F467796

General Info

Members Datasets Scaffolds Average Seq Length
598 409 1196 248

Family's Representative Sequence

Representative Sequence 3300027471|Ga0209995_1011499|Ga0209995_10114991
Length 292
Sequence MMFRQLRFEHSCKSACNQFGKVAVAKDLCSYSMPVRNLQSSGPCDTHIVAVIEFRKVNKWFGPLQVLKDIDLTVDAGNVVVVCGPSGSGKSTLIRCINRLETIQSGDIIVDGRSVCDARLDAASLRANVGMVFQSFNLYPHMTVLDNITLAPLKVKRLSSAEAQKIATGLLDRVGIPDKANAYPANLSGGQQQRVAIARALAMKPKIMLFDEPTSALDPEMINEVLEVMTDLARDGMTMVVVTHEMGFARRVADRVVFMDQGQIIEANKPENFFAAPESPRAQQFLSKILSH

Samples

Sample ID Description Type Environment
1 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
167 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
195 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
200 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
201 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
202 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
203 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
210 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
211 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
215 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
216 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
217 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
220 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
224 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
241 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
249 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
252 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
253 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
254 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
255 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
256 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
257 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
272 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
273 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
300 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
301 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
302 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
311 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
312 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
313 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
314 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
317 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
321 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
322 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
323 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
324 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
325 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
326 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
327 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
330 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
331 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
332 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
333 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
334 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
335 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
336 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
337 2643221569 Achromobacter sp. Root565 Isolate Unclassified
338 2643221594 Achromobacter sp. Root170 Isolate Unclassified
339 2643221621 Achromobacter sp. Root83 Isolate Unclassified
340 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
341 2643221688 Rhizobium sp. Root482 Isolate Unclassified
342 2643221736 Bosea sp. Root483D1 Isolate Unclassified
343 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
344 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
345 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
346 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
347 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
348 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
349 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
350 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
351 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
352 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
353 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
354 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
355 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
356 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
357 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
358 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
359 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
360 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
361 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
362 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
363 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
364 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
365 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
366 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
367 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
368 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
369 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
370 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
371 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
372 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
373 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
374 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
375 2909042592 Labrys sp. LIt4 Isolate Nodule
376 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
377 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
378 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
379 2919726948 Bacillus pumilus 4489 Isolate Unclassified
380 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
381 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
382 2932401849 Devosia sp. 2618 Isolate Rhizosphere
383 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
384 2941479691
385 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
386 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
387 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
388 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
389 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
390 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
391 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
392 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
393 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
394 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
395 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
396 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
397 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
398 641522639 Methylobacterium sp. 4-46 Isolate Nodule
399 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
400 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
401 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
402 8022653035 Bacillus sp. Rc4 Isolate Unclassified
403 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
404 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
405 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
406 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
407 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
408 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
409 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.79
Metatranscriptomes 0
Isolates 14.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.35
Nodule 2.01
Rhizoplane 4.01
Rhizosphere 74.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209995_1011499 3300027471 Bacteria 1439
2 JGI25155J39150_1000229 3300002704 Bacteria 22119
3 JGI25156J39149_1003302 3300002705 Bacteria 5339
4 JGI25154J39366_1000511 3300002738 Bacteria 19768
5 JGI25157J39369_1004131 3300002741 Bacteria 2717
6 JGI25151J46595_10000095 3300003187 Bacteria 118630
7 JGI25151J46595_10000318 3300003187 Bacteria 52064
8 Ga0055538_1000024 3300003751 Bacteria 241526
9 Ga0055526_1000249 3300003771 Bacteria 45798
10 Ga0055524_1000043 3300003775 Bacteria 152518
11 Ga0065714_10067678 3300005288 Bacteria 5290
12 Ga0065704_10013198 3300005289 Bacteria 2076
13 Ga0065715_10000426 3300005293 Bacteria 19372
14 Ga0065715_10009394 3300005293 Bacteria 5401
15 Ga0065707_10098051 3300005295 Bacteria 3117
16 Ga0070690_100001728 3300005330 Bacteria 11534
17 Ga0070670_100000241 3300005331 Bacteria 49604
18 Ga0068869_100065337 3300005334 Bacteria 2678
19 Ga0070666_10006590 3300005335 Bacteria 7137
20 Ga0070666_10023588 3300005335 Bacteria 4005
21 Ga0070666_10330185 3300005335 Bacteria 1089
22 Ga0070680_100055288 3300005336 Bacteria 3243
23 Ga0070682_100027582 3300005337 Bacteria 3409
24 Ga0068868_100032140 3300005338 Bacteria 4036
25 Ga0070691_10003903 3300005341 Bacteria 6747
26 Ga0070687_100140713 3300005343 Bacteria 1405
27 Ga0070661_100064324 3300005344 Bacteria 2695
28 Ga0070661_100108327 3300005344 Bacteria 2073
29 Ga0070661_100298825 3300005344 Bacteria 1253
30 Ga0070668_100280882 3300005347 Bacteria 1390
31 Ga0070669_100062838 3300005353 Bacteria 2731
32 Ga0070675_100015962 3300005354 Bacteria 5950
33 Ga0070671_100003162 3300005355 Bacteria 12839
34 Ga0070671_100123386 3300005355 Bacteria 2180
35 Ga0070671_100606094 3300005355 Bacteria 946
36 Ga0070673_100009896 3300005364 Bacteria 6424
37 Ga0070673_100016661 3300005364 Bacteria 5204
38 Ga0070673_100169713 3300005364 Bacteria 1861
39 Ga0070673_100602672 3300005364 Bacteria 1002
40 Ga0070667_100009817 3300005367 Bacteria 7934
41 Ga0070667_100038018 3300005367 Bacteria 4036
42 Ga0070667_100386595 3300005367 Bacteria 1272
43 Ga0070714_100068229 3300005435 Bacteria 3068
44 Ga0070713_100118514 3300005436 Bacteria 2318
45 Ga0070700_100093866 3300005441 Bacteria 1964
46 Ga0070663_100019625 3300005455 Bacteria 4461
47 Ga0070663_100050570 3300005455 Bacteria 2957
48 Ga0070678_100094092 3300005456 Bacteria 2306
49 Ga0070681_10007675 3300005458 Bacteria 10552
50 Ga0070681_10019365 3300005458 Bacteria 6811
51 Ga0068867_100226451 3300005459 Bacteria 1509
52 Ga0068867_100249872 3300005459 Bacteria 1442
53 Ga0070706_100126446 3300005467 Bacteria 2384
54 Ga0070707_100011228 3300005468 Bacteria 8347
55 Ga0070707_100025476 3300005468 Bacteria 5611
56 Ga0070679_100050772 3300005530 Bacteria 4131
57 Ga0070679_100088679 3300005530 Bacteria 3080
58 Ga0070679_100419173 3300005530 Bacteria 1284
59 Ga0070697_100031141 3300005536 Bacteria 4289
60 Ga0070672_100043746 3300005543 Bacteria 3456
61 Ga0070672_100055242 3300005543 Bacteria 3110
62 Ga0070672_100073479 3300005543 Bacteria 2725
63 Ga0070686_100069349 3300005544 Bacteria 2303
64 Ga0070686_100317162 3300005544 Bacteria 1161
65 Ga0070695_100017441 3300005545 Bacteria 4353
66 Ga0070696_100031376 3300005546 Bacteria 3641
67 Ga0070665_100003905 3300005548 Bacteria 15758
68 Ga0068855_100000235 3300005563 Bacteria 70600
69 Ga0068855_100005884 3300005563 Bacteria 14957
70 Ga0068855_100045149 3300005563 Bacteria 5211
71 Ga0068855_100336100 3300005563 Bacteria 1666
72 Ga0070664_100001253 3300005564 Bacteria 20319
73 Ga0070664_100037578 3300005564 Bacteria 4071
74 Ga0068857_100321719 3300005577 Bacteria 1429
75 Ga0068854_100033253 3300005578 Bacteria 3595
76 Ga0068854_100049200 3300005578 Bacteria 3010
77 Ga0068856_100007513 3300005614 Bacteria 10641
78 Ga0070702_100168334 3300005615 Bacteria 1423
79 Ga0068866_10158450 3300005718 Bacteria 1318
80 Ga0068866_10307548 3300005718 Bacteria 992
81 Ga0068851_10116864 3300005834 Bacteria 1430
82 Ga0068863_100662197 3300005841 Bacteria 1036
83 Ga0068858_100052331 3300005842 Bacteria 3778
84 Ga0068860_100078904 3300005843 Bacteria 3131
85 Ga0075365_10313104 3300006038 Bacteria 1105
86 Ga0075368_10018116 3300006042 Bacteria 2643
87 Ga0075363_100133742 3300006048 Bacteria 1392
88 Ga0075364_10041702 3300006051 Bacteria 2981
89 Ga0075432_10003120 3300006058 Bacteria 5599
90 Ga0070716_100154194 3300006173 Bacteria 1481
91 Ga0075369_10035098 3300006186 Bacteria 2130
92 Ga0075366_10002900 3300006195 Bacteria 8906
93 Ga0075366_10026350 3300006195 Bacteria 3404
94 Ga0097621_100257266 3300006237 Bacteria 1531
95 Ga0075370_10039197 3300006353 Bacteria 2668
96 Ga0075428_100434147 3300006844 Bacteria 1407
97 Ga0075431_100026024 3300006847 Bacteria 5998
98 Ga0075431_100195359 3300006847 Bacteria 2072
99 Ga0075431_100282471 3300006847 Bacteria 1680
100 Ga0075433_10084026 3300006852 Bacteria 2810
101 Ga0075433_10132243 3300006852 Bacteria 2217
102 Ga0075433_10187925 3300006852 Bacteria 1838
103 Ga0075434_100000912 3300006871 Bacteria 23726
104 Ga0075434_100003395 3300006871 Bacteria 14264
105 Ga0075434_100053087 3300006871 Bacteria 4028
106 Ga0075434_100113809 3300006871 Bacteria 2718
107 Ga0068865_100072944 3300006881 Bacteria 2440
108 Ga0075436_100005072 3300006914 Bacteria 9064
109 Ga0075436_100137224 3300006914 Bacteria 1718
110 Ga0099826_10000111 3300006948 Bacteria 38073
111 Ga0099794_10218042 3300007265 Bacteria 979
112 Ga0105251_10001709 3300009011 Bacteria 18381
113 Ga0105244_10085698 3300009036 Bacteria 1554
114 Ga0105250_10059492 3300009092 Bacteria 1534
115 Ga0105250_10079229 3300009092 Bacteria 1331
116 Ga0111539_10254829 3300009094 Bacteria 2043
117 Ga0111539_10601240 3300009094 Bacteria 1281
118 Ga0105245_10028254 3300009098 Bacteria 4945
119 Ga0105245_10256027 3300009098 Bacteria 1702
120 Ga0114129_10046851 3300009147 Bacteria 6076
121 Ga0114129_10117245 3300009147 Bacteria 3669
122 Ga0105243_10025532 3300009148 Bacteria 4516
123 Ga0105241_10009789 3300009174 Bacteria 7044
124 Ga0105242_10038460 3300009176 Bacteria 3847
125 Ga0105242_10252814 3300009176 Bacteria 1589
126 Ga0105248_10001597 3300009177 Bacteria 25193
127 Ga0105248_10029885 3300009177 Bacteria 6081
128 Ga0105248_10201612 3300009177 Bacteria 2242
129 Ga0105248_10581094 3300009177 Bacteria 1264
130 Ga0105237_10039387 3300009545 Bacteria 4771
131 Ga0105237_10111120 3300009545 Bacteria 2732
132 Ga0105237_10593508 3300009545 Bacteria 1114
133 Ga0105238_10000113 3300009551 Bacteria 89675
134 Ga0105238_10058573 3300009551 Bacteria 3860
135 Ga0105238_10105126 3300009551 Bacteria 2805
136 Ga0105238_10299803 3300009551 Bacteria 1591
137 Ga0105249_10073334 3300009553 Bacteria 3167
138 Ga0105249_10447338 3300009553 Bacteria 1330
139 Ga0105239_10001563 3300010375 Bacteria 30254
140 Ga0105239_10017697 3300010375 Bacteria 7885
141 Ga0105239_10262397 3300010375 Bacteria 1941
142 Ga0105246_10010742 3300011119 Bacteria 5674
143 Ga0105246_10018015 3300011119 Bacteria 4498
144 Ga0105246_10152400 3300011119 Bacteria 1751
145 Ga0157319_1001881 3300012497 Bacteria 1141
146 Ga0157373_10092948 3300013100 Bacteria 2124
147 Ga0157373_10161683 3300013100 Bacteria 1576
148 Ga0157371_10166634 3300013102 Bacteria 1573
149 Ga0157370_10284202 3300013104 Bacteria 1528
150 Ga0171462_1012 3300013250 Bacteria 208216
151 Ga0157378_10187876 3300013297 Bacteria 1947
152 Ga0163162_10001128 3300013306 Bacteria 24861
153 Ga0163162_10017943 3300013306 Bacteria 6925
154 Ga0163162_10115131 3300013306 Bacteria 2789
155 Ga0163162_10233793 3300013306 Bacteria 1969
156 Ga0157372_10032766 3300013307 Bacteria 5701
157 Ga0157372_10047601 3300013307 Bacteria 4765
158 Ga0157375_10001058 3300013308 Bacteria 23752
159 Ga0157375_10107199 3300013308 Bacteria 2887
160 Ga0157375_10219956 3300013308 Bacteria 2057
161 Ga0157380_10005138 3300014326 Bacteria 9145
162 Ga0157376_10010980 3300014969 Bacteria 6654
163 Ga0182006_1000245 3300015261 Bacteria 50641
164 Ga0182007_10001008 3300015262 Bacteria 15430
165 Ga0209435_100124 3300025206 Bacteria 27904
166 Ga0209646_1000238 3300025246 Bacteria 57384
167 Ga0209026_1003975 3300025250 Bacteria 4614
168 Ga0209759_1000921 3300025256 Bacteria 21615
169 Ga0209130_1001190 3300025284 Bacteria 18542
170 Ga0209676_1008189 3300025292 Bacteria 4717
171 Ga0209025_1000429 3300025294 Bacteria 83306
172 Ga0209564_1000041 3300025295 Bacteria 405199
173 Ga0209564_1008314 3300025295 Bacteria 5142
174 Ga0209758_1002010 3300025297 Bacteria 21870
175 Ga0209050_1001827 3300025298 Bacteria 20722
176 Ga0209050_1016676 3300025298 Bacteria 2987
177 Ga0209256_1000014 3300025299 Bacteria 687409
178 Ga0207426_1000085 3300025302 Bacteria 293171
179 Ga0209051_1009097 3300025303 Bacteria 5160
180 Ga0207697_10008134 3300025315 Bacteria 4618
181 Ga0207697_10022284 3300025315 Bacteria 2594
182 Ga0207656_10086379 3300025321 Bacteria 1417
183 Ga0207656_10135133 3300025321 Bacteria 1158
184 Ga0207696_1099331 3300025711 Bacteria 793
185 Ga0207713_1003781 3300025735 Bacteria 10149
186 Ga0207642_10250366 3300025899 Bacteria 1005
187 Ga0207688_10004542 3300025901 Bacteria 7557
188 Ga0207688_10014828 3300025901 Bacteria 4229
189 Ga0207680_10003765 3300025903 Bacteria 7140
190 Ga0207680_10207096 3300025903 Bacteria 1339
191 Ga0207647_10045724 3300025904 Bacteria 2730
192 Ga0207647_10232048 3300025904 Bacteria 1062
193 Ga0207645_10020234 3300025907 Bacteria 4359
194 Ga0207707_10032009 3300025912 Bacteria 4604
195 Ga0207695_10002110 3300025913 Bacteria 30178
196 Ga0207671_10001053 3300025914 Bacteria 33415
197 Ga0207671_10124001 3300025914 Bacteria 1977
198 Ga0207693_10154107 3300025915 Bacteria 1808
199 Ga0207660_10025398 3300025917 Bacteria 4020
200 Ga0207657_10002201 3300025919 Bacteria 21128
201 Ga0207649_10186349 3300025920 Bacteria 1456
202 Ga0207649_10297588 3300025920 Bacteria 1179
203 Ga0207652_10052510 3300025921 Bacteria 3499
204 Ga0207652_10362267 3300025921 Bacteria 1309
205 Ga0207646_10065881 3300025922 Bacteria 3233
206 Ga0207681_10022576 3300025923 Bacteria 4015
207 Ga0207681_10485962 3300025923 Bacteria 1009
208 Ga0207694_10000075 3300025924 Bacteria 114693
209 Ga0207694_10100159 3300025924 Bacteria 2295
210 Ga0207694_10402529 3300025924 Bacteria 1138
211 Ga0207650_10001805 3300025925 Bacteria 15135
212 Ga0207659_10208975 3300025926 Bacteria 1563
213 Ga0207687_10393465 3300025927 Bacteria 1138
214 Ga0207664_10104432 3300025929 Bacteria 2346
215 Ga0207690_10012404 3300025932 Bacteria 5096
216 Ga0207706_10002107 3300025933 Bacteria 19464
217 Ga0207686_10175927 3300025934 Bacteria 1513
218 Ga0207669_10184266 3300025937 Bacteria 1500
219 Ga0207665_10124210 3300025939 Bacteria 1826
220 Ga0207691_10008329 3300025940 Bacteria 9957
221 Ga0207691_10061325 3300025940 Bacteria 3417
222 Ga0207711_10005820 3300025941 Bacteria 10412
223 Ga0207711_10015929 3300025941 Bacteria 6235
224 Ga0207689_10056084 3300025942 Bacteria 3242
225 Ga0207679_10016389 3300025945 Bacteria 4921
226 Ga0207667_10000110 3300025949 Bacteria 131872
227 Ga0207667_10006885 3300025949 Bacteria 13735
228 Ga0207667_10018717 3300025949 Bacteria 7758
229 Ga0207667_10480648 3300025949 Bacteria 1261
230 Ga0207651_10134326 3300025960 Bacteria 1900
231 Ga0207712_10358754 3300025961 Bacteria 1214
232 Ga0207640_10009174 3300025981 Bacteria 5526
233 Ga0207658_10244664 3300025986 Bacteria 1521
234 Ga0207658_10323656 3300025986 Bacteria 1335
235 Ga0207677_10414542 3300026023 Bacteria 1145
236 Ga0207703_10274227 3300026035 Bacteria 1529
237 Ga0207703_10544347 3300026035 Bacteria 1094
238 Ga0207678_10006728 3300026067 Bacteria 10191
239 Ga0207678_10103002 3300026067 Bacteria 2437
240 Ga0207678_10107857 3300026067 Bacteria 2375
241 Ga0207708_10023099 3300026075 Bacteria 4698
242 Ga0207708_10027482 3300026075 Bacteria 4308
243 Ga0207702_10016597 3300026078 Bacteria 6093
244 Ga0207702_10082368 3300026078 Bacteria 2797
245 Ga0207702_10308948 3300026078 Bacteria 1503
246 Ga0207674_10058955 3300026116 Bacteria 3887
247 Ga0207683_10001733 3300026121 Bacteria 19431
248 Ga0207683_10022161 3300026121 Bacteria 5451
249 Ga0209973_1013537 3300027252 Bacteria 1007
250 Ga0209982_1000864 3300027552 Bacteria 3975
251 Ga0209970_1005183 3300027614 Bacteria 2153
252 Ga0210002_1001446 3300027617 Bacteria 3348
253 Ga0209983_1006509 3300027665 Bacteria 2397
254 Ga0209282_1000732 3300027666 Bacteria 16518
255 Ga0209998_10003754 3300027717 Bacteria 3287
256 Ga0209974_10003272 3300027876 Bacteria 5857
257 Ga0209974_10005507 3300027876 Bacteria 4450
258 Ga0209974_10007787 3300027876 Bacteria 3682
259 Ga0207428_10020006 3300027907 Bacteria 5701
260 Ga0268266_10005433 3300028379 Bacteria 11880
261 Ga0268266_10616305 3300028379 Bacteria 1043
262 Ga0268264_10074017 3300028381 Bacteria 2892
263 Ga0265330_10017135 3300031235 Bacteria 3339
264 Ga0265325_10015182 3300031241 Bacteria 4337
265 Ga0265339_10013765 3300031249 Bacteria 4896
266 Ga0307408_100180746 3300031548 Bacteria 1691
267 Ga0307408_100457746 3300031548 Bacteria 1108
268 Ga0265342_10067903 3300031712 Bacteria 2085
269 Ga0316576_10001641 3300031727 Bacteria 12249
270 Ga0307405_10080630 3300031731 Bacteria 2125
271 Ga0307405_10472443 3300031731 Bacteria 999
272 Ga0307413_10015212 3300031824 Bacteria 3936
273 Ga0307413_10045836 3300031824 Bacteria 2595
274 Ga0307410_10045319 3300031852 Bacteria 2927
275 Ga0307410_10064110 3300031852 Bacteria 2524
276 Ga0307410_10508339 3300031852 Bacteria 992
277 Ga0307406_10022045 3300031901 Bacteria 3775
278 Ga0307406_10219947 3300031901 Bacteria 1411
279 Ga0307407_10041710 3300031903 Bacteria 2568
280 Ga0307407_10079086 3300031903 Bacteria 1983
281 Ga0307407_10125158 3300031903 Bacteria 1636
282 Ga0307412_10007247 3300031911 Bacteria 6287
283 Ga0307412_10025051 3300031911 Bacteria 3690
284 Ga0307412_10061814 3300031911 Bacteria 2519
285 Ga0307412_10209542 3300031911 Bacteria 1486
286 Ga0307409_100014522 3300031995 Bacteria 5128
287 Ga0307409_100054396 3300031995 Bacteria 3082
288 Ga0307409_100288192 3300031995 Bacteria 1521
289 Ga0307409_100508467 3300031995 Bacteria 1174
290 Ga0307416_100069352 3300032002 Bacteria 2917
291 Ga0307416_100375443 3300032002 Bacteria 1450
292 Ga0307414_10047790 3300032004 Bacteria 2948
293 Ga0307415_100009625 3300032126 Bacteria 5431
294 Ga0316580_10097353 3300032139 Bacteria 901
295 Ga0373940_0072746 3300035088 Bacteria 1004
296 Ga0373956_0043945 3300035119 Bacteria 1990
297 Ga0373931_0222278 3300035691 Bacteria 1137
298 Ga0373927_0371959 3300035695 Bacteria 942
299 Ga0373937_0317772 3300036401 Bacteria 1473
300 Ga0316582_0002253 3300036647 Bacteria 8981
301 Ga0316582_0059315 3300036647 Bacteria 2450
302 Ga0316584_0004012 3300036712 Bacteria 9688
303 Ga0316584_0061397 3300036712 Bacteria 2814
304 Ga0316584_0173116 3300036712 Bacteria 1600
305 Ga0395900_0003258 3300037418 Bacteria 17580
306 Ga0395905_0125367 3300037471 Bacteria 2415
307 Ga0395901_0462636 3300038443 Bacteria 1296
308 Ga0439431_0017370 3300041997 Bacteria 1691
309 Ga0439452_000046 3300042010 Bacteria 130842
310 Ga0439456_013399 3300042013 Bacteria 1706
311 Ga0439434_0005016 3300042435 Bacteria 3871
312 Ga0450901_000920 3300042533 Bacteria 3443
313 Ga0451577_0000068 3300042876 Bacteria 241923
314 Ga0451577_0621428 3300042876 Bacteria 980
315 Ga0466972_0146165 3300044658 Bacteria 1112
316 Ga0466965_0305061 3300044683 Bacteria 865
317 Ga0451576_0049550 3300045051 Bacteria 4408
318 Ga0451576_0062156 3300045051 Bacteria 3894
319 Ga0451576_0654731 3300045051 Bacteria 1104
320 Ga0451576_0762095 3300045051 Bacteria 1016
321 Ga0466967_0277776 3300045976 Bacteria 1606
322 Ga0466967_0340526 3300045976 Bacteria 1450
323 Ga0495627_014592 3300046453 Bacteria 2737
324 Ga0495590_0002665 3300046457 Bacteria 7378
325 Ga0495591_000144 3300046458 Bacteria 75817
326 Ga0495629_0217576 3300046459 Bacteria 1318
327 Ga0495653_0003314 3300046463 Bacteria 12931
328 Ga0495605_0005803 3300046474 Bacteria 7144
329 Ga0495605_0170437 3300046474 Bacteria 962
330 Ga0495584_0094867 3300046491 Bacteria 1506
331 Ga0495596_0112154 3300046500 Bacteria 1059
332 Ga0495607_0002089 3300046501 Bacteria 16681
333 Ga0495607_0004246 3300046501 Bacteria 10621
334 Ga0495607_0010943 3300046501 Bacteria 6068
335 Ga0495606_0000990 3300046507 Bacteria 41399
336 Ga0495606_0032733 3300046507 Bacteria 3597
337 Ga0495610_0007209 3300046512 Bacteria 7462
338 Ga0495610_0008769 3300046512 Bacteria 6493
339 Ga0495610_0011039 3300046512 Bacteria 5553
340 Ga0495620_0000065 3300046515 Bacteria 90842
341 Ga0495620_0005571 3300046515 Bacteria 7018
342 Ga0495628_0002680 3300046516 Bacteria 15934
343 Ga0495630_0001625 3300046517 Bacteria 15627
344 Ga0495632_0000421 3300046519 Bacteria 40149
345 Ga0495637_0029051 3300046520 Bacteria 2464
346 Ga0495643_0002355 3300046522 Bacteria 15142
347 Ga0495642_0005038 3300046528 Bacteria 5089
348 Ga0495652_0001468 3300046529 Bacteria 26039
349 Ga0495652_0263252 3300046529 Bacteria 1272
350 Ga0495654_0092122 3300046530 Bacteria 1405
351 Ga0495665_0000184 3300046531 Bacteria 31944
352 Ga0495587_0012602 3300046536 Bacteria 5317
353 Ga0495597_0006750 3300046542 Bacteria 5908
354 Ga0495597_0054633 3300046542 Bacteria 1753
355 Ga0495645_0011832 3300046543 Bacteria 6147
356 Ga0495635_0007577 3300046663 Bacteria 7574
357 Ga0495661_0000047 3300046665 Bacteria 146326
358 Ga0495588_0305420 3300046674 Bacteria 837
359 Ga0495599_0169126 3300046678 Bacteria 1349
360 Ga0495623_0001022 3300046679 Bacteria 18934
361 Ga0495669_0023296 3300046684 Bacteria 2694
362 Ga0495669_0102548 3300046684 Bacteria 1330
363 Ga0495670_0003366 3300046691 Bacteria 7866
364 Ga0495649_0292364 3300046694 Bacteria 831
365 Ga0495589_0000669 3300046794 Bacteria 22466
366 Ga0495589_0001077 3300046794 Bacteria 16294
367 Ga0495600_0078820 3300046809 Bacteria 2151
368 Ga0495600_0109330 3300046809 Bacteria 1800
369 Ga0495660_0048800 3300046810 Bacteria 2314
370 Ga0495581_0070940 3300047315 Bacteria 2016
371 Ga0495604_0002912 3300047317 Bacteria 13721
372 Ga0495674_0024236 3300047319 Bacteria 5579
373 Ga0495680_0020202 3300047322 Bacteria 5609
374 Ga0495683_0001566 3300047323 Bacteria 14818
375 Ga0495687_000005 3300047443 Bacteria 610401
376 Ga0495675_0014062 3300047444 Bacteria 5059
377 Ga0495679_000674 3300047446 Bacteria 22384
378 Ga0495679_020367 3300047446 Bacteria 2311
379 Ga0495685_033324 3300047447 Bacteria 1770
380 Ga0495673_0098907 3300047469 Bacteria 1182
381 Ga0495681_0001120 3300047470 Bacteria 20319
382 Ga0495681_0008370 3300047470 Bacteria 6493
383 Ga0495681_0009690 3300047470 Bacteria 5905
384 Ga0495593_0005628 3300047673 Bacteria 7395
385 Ga0495602_0001075 3300048088 Bacteria 26813
386 Ga0495626_0130360 3300048091 Bacteria 1074
387 Ga0496100_0040757 3300048903 Bacteria 2957
388 Ga0496100_0252008 3300048903 Bacteria 1306
389 Ga0496101_0006058 3300048904 Bacteria 7760
390 Ga0496102_0002576 3300048905 Bacteria 15461
391 Ga0496102_0368929 3300048905 Bacteria 1351
392 Ga0496103_0053703 3300048906 Bacteria 2497
393 Ga0496103_0065993 3300048906 Bacteria 2258
394 Ga0496104_0025327 3300048907 Bacteria 5469
395 Ga0496104_0489109 3300048907 Bacteria 1142
396 Ga0496105_0245484 3300048908 Bacteria 1452
397 Ga0496105_0284961 3300048908 Bacteria 1331
398 Ga0496107_0022464 3300048910 Bacteria 4458
399 Ga0496107_0164597 3300048910 Bacteria 1644
400 Ga0496108_0588166 3300048911 Bacteria 970
401 Ga0496110_0003254 3300048913 Bacteria 12382
402 Ga0496111_0516318 3300048914 Bacteria 879
403 Ga0496112_0002364 3300048915 Bacteria 15157
404 Ga0496112_0069699 3300048915 Bacteria 3473
405 Ga0496113_0001917 3300048916 Bacteria 11882
406 Ga0496113_0178186 3300048916 Bacteria 1685
407 Ga0496115_0027633 3300048918 Bacteria 4441
408 Ga0496115_0128763 3300048918 Bacteria 2086
409 Ga0496116_0002577 3300048919 Bacteria 18879
410 Ga0496116_0020483 3300048919 Bacteria 5021
411 Ga0496116_0149677 3300048919 Bacteria 1299
412 Ga0496117_0018750 3300048920 Bacteria 5714
413 Ga0496118_0145091 3300048921 Bacteria 1496
414 Ga0496121_0000100 3300048924 Bacteria 198641
415 Ga0496121_0011781 3300048924 Bacteria 9644
416 Ga0496121_0040642 3300048924 Bacteria 4076
417 Ga0496121_0095257 3300048924 Bacteria 2314
418 Ga0496121_0102919 3300048924 Bacteria 2198
419 Ga0496122_0004972 3300048925 Bacteria 16086
420 Ga0496122_0006588 3300048925 Bacteria 13254
421 Ga0496122_0194543 3300048925 Bacteria 1193
422 Ga0496123_0003372 3300048926 Bacteria 18061
423 Ga0496124_0002797 3300048927 Bacteria 22104
424 Ga0496124_0004561 3300048927 Bacteria 16098
425 Ga0496124_0050893 3300048927 Bacteria 3526
426 Ga0496125_0005929 3300048928 Bacteria 13386
427 Ga0496125_0011406 3300048928 Bacteria 8890
428 Ga0496125_0013098 3300048928 Bacteria 8177
429 Ga0496125_0050941 3300048928 Bacteria 3421
430 Ga0496126_0001145 3300048929 Bacteria 44005
431 Ga0496126_0048630 3300048929 Bacteria 3874
432 Ga0496126_0085248 3300048929 Bacteria 2785
433 Ga0501033_0068078 3300049570 Bacteria 2618
434 Ga0501033_0070443 3300049570 Bacteria 2569
435 Ga0501034_0205845 3300049571 Bacteria 1924
436 Ga0501034_0218713 3300049571 Bacteria 1858
437 Ga0501034_0273426 3300049571 Bacteria 1630
438 Ga0501036_0047235 3300049572 Bacteria 3646
439 Ga0501036_0364544 3300049572 Bacteria 1206
440 Ga0501037_0015751 3300049573 Bacteria 5564
441 Ga0501038_0002511 3300049574 Bacteria 17093
442 Ga0501039_0001556 3300049575 Bacteria 16876
443 Ga0501040_0003219 3300049576 Bacteria 10561
444 Ga0501041_0000212 3300049577 Bacteria 26965
445 Ga0501042_0000098 3300049578 Bacteria 34576
446 Ga0501043_0188310 3300049579 Bacteria 1606
447 Ga0501043_0196687 3300049579 Bacteria 1566
448 Ga0501046_0015300 3300049580 Bacteria 6451
449 Ga0501047_0089084 3300049581 Bacteria 2963
450 Ga0501048_0004806 3300049582 Bacteria 10296
451 Ga0501069_0063037 3300049585 Bacteria 2070
452 Ga0501070_0017605 3300049586 Bacteria 5999
453 Ga0501070_0531285 3300049586 Bacteria 943
454 Ga0501071_0000452 3300049587 Bacteria 20662
455 Ga0501072_0044935 3300049588 Bacteria 3472
456 Ga0501072_0255965 3300049588 Bacteria 1394
457 Ga0501073_0013088 3300049589 Bacteria 6052
458 Ga0501073_0034857 3300049589 Bacteria 3580
459 Ga0501073_0176678 3300049589 Bacteria 1478
460 Ga0501073_0219077 3300049589 Bacteria 1315
461 Ga0501074_0004506 3300049590 Bacteria 9974
462 Ga0501074_0023654 3300049590 Bacteria 4465
463 Ga0501075_0000095 3300049591 Bacteria 40804
464 Ga0501076_0000386 3300049592 Bacteria 27579
465 Ga0501077_0000670 3300049593 Bacteria 20698
466 Ga0501217_076390 3300049661 Bacteria 920
467 Ga0501079_0001514 3300049741 Bacteria 16455
468 Ga0501080_0097373 3300049742 Bacteria 2731
469 Ga0501081_0000063 3300049743 Bacteria 41530
470 Ga0501083_0007185 3300049744 Bacteria 7908
471 Ga0501035_0118540 3300049822 Bacteria 2316
472 Ga0501044_0026894 3300049823 Bacteria 6089
473 Ga0501044_0079262 3300049823 Bacteria 3328
474 Ga0501045_0000186 3300049824 Bacteria 34725
475 nmdc:mga03n38_132249_c1 3300050490 Bacteria 1238
476 nmdc:mga00v17_13505_c2 3300050491 Bacteria 4157
477 nmdc:mga0yw44_282733_c1 3300050492 Bacteria 1109
478 nmdc:mga0yw44_306779_c1 3300050492 Bacteria 1064
479 nmdc:mga0k408_40516_c1 3300050493 Bacteria 2680
480 nmdc:mga0k408_5235_c1 3300050493 Bacteria 6887
481 nmdc:mga07m45_14313_c1 3300050496 Bacteria 4223
482 nmdc:mga05p37_113218_c1 3300050507 Bacteria 3336
483 nmdc:mga05p37_643123_c1 3300050507 Bacteria 1189
484 nmdc:mga09592_306117_c1 3300050508 Bacteria 1377
485 nmdc:mga06r32_262154_c1 3300050510 Bacteria 1716
486 nmdc:mga06r32_473266_c1 3300050510 Bacteria 1231
487 nmdc:mga08y16_100368_c1 3300050511 Bacteria 3013
488 nmdc:mga08y16_404359_c1 3300050511 Bacteria 1397
489 nmdc:mga08y16_94837_c1 3300050511 Bacteria 3108
490 nmdc:mga0n895_25810_c1 3300050512 Bacteria 5556
491 nmdc:mga0n895_31767_c1 3300050512 Bacteria 5059
492 nmdc:mga0n895_377049_c1 3300050512 Bacteria 1436
493 nmdc:mga0n895_613_c1 3300050512 Bacteria 24760
494 nmdc:mga0n895_659914_c1 3300050512 Bacteria 1044
495 nmdc:mga0rr50_61810_c1 3300050513 Bacteria 2823
496 nmdc:mga0rr50_94600_c1 3300050513 Bacteria 2334
497 nmdc:mga08x19_114342_c1 3300050514 Bacteria 1803
498 nmdc:mga08x19_21028_c1 3300050514 Bacteria 4025
499 nmdc:mga08x19_352653_c1 3300050514 Bacteria 1027
500 nmdc:mga0a205_17778_c1 3300050515 Bacteria 6671
501 nmdc:mga0a205_229939_c1 3300050515 Bacteria 1738
502 nmdc:mga0a205_258328_c1 3300050515 Bacteria 1620
503 nmdc:mga0a205_46558_c1 3300050515 Bacteria 4183
504 nmdc:mga0sz30_47029_c1 3300050516 Bacteria 1823
505 Ga0500643_008152 3300053087 Bacteria 4144
506 Ga0500566_0000210 3300053094 Bacteria 30847
507 Ga0500568_0000048 3300053139 Bacteria 119025
508 Ga0500568_0020221 3300053139 Bacteria 2883
509 Ga0500568_0022641 3300053139 Bacteria 2684
510 Ga0500616_0055893 3300053153 Bacteria 2062
511 Ga0501084_0000662 3300054114 Bacteria 26273
512 Ga0501082_0000921 3300060353 Bacteria 25918
513 Ga0530510_0381796 3300061734 Bacteria 1060
514 2509078542 2508501114 Bacteria 7082538
515 2511391173 2511231027 Bacteria 5013807
516 2511700415 2511231119 Bacteria 4019861
517 2521560528 2521172590 Bacteria 5047645
518 2599905929 2599185292 Bacteria 6290804
519 2599907820 2599185292 Bacteria 6290804
520 2643845765 2643221565 Bacteria 6216018
521 2643859083 2643221569 Bacteria 6064337
522 2643859890 2643221569 Bacteria 6064337
523 2643979180 2643221594 Bacteria 5811388
524 2643980087 2643221594 Bacteria 5811388
525 2644121224 2643221621 Bacteria 6212786
526 2644122950 2643221621 Bacteria 6212786
527 2644153838 2643221627 Bacteria 6761570
528 2644492754 2643221688 Bacteria 5260751
529 2644743064 2643221736 Bacteria 6608466
530 2651531710 2648501850 Bacteria 3975476
531 2686997642 2684623153 Bacteria 3878815
532 2695628405 2695420354 Bacteria 3922431
533 2739612591 2739367655 Bacteria 4051151
534 2739613731 2739367655 Bacteria 4051151
535 2758638217 2758568016 Bacteria 5645291
536 2776266116 2775506901 Bacteria 9631051
537 2809033811 2808606395 Bacteria 6020352
538 2809036053 2808606395 Bacteria 6020352
539 2809055615 2808606399 Bacteria 4021018
540 2819617213 2818991449 Bacteria 5518009
541 2837681732 2837678835 Bacteria 5252418
542 2838079886 2838074704 Bacteria 6785777
543 2842874104 2842871566 Bacteria 4827117
544 2844322666 2844315083 Bacteria 8138177
545 2844535060 2844533157 Bacteria 7517899
546 2852392330 2852387548 Bacteria 8025568
547 2854896654 2854896431 Bacteria 5869725
548 2857533350 2857531043 Bacteria 6754041
549 2857539719 2857537821 Bacteria 5248181
550 2876378120 2876377896 Bacteria 6565995
551 2876766077 2876761206 Bacteria 10111113
552 2877771302 2877768649 Bacteria 3957164
553 2880172169 2880169592 Bacteria 3900066
554 2889298428 2889295896 Bacteria 4704906
555 2897112444 2897109615 Bacteria 4009619
556 2897809667 2897803580 Bacteria 7000062
557 2903734819 2903727486 Bacteria 8281579
558 2904442851 2904439833 Bacteria 5931679
559 2904534952 2904530477 Bacteria 5876334
560 2904588709 2904584206 Bacteria 6028872
561 2904594217 2904589729 Bacteria 6113573
562 2904604942 2904601388 Bacteria 5884906
563 2906604870 2906602504 Bacteria 8295279
564 2909047787 2909042592 Bacteria 6499737
565 2919048651 2919046199 Bacteria 5567169
566 2919055512 2919055335 Bacteria 3875751
567 2919083178 2919079590 Bacteria 5946433
568 2919728545 2919726948 Bacteria 3696050
569 2928133034 2928130867 Bacteria 5467269
570 2928525185 2928521798 Bacteria 4960112
571 2932404049 2932401849 Bacteria 4262978
572 2932801578 2932794094 Bacteria 7915132
573 2941484926
574 2945962943 2945961074 Bacteria 7342064
575 2954011275 2954011201 Bacteria 4762601
576 2981289175 2981284811 Bacteria 4641497
577 2981293991 2981289755 Bacteria 4641509
578 2981984754 2981980479 Bacteria 4641628
579 2981989682 2981985349 Bacteria 4641497
580 2995727661 2995726249 Bacteria 3470435
581 3002145492 3002141150 Bacteria 5254435
582 3005409946 3005409236 Bacteria 7188837
583 3005602740 3005594810 Bacteria 8716512
584 3005725212 3005718088 Bacteria 8283608
585 3006882443 3006879489 Bacteria 4064221
586 3006985803 3006984091 Bacteria 4207523
587 641641997 641522639 Bacteria 7737025
588 643601343 643348564 Bacteria 8839022
589 8002395602 8002392321 Bacteria 4159911
590 8022632043 8022630665 Bacteria 3886130
591 8022654559 8022653035 Bacteria 4035078
592 8045868898 8045864390 Bacteria 5043873
593 8046773407 8046767195 Bacteria 7547379
594 8048748705 8048746797 Bacteria 3557226
595 8054283859 8054280661 Bacteria 4232245
596 8055036369 8055034563 Bacteria 3562128
597 8056976675 8056967851 Bacteria 9038162
598 8057738649 8057733483 Bacteria 6578323
599 Ga0209995_1011499
600 JGI25155J39150_1000229
601 JGI25156J39149_1003302
602 JGI25154J39366_1000511
603 JGI25157J39369_1004131
604 JGI25151J46595_10000095
605 JGI25151J46595_10000318
606 Ga0055538_1000024
607 Ga0055526_1000249
608 Ga0055524_1000043
609 Ga0065714_10067678
610 Ga0065704_10013198
611 Ga0065715_10000426
612 Ga0065715_10009394
613 Ga0065707_10098051
614 Ga0070690_100001728
615 Ga0070670_100000241
616 Ga0068869_100065337
617 Ga0070666_10006590
618 Ga0070666_10023588
619 Ga0070666_10330185
620 Ga0070680_100055288
621 Ga0070682_100027582
622 Ga0068868_100032140
623 Ga0070691_10003903
624 Ga0070687_100140713
625 Ga0070661_100064324
626 Ga0070661_100108327
627 Ga0070661_100298825
628 Ga0070668_100280882
629 Ga0070669_100062838
630 Ga0070675_100015962
631 Ga0070671_100003162
632 Ga0070671_100123386
633 Ga0070671_100606094
634 Ga0070673_100009896
635 Ga0070673_100016661
636 Ga0070673_100169713
637 Ga0070673_100602672
638 Ga0070667_100009817
639 Ga0070667_100038018
640 Ga0070667_100386595
641 Ga0070714_100068229
642 Ga0070713_100118514
643 Ga0070700_100093866
644 Ga0070663_100019625
645 Ga0070663_100050570
646 Ga0070678_100094092
647 Ga0070681_10007675
648 Ga0070681_10019365
649 Ga0068867_100226451
650 Ga0068867_100249872
651 Ga0070706_100126446
652 Ga0070707_100011228
653 Ga0070707_100025476
654 Ga0070679_100050772
655 Ga0070679_100088679
656 Ga0070679_100419173
657 Ga0070697_100031141
658 Ga0070672_100043746
659 Ga0070672_100055242
660 Ga0070672_100073479
661 Ga0070686_100069349
662 Ga0070686_100317162
663 Ga0070695_100017441
664 Ga0070696_100031376
665 Ga0070665_100003905
666 Ga0068855_100000235
667 Ga0068855_100005884
668 Ga0068855_100045149
669 Ga0068855_100336100
670 Ga0070664_100001253
671 Ga0070664_100037578
672 Ga0068857_100321719
673 Ga0068854_100033253
674 Ga0068854_100049200
675 Ga0068856_100007513
676 Ga0070702_100168334
677 Ga0068866_10158450
678 Ga0068866_10307548
679 Ga0068851_10116864
680 Ga0068863_100662197
681 Ga0068858_100052331
682 Ga0068860_100078904
683 Ga0075365_10313104
684 Ga0075368_10018116
685 Ga0075363_100133742
686 Ga0075364_10041702
687 Ga0075432_10003120
688 Ga0070716_100154194
689 Ga0075369_10035098
690 Ga0075366_10002900
691 Ga0075366_10026350
692 Ga0097621_100257266
693 Ga0075370_10039197
694 Ga0075428_100434147
695 Ga0075431_100026024
696 Ga0075431_100195359
697 Ga0075431_100282471
698 Ga0075433_10084026
699 Ga0075433_10132243
700 Ga0075433_10187925
701 Ga0075434_100000912
702 Ga0075434_100003395
703 Ga0075434_100053087
704 Ga0075434_100113809
705 Ga0068865_100072944
706 Ga0075436_100005072
707 Ga0075436_100137224
708 Ga0099826_10000111
709 Ga0099794_10218042
710 Ga0105251_10001709
711 Ga0105244_10085698
712 Ga0105250_10059492
713 Ga0105250_10079229
714 Ga0111539_10254829
715 Ga0111539_10601240
716 Ga0105245_10028254
717 Ga0105245_10256027
718 Ga0114129_10046851
719 Ga0114129_10117245
720 Ga0105243_10025532
721 Ga0105241_10009789
722 Ga0105242_10038460
723 Ga0105242_10252814
724 Ga0105248_10001597
725 Ga0105248_10029885
726 Ga0105248_10201612
727 Ga0105248_10581094
728 Ga0105237_10039387
729 Ga0105237_10111120
730 Ga0105237_10593508
731 Ga0105238_10000113
732 Ga0105238_10058573
733 Ga0105238_10105126
734 Ga0105238_10299803
735 Ga0105249_10073334
736 Ga0105249_10447338
737 Ga0105239_10001563
738 Ga0105239_10017697
739 Ga0105239_10262397
740 Ga0105246_10010742
741 Ga0105246_10018015
742 Ga0105246_10152400
743 Ga0157319_1001881
744 Ga0157373_10092948
745 Ga0157373_10161683
746 Ga0157371_10166634
747 Ga0157370_10284202
748 Ga0171462_1012
749 Ga0157378_10187876
750 Ga0163162_10001128
751 Ga0163162_10017943
752 Ga0163162_10115131
753 Ga0163162_10233793
754 Ga0157372_10032766
755 Ga0157372_10047601
756 Ga0157375_10001058
757 Ga0157375_10107199
758 Ga0157375_10219956
759 Ga0157380_10005138
760 Ga0157376_10010980
761 Ga0182006_1000245
762 Ga0182007_10001008
763 Ga0209435_100124
764 Ga0209646_1000238
765 Ga0209026_1003975
766 Ga0209759_1000921
767 Ga0209130_1001190
768 Ga0209676_1008189
769 Ga0209025_1000429
770 Ga0209564_1000041
771 Ga0209564_1008314
772 Ga0209758_1002010
773 Ga0209050_1001827
774 Ga0209050_1016676
775 Ga0209256_1000014
776 Ga0207426_1000085
777 Ga0209051_1009097
778 Ga0207697_10008134
779 Ga0207697_10022284
780 Ga0207656_10086379
781 Ga0207656_10135133
782 Ga0207696_1099331
783 Ga0207713_1003781
784 Ga0207642_10250366
785 Ga0207688_10004542
786 Ga0207688_10014828
787 Ga0207680_10003765
788 Ga0207680_10207096
789 Ga0207647_10045724
790 Ga0207647_10232048
791 Ga0207645_10020234
792 Ga0207707_10032009
793 Ga0207695_10002110
794 Ga0207671_10001053
795 Ga0207671_10124001
796 Ga0207693_10154107
797 Ga0207660_10025398
798 Ga0207657_10002201
799 Ga0207649_10186349
800 Ga0207649_10297588
801 Ga0207652_10052510
802 Ga0207652_10362267
803 Ga0207646_10065881
804 Ga0207681_10022576
805 Ga0207681_10485962
806 Ga0207694_10000075
807 Ga0207694_10100159
808 Ga0207694_10402529
809 Ga0207650_10001805
810 Ga0207659_10208975
811 Ga0207687_10393465
812 Ga0207664_10104432
813 Ga0207690_10012404
814 Ga0207706_10002107
815 Ga0207686_10175927
816 Ga0207669_10184266
817 Ga0207665_10124210
818 Ga0207691_10008329
819 Ga0207691_10061325
820 Ga0207711_10005820
821 Ga0207711_10015929
822 Ga0207689_10056084
823 Ga0207679_10016389
824 Ga0207667_10000110
825 Ga0207667_10006885
826 Ga0207667_10018717
827 Ga0207667_10480648
828 Ga0207651_10134326
829 Ga0207712_10358754
830 Ga0207640_10009174
831 Ga0207658_10244664
832 Ga0207658_10323656
833 Ga0207677_10414542
834 Ga0207703_10274227
835 Ga0207703_10544347
836 Ga0207678_10006728
837 Ga0207678_10103002
838 Ga0207678_10107857
839 Ga0207708_10023099
840 Ga0207708_10027482
841 Ga0207702_10016597
842 Ga0207702_10082368
843 Ga0207702_10308948
844 Ga0207674_10058955
845 Ga0207683_10001733
846 Ga0207683_10022161
847 Ga0209973_1013537
848 Ga0209982_1000864
849 Ga0209970_1005183
850 Ga0210002_1001446
851 Ga0209983_1006509
852 Ga0209282_1000732
853 Ga0209998_10003754
854 Ga0209974_10003272
855 Ga0209974_10005507
856 Ga0209974_10007787
857 Ga0207428_10020006
858 Ga0268266_10005433
859 Ga0268266_10616305
860 Ga0268264_10074017
861 Ga0265330_10017135
862 Ga0265325_10015182
863 Ga0265339_10013765
864 Ga0307408_100180746
865 Ga0307408_100457746
866 Ga0265342_10067903
867 Ga0316576_10001641
868 Ga0307405_10080630
869 Ga0307405_10472443
870 Ga0307413_10015212
871 Ga0307413_10045836
872 Ga0307410_10045319
873 Ga0307410_10064110
874 Ga0307410_10508339
875 Ga0307406_10022045
876 Ga0307406_10219947
877 Ga0307407_10041710
878 Ga0307407_10079086
879 Ga0307407_10125158
880 Ga0307412_10007247
881 Ga0307412_10025051
882 Ga0307412_10061814
883 Ga0307412_10209542
884 Ga0307409_100014522
885 Ga0307409_100054396
886 Ga0307409_100288192
887 Ga0307409_100508467
888 Ga0307416_100069352
889 Ga0307416_100375443
890 Ga0307414_10047790
891 Ga0307415_100009625
892 Ga0316580_10097353
893 Ga0373940_0072746
894 Ga0373956_0043945
895 Ga0373931_0222278
896 Ga0373927_0371959
897 Ga0373937_0317772
898 Ga0316582_0002253
899 Ga0316582_0059315
900 Ga0316584_0004012
901 Ga0316584_0061397
902 Ga0316584_0173116
903 Ga0395900_0003258
904 Ga0395905_0125367
905 Ga0395901_0462636
906 Ga0439431_0017370
907 Ga0439452_000046
908 Ga0439456_013399
909 Ga0439434_0005016
910 Ga0450901_000920
911 Ga0451577_0000068
912 Ga0451577_0621428
913 Ga0466972_0146165
914 Ga0466965_0305061
915 Ga0451576_0049550
916 Ga0451576_0062156
917 Ga0451576_0654731
918 Ga0451576_0762095
919 Ga0466967_0277776
920 Ga0466967_0340526
921 Ga0495627_014592
922 Ga0495590_0002665
923 Ga0495591_000144
924 Ga0495629_0217576
925 Ga0495653_0003314
926 Ga0495605_0005803
927 Ga0495605_0170437
928 Ga0495584_0094867
929 Ga0495596_0112154
930 Ga0495607_0002089
931 Ga0495607_0004246
932 Ga0495607_0010943
933 Ga0495606_0000990
934 Ga0495606_0032733
935 Ga0495610_0007209
936 Ga0495610_0008769
937 Ga0495610_0011039
938 Ga0495620_0000065
939 Ga0495620_0005571
940 Ga0495628_0002680
941 Ga0495630_0001625
942 Ga0495632_0000421
943 Ga0495637_0029051
944 Ga0495643_0002355
945 Ga0495642_0005038
946 Ga0495652_0001468
947 Ga0495652_0263252
948 Ga0495654_0092122
949 Ga0495665_0000184
950 Ga0495587_0012602
951 Ga0495597_0006750
952 Ga0495597_0054633
953 Ga0495645_0011832
954 Ga0495635_0007577
955 Ga0495661_0000047
956 Ga0495588_0305420
957 Ga0495599_0169126
958 Ga0495623_0001022
959 Ga0495669_0023296
960 Ga0495669_0102548
961 Ga0495670_0003366
962 Ga0495649_0292364
963 Ga0495589_0000669
964 Ga0495589_0001077
965 Ga0495600_0078820
966 Ga0495600_0109330
967 Ga0495660_0048800
968 Ga0495581_0070940
969 Ga0495604_0002912
970 Ga0495674_0024236
971 Ga0495680_0020202
972 Ga0495683_0001566
973 Ga0495687_000005
974 Ga0495675_0014062
975 Ga0495679_000674
976 Ga0495679_020367
977 Ga0495685_033324
978 Ga0495673_0098907
979 Ga0495681_0001120
980 Ga0495681_0008370
981 Ga0495681_0009690
982 Ga0495593_0005628
983 Ga0495602_0001075
984 Ga0495626_0130360
985 Ga0496100_0040757
986 Ga0496100_0252008
987 Ga0496101_0006058
988 Ga0496102_0002576
989 Ga0496102_0368929
990 Ga0496103_0053703
991 Ga0496103_0065993
992 Ga0496104_0025327
993 Ga0496104_0489109
994 Ga0496105_0245484
995 Ga0496105_0284961
996 Ga0496107_0022464
997 Ga0496107_0164597
998 Ga0496108_0588166
999 Ga0496110_0003254
1000 Ga0496111_0516318
1001 Ga0496112_0002364
1002 Ga0496112_0069699
1003 Ga0496113_0001917
1004 Ga0496113_0178186
1005 Ga0496115_0027633
1006 Ga0496115_0128763
1007 Ga0496116_0002577
1008 Ga0496116_0020483
1009 Ga0496116_0149677
1010 Ga0496117_0018750
1011 Ga0496118_0145091
1012 Ga0496121_0000100
1013 Ga0496121_0011781
1014 Ga0496121_0040642
1015 Ga0496121_0095257
1016 Ga0496121_0102919
1017 Ga0496122_0004972
1018 Ga0496122_0006588
1019 Ga0496122_0194543
1020 Ga0496123_0003372
1021 Ga0496124_0002797
1022 Ga0496124_0004561
1023 Ga0496124_0050893
1024 Ga0496125_0005929
1025 Ga0496125_0011406
1026 Ga0496125_0013098
1027 Ga0496125_0050941
1028 Ga0496126_0001145
1029 Ga0496126_0048630
1030 Ga0496126_0085248
1031 Ga0501033_0068078
1032 Ga0501033_0070443
1033 Ga0501034_0205845
1034 Ga0501034_0218713
1035 Ga0501034_0273426
1036 Ga0501036_0047235
1037 Ga0501036_0364544
1038 Ga0501037_0015751
1039 Ga0501038_0002511
1040 Ga0501039_0001556
1041 Ga0501040_0003219
1042 Ga0501041_0000212
1043 Ga0501042_0000098
1044 Ga0501043_0188310
1045 Ga0501043_0196687
1046 Ga0501046_0015300
1047 Ga0501047_0089084
1048 Ga0501048_0004806
1049 Ga0501069_0063037
1050 Ga0501070_0017605
1051 Ga0501070_0531285
1052 Ga0501071_0000452
1053 Ga0501072_0044935
1054 Ga0501072_0255965
1055 Ga0501073_0013088
1056 Ga0501073_0034857
1057 Ga0501073_0176678
1058 Ga0501073_0219077
1059 Ga0501074_0004506
1060 Ga0501074_0023654
1061 Ga0501075_0000095
1062 Ga0501076_0000386
1063 Ga0501077_0000670
1064 Ga0501217_076390
1065 Ga0501079_0001514
1066 Ga0501080_0097373
1067 Ga0501081_0000063
1068 Ga0501083_0007185
1069 Ga0501035_0118540
1070 Ga0501044_0026894
1071 Ga0501044_0079262
1072 Ga0501045_0000186
1073 nmdc:mga03n38_132249_c1
1074 nmdc:mga00v17_13505_c2
1075 nmdc:mga0yw44_282733_c1
1076 nmdc:mga0yw44_306779_c1
1077 nmdc:mga0k408_40516_c1
1078 nmdc:mga0k408_5235_c1
1079 nmdc:mga07m45_14313_c1
1080 nmdc:mga05p37_113218_c1
1081 nmdc:mga05p37_643123_c1
1082 nmdc:mga09592_306117_c1
1083 nmdc:mga06r32_262154_c1
1084 nmdc:mga06r32_473266_c1
1085 nmdc:mga08y16_100368_c1
1086 nmdc:mga08y16_404359_c1
1087 nmdc:mga08y16_94837_c1
1088 nmdc:mga0n895_25810_c1
1089 nmdc:mga0n895_31767_c1
1090 nmdc:mga0n895_377049_c1
1091 nmdc:mga0n895_613_c1
1092 nmdc:mga0n895_659914_c1
1093 nmdc:mga0rr50_61810_c1
1094 nmdc:mga0rr50_94600_c1
1095 nmdc:mga08x19_114342_c1
1096 nmdc:mga08x19_21028_c1
1097 nmdc:mga08x19_352653_c1
1098 nmdc:mga0a205_17778_c1
1099 nmdc:mga0a205_229939_c1
1100 nmdc:mga0a205_258328_c1
1101 nmdc:mga0a205_46558_c1
1102 nmdc:mga0sz30_47029_c1
1103 Ga0500643_008152
1104 Ga0500566_0000210
1105 Ga0500568_0000048
1106 Ga0500568_0020221
1107 Ga0500568_0022641
1108 Ga0500616_0055893
1109 Ga0501084_0000662
1110 Ga0501082_0000921
1111 Ga0530510_0381796
1112 2509078542
1113 2511391173
1114 2511700415
1115 2521560528
1116 2599905929
1117 2599907820
1118 2643845765
1119 2643859083
1120 2643859890
1121 2643979180
1122 2643980087
1123 2644121224
1124 2644122950
1125 2644153838
1126 2644492754
1127 2644743064
1128 2651531710
1129 2686997642
1130 2695628405
1131 2739612591
1132 2739613731
1133 2758638217
1134 2776266116
1135 2809033811
1136 2809036053
1137 2809055615
1138 2819617213
1139 2837681732
1140 2838079886
1141 2842874104
1142 2844322666
1143 2844535060
1144 2852392330
1145 2854896654
1146 2857533350
1147 2857539719
1148 2876378120
1149 2876766077
1150 2877771302
1151 2880172169
1152 2889298428
1153 2897112444
1154 2897809667
1155 2903734819
1156 2904442851
1157 2904534952
1158 2904588709
1159 2904594217
1160 2904604942
1161 2906604870
1162 2909047787
1163 2919048651
1164 2919055512
1165 2919083178
1166 2919728545
1167 2928133034
1168 2928525185
1169 2932404049
1170 2932801578
1171 2941484926
1172 2945962943
1173 2954011275
1174 2981289175
1175 2981293991
1176 2981984754
1177 2981989682
1178 2995727661
1179 3002145492
1180 3005409946
1181 3005602740
1182 3005725212
1183 3006882443
1184 3006985803
1185 641641997
1186 643601343
1187 8002395602
1188 8022632043
1189 8022654559
1190 8045868898
1191 8046773407
1192 8048748705
1193 8054283859
1194 8055036369
1195 8056976675
1196 8057738649

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

67

215

0.95

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

148

249

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9906 2 241
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9888 1 240
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9847 1 240
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9784 2 241
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9773 1 240
ID Description Score Start End Superfamily
4ymtJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9885 1 240 3.40.50.300
4ymtJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9845 1 240 3.40.50.300
af_P0AAF6_1_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9561 2 236 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9522 1 219 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9518 1 236 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4Y8J269-F1-model_v4 deleted 0.9985 1 212
AF-A0A2T5G7R1-F1-model_v4 Glutamine transport ATP-binding protein GlnQ 0.9984 1 239 GO:0005524
GO:0015424
GO:0016887
AF-A0A8B2V9U2-F1-model_v4 deleted 0.9982 1 239
AF-A0A0H5Q9M2-F1-model_v4 Glutamate transport ATP-binding protein 0.998 1 239 GO:0005524
GO:0005886
GO:0015424
GO:0016887
AF-A0A1F0F7W3-F1-model_v4 Polar amino acid ABC transporter ATP-binding protein 0.998 1 210 GO:0005524
GO:0005886
GO:0015424
GO:0016887

Map