16_94837_c1 | |||
| 1088 | nmdc:mga0n895_25810_c1 | |||
| 1089 | nmdc:mga0n895_31767_c1 | |||
| 1090 | nmdc:mga0n895_377049_c1 | |||
| 1091 | nmdc:mga0n895_613_c1 | |||
| 1092 | nmdc:mga0n895_659914_c1 | |||
| 1093 | nmdc:mga0rr50_61810_c1 | |||
| 1094 | nmdc:mga0rr50_94600_c1 | |||
| 1095 | nmdc:mga08x19_114342_c1 | |||
| 1096 | nmdc:mga08x19_21028_c1 | |||
| 1097 | nmdc:mga08x19_352653_c1 | |||
| 1098 | nmdc:mga0a205_17778_c1 | |||
| 1099 | nmdc:mga0a205_229939_c1 | |||
| 1100 | nmdc:mga0a205_258328_c1 | |||
| 1101 | nmdc:mga0a205_46558_c1 | |||
| 1102 | nmdc:mga0sz30_47029_c1 | |||
| 1103 | Ga0500643_008152 | |||
| 1104 | Ga0500566_0000210 | |||
| 1105 | Ga0500568_0000048 | |||
| 1106 | Ga0500568_0020221 | |||
| 1107 | Ga0500568_0022641 | |||
| 1108 | Ga0500616_0055893 | |||
| 1109 | Ga0501084_0000662 | |||
| 1110 | Ga0501082_0000921 | |||
| 1111 | Ga0530510_0381796 | |||
| 1112 | 2509078542 | |||
| 1113 | 2511391173 | |||
| 1114 | 2511700415 | |||
| 1115 | 2521560528 | |||
| 1116 | 2599905929 | |||
| 1117 | 2599907820 | |||
| 1118 | 2643845765 | |||
| 1119 | 2643859083 | |||
| 1120 | 2643859890 | |||
| 1121 | 2643979180 | |||
| 1122 | 2643980087 | |||
| 1123 | 2644121224 | |||
| 1124 | 2644122950 | |||
| 1125 | 2644153838 | |||
| 1126 | 2644492754 | |||
| 1127 | 2644743064 | |||
| 1128 | 2651531710 | |||
| 1129 | 2686997642 | |||
| 1130 | 2695628405 | |||
| 1131 | 2739612591 | |||
| 1132 | 2739613731 | |||
| 1133 | 2758638217 | |||
| 1134 | 2776266116 | |||
| 1135 | 2809033811 | |||
| 1136 | 2809036053 | |||
| 1137 | 2809055615 | |||
| 1138 | 2819617213 | |||
| 1139 | 2837681732 | |||
| 1140 | 2838079886 | |||
| 1141 | 2842874104 | |||
| 1142 | 2844322666 | |||
| 1143 | 2844535060 | |||
| 1144 | 2852392330 | |||
| 1145 | 2854896654 | |||
| 1146 | 2857533350 | |||
| 1147 | 2857539719 | |||
| 1148 | 2876378120 | |||
| 1149 | 2876766077 | |||
| 1150 | 2877771302 | |||
| 1151 | 2880172169 | |||
| 1152 | 2889298428 | |||
| 1153 | 2897112444 | |||
| 1154 | 2897809667 | |||
| 1155 | 2903734819 | |||
| 1156 | 2904442851 | |||
| 1157 | 2904534952 | |||
| 1158 | 2904588709 | |||
| 1159 | 2904594217 | |||
| 1160 | 2904604942 | |||
| 1161 | 2906604870 | |||
| 1162 | 2909047787 | |||
| 1163 | 2919048651 | |||
| 1164 | 2919055512 | |||
| 1165 | 2919083178 | |||
| 1166 | 2919728545 | |||
| 1167 | 2928133034 | |||
| 1168 | 2928525185 | |||
| 1169 | 2932404049 | |||
| 1170 | 2932801578 | |||
| 1171 | 2941484926 | |||
| 1172 | 2945962943 | |||
| 1173 | 2954011275 | |||
| 1174 | 2981289175 | |||
| 1175 | 2981293991 | |||
| 1176 | 2981984754 | |||
| 1177 | 2981989682 | |||
| 1178 | 2995727661 | |||
| 1179 | 3002145492 | |||
| 1180 | 3005409946 | |||
| 1181 | 3005602740 | |||
| 1182 | 3005725212 | |||
| 1183 | 3006882443 | |||
| 1184 | 3006985803 | |||
| 1185 | 641641997 | |||
| 1186 | 643601343 | |||
| 1187 | 8002395602 | |||
| 1188 | 8022632043 | |||
| 1189 | 8022654559 | |||
| 1190 | 8045868898 | |||
| 1191 | 8046773407 | |||
| 1192 | 8048748705 | |||
| 1193 | 8054283859 | |||
| 1194 | 8055036369 | |||
| 1195 | 8056976675 | |||
| 1196 | 8057738649 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4u00-assembly1.cif.gz_A | crystal structure of ttha1159 in complex with adp | 0.9906 | 2 | 241 |
| 4yms-assembly1.cif.gz_A | crystal structure of an amino acid abc transporter | 0.9888 | 1 | 240 |
| 4yms-assembly1.cif.gz_A | crystal structure of an amino acid abc transporter | 0.9847 | 1 | 240 |
| 4u00-assembly1.cif.gz_A | crystal structure of ttha1159 in complex with adp | 0.9784 | 2 | 241 |
| 3c41-assembly1.cif.gz_K | abc protein artp in complex with amp-pnp/mg2+ | 0.9773 | 1 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ymtJ00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9885 | 1 | 240 | 3.40.50.300 |
| 4ymtJ00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9845 | 1 | 240 | 3.40.50.300 |
| af_P0AAF6_1_241_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9561 | 2 | 236 | 3.40.50.300 |
| 2pclA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9522 | 1 | 219 | 3.40.50.300 |
| af_Q58762_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9518 | 1 | 236 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Y8J269-F1-model_v4 | deleted | 0.9985 | 1 | 212 |
|
| AF-A0A2T5G7R1-F1-model_v4 | Glutamine transport ATP-binding protein GlnQ | 0.9984 | 1 | 239 |
GO:0005524
GO:0015424 GO:0016887 |
| AF-A0A8B2V9U2-F1-model_v4 | deleted | 0.9982 | 1 | 239 |
|
| AF-A0A0H5Q9M2-F1-model_v4 | Glutamate transport ATP-binding protein | 0.998 | 1 | 239 |
GO:0005524
GO:0005886 GO:0015424 GO:0016887 |
| AF-A0A1F0F7W3-F1-model_v4 | Polar amino acid ABC transporter ATP-binding protein | 0.998 | 1 | 210 |
GO:0005524
GO:0005886 GO:0015424 GO:0016887 |