F467677

General Info

Members Datasets Scaffolds Average Seq Length
597 480 322 255

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10334095|Ga0207671_103340952
Length 285
Sequence MKNAVEGRCEPVFSACGHAIGCVQSREERLAPILEIAGLRKSFGPVEALCGVDLDLAPGEVLAVVGDNGAGKSTFVRQITGVEHPTAGQIFLDGQEVNFSDPLQAREAGIETVFQTLALADDLDVPSNLFLGREVFRFPLGPFSWLDRKQMRRRTLEALQKTAVKIPNIDNTIRNMSGGQRQCVSIARAAAFASKLVIMDEPTAALGVQETAQVENIIRGLKDRGVPLILVSHNLRQVFDLVDRIWVFRRGRIAGVVDRDKTTGNEVVSMITGVSETAGEASAFA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
11 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
12 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
13 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
14 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
15 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
16 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
17 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
18 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
19 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
20 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
21 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
22 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
23 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
24 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
25 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
26 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
27 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
28 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
29 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
30 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
31 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
32 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
33 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
34 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
35 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
36 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
37 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
38 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
39 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
40 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
41 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
42 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
43 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
44 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
45 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
46 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
47 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
48 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
49 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
50 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
51 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
52 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
53 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
54 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
55 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
56 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
57 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
58 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
59 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
60 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
61 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
62 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
63 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
64 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
65 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
66 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
67 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
68 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
69 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
70 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
71 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
72 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
73 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
74 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
75 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
76 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
77 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
78 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
79 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
80 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
81 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
82 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
83 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
84 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
85 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
86 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
87 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
88 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
89 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
90 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
91 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
92 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
93 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
94 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
95 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
96 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
97 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
98 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
99 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
100 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
101 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
102 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
103 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
104 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
105 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
106 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
107 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
108 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
109 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
110 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
111 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
112 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
113 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
114 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
115 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
116 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
117 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
118 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
119 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
120 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
121 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
122 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
123 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
124 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
125 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
126 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
127 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
128 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
129 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
130 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
131 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
132 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
133 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
134 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
135 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
136 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
137 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
138 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
139 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
140 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
141 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
142 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
143 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
144 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
145 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
146 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
147 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
148 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
149 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
150 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
151 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
152 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
153 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
154 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
155 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
156 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
157 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
158 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
159 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
160 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
161 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
162 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
163 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
164 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
165 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
166 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
167 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
168 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
169 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
170 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
171 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
172 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
173 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
174 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
175 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
176 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
177 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
178 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
179 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
180 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
181 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
182 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
183 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
184 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
185 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
186 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
187 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
188 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
189 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
190 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
191 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
192 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
193 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
194 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
195 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
196 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
197 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
198 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
199 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
200 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
201 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
202 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
203 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
204 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
205 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
206 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
207 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
208 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
209 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
210 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
211 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
212 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
213 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
214 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
215 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
216 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
217 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
218 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
219 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
220 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
221 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
222 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
223 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
224 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
225 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
226 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
227 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
228 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
229 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
230 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
231 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
232 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
233 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
234 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
235 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
236 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
237 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
238 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
239 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
240 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
241 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
242 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
243 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
244 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
245 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
246 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
247 3004167301 Mesorhizobium loti 582 Isolate Unclassified
248 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
249 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
250 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
251 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
252 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
253 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
254 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
255 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
256 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
257 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
258 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
259 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
260 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
261 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
262 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
263 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
264 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
265 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
266 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
267 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
268 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
269 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
270 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
271 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
272 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
273 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
274 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
275 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
276 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
277 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
278 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
279 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
280 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
281 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
282 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
283 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
284 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
285 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
286 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
287 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
288 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
289 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
290 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
291 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
292 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
293 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
294 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
295 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
296 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
297 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
298 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
299 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
300 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
301 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
302 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
303 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
304 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
305 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
306 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
307 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
308 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
309 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
310 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
311 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
312 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
313 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
314 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
315 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
316 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
317 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
318 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
319 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
320 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
321 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
323 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
324 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
326 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
359 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
362 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
363 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
364 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
365 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
366 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
367 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
368 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
369 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
370 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
371 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
372 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
373 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
374 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
375 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
376 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
377 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
378 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
379 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
380 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
381 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
382 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
383 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
384 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
385 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
386 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
387 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
388 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
389 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
390 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
391 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
392 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
393 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
394 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
395 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
396 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
397 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
398 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
399 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
400 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
401 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
402 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
403 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
404 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
405 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
406 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
407 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
408 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
409 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
410 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
411 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
412 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
413 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
414 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
415 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
416 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
417 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
418 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
419 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
420 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
421 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
434 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
435 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
436 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
437 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
438 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
439 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
440 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
441 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
442 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
443 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
444 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
445 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
447 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
448 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
449 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
450 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
451 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
452 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
453 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
454 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
455 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
456 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
457 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
458 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
459 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
460 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
461 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
462 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
465 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
466 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
467 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
468 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
469 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
470 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
471 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
472 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
473 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
474 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
475 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
476 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
477 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
478 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
479 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
480 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 53.43
Metatranscriptomes 0.5
Isolates 46.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.7
Nodule 40.2
Rhizoplane 1.68
Rhizosphere 42.04
Stem 0
Stem Tuber 0
Unclassified 9.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10015027 3300001979 Bacteria 2837
2 JGI24740J21852_10044383 3300001979 Bacteria 1319
3 JGI24739J22299_10024458 3300001989 Bacteria 2129
4 JGI24739J22299_10026984 3300001989 Bacteria 2010
5 JGI24735J21928_10038964 3300002067 Bacteria 1390
6 JGI25157J39369_1000470 3300002741 Bacteria 25329
7 JGI25165J46597_1000078 3300003214 Bacteria 179320
8 Ga0055542_1001263 3300003762 Bacteria 13787
9 JGI25405J52794_10012454 3300003911 Bacteria 1638
10 Ga0070658_10010514 3300005327 Bacteria 7416
11 Ga0070676_10029445 3300005328 Bacteria 3123
12 Ga0068869_100312815 3300005334 Bacteria 1272
13 Ga0070660_100007424 3300005339 Bacteria 7639
14 Ga0070660_100046380 3300005339 Bacteria 3331
15 Ga0070661_100188212 3300005344 Bacteria 1573
16 Ga0070668_100137728 3300005347 Bacteria 1965
17 Ga0070668_100222390 3300005347 Bacteria 1558
18 Ga0070669_100137730 3300005353 Bacteria 1879
19 Ga0070671_100421062 3300005355 Bacteria 1144
20 Ga0070674_100160071 3300005356 Bacteria 1707
21 Ga0070659_100229581 3300005366 Bacteria 1534
22 Ga0070667_100106299 3300005367 Bacteria 2429
23 Ga0070708_100347438 3300005445 Bacteria 1398
24 Ga0070678_100094669 3300005456 Bacteria 2300
25 Ga0068867_100118734 3300005459 Bacteria 2041
26 Ga0068867_100327695 3300005459 Bacteria 1271
27 Ga0068867_100702033 3300005459 Bacteria 893
28 Ga0070684_100089357 3300005535 Bacteria 2738
29 Ga0068853_100009928 3300005539 Bacteria 7686
30 Ga0068853_100021907 3300005539 Bacteria 5330
31 Ga0068853_100359257 3300005539 Bacteria 1356
32 Ga0070665_100011955 3300005548 Bacteria 8765
33 Ga0070665_100091268 3300005548 Bacteria 3051
34 Ga0070665_100516886 3300005548 Bacteria 1205
35 Ga0068855_100033938 3300005563 Bacteria 6087
36 Ga0070664_100167619 3300005564 Bacteria 1947
37 Ga0068857_100057740 3300005577 Bacteria 3445
38 Ga0068857_100178026 3300005577 Bacteria 1935
39 Ga0068854_100025684 3300005578 Bacteria 4042
40 Ga0068854_100533907 3300005578 Bacteria 993
41 Ga0068856_100027277 3300005614 Bacteria 5572
42 Ga0068856_100044312 3300005614 Bacteria 4378
43 Ga0068856_100806677 3300005614 Bacteria 958
44 Ga0068858_100621515 3300005842 Bacteria 1049
45 Ga0068860_100011496 3300005843 Bacteria 8722
46 Ga0081455_10270701 3300005937 Bacteria 1232
47 Ga0081539_10079114 3300005985 Bacteria 1733
48 Ga0075365_10007236 3300006038 Bacteria 6201
49 Ga0075368_10124113 3300006042 Bacteria 1071
50 Ga0075363_100085186 3300006048 Bacteria 1733
51 Ga0075363_100112404 3300006048 Bacteria 1515
52 Ga0075363_100140581 3300006048 Bacteria 1359
53 Ga0075363_100176476 3300006048 Bacteria 1214
54 Ga0075362_10050548 3300006177 Bacteria 1858
55 Ga0075362_10220791 3300006177 Bacteria 926
56 Ga0075367_10123876 3300006178 Bacteria 1594
57 Ga0075367_10126793 3300006178 Bacteria 1576
58 Ga0075369_10016027 3300006186 Bacteria 3016
59 Ga0075369_10226581 3300006186 Bacteria 865
60 Ga0075370_10019264 3300006353 Bacteria 3715
61 Ga0068865_100388801 3300006881 Bacteria 1140
62 Ga0105240_10540024 3300009093 Bacteria 1291
63 Ga0105245_10126388 3300009098 Bacteria 2394
64 Ga0105245_10233703 3300009098 Bacteria 1779
65 Ga0105245_10383542 3300009098 Bacteria 1400
66 Ga0105245_10452530 3300009098 Bacteria 1293
67 Ga0114129_10019439 3300009147 Bacteria 9671
68 Ga0105243_10033886 3300009148 Bacteria 3950
69 Ga0105243_10280733 3300009148 Bacteria 1500
70 Ga0105243_10663355 3300009148 Bacteria 1012
71 Ga0105241_10046212 3300009174 Bacteria 3306
72 Ga0105241_10139203 3300009174 Bacteria 1974
73 Ga0105242_10501270 3300009176 Bacteria 1155
74 Ga0105237_10000397 3300009545 Bacteria 61927
75 Ga0105237_10051914 3300009545 Bacteria 4118
76 Ga0105238_10001985 3300009551 Bacteria 20609
77 Ga0105238_10406399 3300009551 Bacteria 1355
78 Ga0105249_10769741 3300009553 Bacteria 1025
79 Ga0105239_10002841 3300010375 Bacteria 21656
80 Ga0105246_10060750 3300011119 Bacteria 2627
81 Ga0105246_10400880 3300011119 Bacteria 1139
82 Ga0157373_10200194 3300013100 Bacteria 1408
83 Ga0157371_10059934 3300013102 Bacteria 2698
84 Ga0157370_10351590 3300013104 Bacteria 1358
85 Ga0157369_10433988 3300013105 Bacteria 1361
86 Ga0157374_10118073 3300013296 Bacteria 2557
87 Ga0157374_10217456 3300013296 Bacteria 1874
88 Ga0157372_10137067 3300013307 Bacteria 2819
89 Ga0157376_10011284 3300014969 Bacteria 6578
90 Ga0163161_10256618 3300017792 Bacteria 1364
91 Ga0209026_1000151 3300025250 Bacteria 110338
92 Ga0209148_1000032 3300025254 Bacteria 557660
93 Ga0209759_1000076 3300025256 Bacteria 175911
94 Ga0209233_1000150 3300025261 Bacteria 179401
95 Ga0209455_1000085 3300025272 Bacteria 247601
96 Ga0209758_1009953 3300025297 Bacteria 5786
97 Ga0209051_1000808 3300025303 Bacteria 32707
98 Ga0209051_1071368 3300025303 Bacteria 1044
99 Ga0207697_10020847 3300025315 Bacteria 2683
100 Ga0207656_10101513 3300025321 Bacteria 1319
101 Ga0207647_10041417 3300025904 Bacteria 2895
102 Ga0207647_10077972 3300025904 Bacteria 1991
103 Ga0207645_10026019 3300025907 Bacteria 3784
104 Ga0207645_10031988 3300025907 Bacteria 3383
105 Ga0207705_10007543 3300025909 Bacteria 7994
106 Ga0207705_10019453 3300025909 Bacteria 4856
107 Ga0207654_10154310 3300025911 Bacteria 1477
108 Ga0207695_10102999 3300025913 Bacteria 2847
109 Ga0207695_10223463 3300025913 Bacteria 1790
110 Ga0207695_10454748 3300025913 Bacteria 1163
111 Ga0207671_10001048 3300025914 Bacteria 33586
112 Ga0207671_10025314 3300025914 Bacteria 4457
113 Ga0207671_10161209 3300025914 Bacteria 1737
114 Ga0207671_10211926 3300025914 Bacteria 1516
115 Ga0207671_10281461 3300025914 Bacteria 1312
116 Ga0207671_10334095 3300025914 Bacteria 1200
117 Ga0207657_10019972 3300025919 Bacteria 6346
118 Ga0207657_10136675 3300025919 Bacteria 2005
119 Ga0207646_10053639 3300025922 Bacteria 3606
120 Ga0207694_10046775 3300025924 Bacteria 3345
121 Ga0207694_10338357 3300025924 Bacteria 1244
122 Ga0207694_10378017 3300025924 Bacteria 1175
123 Ga0207659_10136275 3300025926 Bacteria 1900
124 Ga0207687_10381464 3300025927 Bacteria 1155
125 Ga0207690_10060981 3300025932 Bacteria 2562
126 Ga0207709_10018244 3300025935 Bacteria 3926
127 Ga0207669_10039242 3300025937 Bacteria 2734
128 Ga0207691_10074888 3300025940 Bacteria 3053
129 Ga0207711_10098376 3300025941 Bacteria 2585
130 Ga0207689_10081644 3300025942 Bacteria 2657
131 Ga0207679_10281947 3300025945 Bacteria 1425
132 Ga0207667_10019765 3300025949 Bacteria 7508
133 Ga0207651_10048219 3300025960 Bacteria 2878
134 Ga0207712_10465241 3300025961 Bacteria 1075
135 Ga0207640_10009959 3300025981 Bacteria 5339
136 Ga0207703_10492602 3300026035 Bacteria 1149
137 Ga0207639_10003335 3300026041 Bacteria 10802
138 Ga0207639_10011379 3300026041 Bacteria 6179
139 Ga0207678_10146767 3300026067 Bacteria 2013
140 Ga0207678_10221294 3300026067 Bacteria 1620
141 Ga0207678_10448740 3300026067 Bacteria 1121
142 Ga0207702_10717547 3300026078 Bacteria 986
143 Ga0207648_10058818 3300026089 Bacteria 3351
144 Ga0207648_10309294 3300026089 Bacteria 1418
145 Ga0207674_10263262 3300026116 Bacteria 1672
146 Ga0207683_10076330 3300026121 Bacteria 2967
147 Ga0209973_1005851 3300027252 Bacteria 1322
148 Ga0268266_10000257 3300028379 Bacteria 89384
149 Ga0268266_10503803 3300028379 Bacteria 1156
150 Ga0268264_10560098 3300028381 Bacteria 1122
151 Ga0265318_10013352 3300028577 Bacteria 3474
152 Ga0307515_10000080 3300028794 Bacteria 224941
153 Ga0307515_10000109 3300028794 Bacteria 195895
154 Ga0307515_10008086 3300028794 Bacteria 20612
155 Ga0307515_10036146 3300028794 Bacteria 8004
156 Ga0307512_10011673 3300030522 Bacteria 8309
157 Ga0265330_10081275 3300031235 Bacteria 1396
158 Ga0265330_10102042 3300031235 Bacteria 1228
159 Ga0265330_10141773 3300031235 Bacteria 1022
160 Ga0265332_10067902 3300031238 Bacteria 1520
161 Ga0265325_10013585 3300031241 Bacteria 4630
162 Ga0265325_10042452 3300031241 Bacteria 2377
163 Ga0265325_10068662 3300031241 Bacteria 1784
164 Ga0265340_10003628 3300031247 Bacteria 8680
165 Ga0265340_10028955 3300031247 Bacteria 2783
166 Ga0265340_10099612 3300031247 Bacteria 1351
167 Ga0265339_10014648 3300031249 Bacteria 4720
168 Ga0265339_10037055 3300031249 Bacteria 2727
169 Ga0265339_10062419 3300031249 Bacteria 2003
170 Ga0265327_10000108 3300031251 Bacteria 183209
171 Ga0265316_10013087 3300031344 Bacteria 7399
172 Ga0265316_10032893 3300031344 Bacteria 4229
173 Ga0265316_10241089 3300031344 Bacteria 1329
174 Ga0307513_10010428 3300031456 Bacteria 11648
175 Ga0307509_10078874 3300031507 Bacteria 3410
176 Ga0307509_10147911 3300031507 Bacteria 2271
177 Ga0307408_100228903 3300031548 Bacteria 1521
178 Ga0307408_100261609 3300031548 Bacteria 1432
179 Ga0265313_10000481 3300031595 Bacteria 41874
180 Ga0265313_10011274 3300031595 Bacteria 5569
181 Ga0265313_10040664 3300031595 Bacteria 2296
182 Ga0265313_10048089 3300031595 Bacteria 2061
183 Ga0265313_10138671 3300031595 Bacteria 1047
184 Ga0307508_10000237 3300031616 Bacteria 67014
185 Ga0307514_10004431 3300031649 Bacteria 12924
186 Ga0265314_10010039 3300031711 Bacteria 7937
187 Ga0265342_10000926 3300031712 Bacteria 29144
188 Ga0265342_10083849 3300031712 Bacteria 1836
189 Ga0265342_10103097 3300031712 Bacteria 1622
190 Ga0307516_10033702 3300031730 Bacteria 5153
191 Ga0307516_10056906 3300031730 Bacteria 3811
192 Ga0307516_10176898 3300031730 Bacteria 1870
193 Ga0307406_10407423 3300031901 Bacteria 1080
194 Ga0307412_10235773 3300031911 Bacteria 1412
195 Ga0307409_100811215 3300031995 Bacteria 944
196 Ga0307414_10155783 3300032004 Bacteria 1808
197 Ga0307507_10085199 3300033179 Bacteria 2750
198 Ga0373937_0084373 3300036401 Bacteria 2939
199 Ga0395900_0025835 3300037418 Bacteria 6012
200 Ga0395900_0712750 3300037418 Bacteria 936
201 Ga0395898_0247762 3300037466 Bacteria 1699
202 Ga0395905_0052544 3300037471 Bacteria 3814
203 Ga0395905_0245857 3300037471 Bacteria 1671
204 Ga0395905_0370543 3300037471 Bacteria 1325
205 Ga0395905_0420554 3300037471 Bacteria 1232
206 Ga0395901_0366207 3300038443 Bacteria 1485
207 Ga0395901_0741673 3300038443 Bacteria 976
208 Ga0400490_38288 3300038726 Bacteria 3591
209 Ga0400489_07665 3300039093 Bacteria 30923
210 Ga0400489_32701 3300039093 Bacteria 80294
211 Ga0436361_0496708 3300039447 Bacteria 2420
212 Ga0451791_1385014 3300041451 Bacteria 1399
213 Ga0439441_007092 3300042001 Bacteria 1795
214 Ga0453683_0167382 3300044673 Bacteria 1392
215 Ga0466960_0061952 3300044901 Bacteria 1837
216 Ga0466958_0033742 3300045836 Bacteria 3050
217 Ga0466967_0152701 3300045976 Bacteria 2160
218 Ga0466967_0933504 3300045976 Bacteria 863
219 Ga0495638_0051289 3300046460 Bacteria 2573
220 Ga0495638_0119102 3300046460 Bacteria 1562
221 Ga0495610_0011182 3300046512 Bacteria 5505
222 Ga0495632_0070539 3300046519 Bacteria 1680
223 Ga0495632_0126054 3300046519 Bacteria 1194
224 Ga0495643_0119456 3300046522 Bacteria 1333
225 Ga0495668_0070029 3300046616 Bacteria 1928
226 Ga0495625_0003882 3300046660 Bacteria 14430
227 Ga0495687_051064 3300047443 Bacteria 1758
228 Ga0495686_0001214 3300047472 Bacteria 29590
229 Ga0495686_0052477 3300047472 Bacteria 2557
230 Ga0495626_0054808 3300048091 Bacteria 1830
231 Ga0496102_0328707 3300048905 Bacteria 1440
232 Ga0496102_0329255 3300048905 Bacteria 1439
233 Ga0496108_0434467 3300048911 Bacteria 1147
234 Ga0496110_0476990 3300048913 Bacteria 1136
235 Ga0496112_0121023 3300048915 Bacteria 2587
236 Ga0496112_0284770 3300048915 Bacteria 1599
237 Ga0496113_0373160 3300048916 Bacteria 1145
238 Ga0496114_0099963 3300048917 Bacteria 2475
239 Ga0496117_0283795 3300048920 Bacteria 885
240 Ga0496118_0051085 3300048921 Bacteria 3166
241 Ga0496119_0041198 3300048922 Bacteria 2944
242 Ga0496119_0043891 3300048922 Bacteria 2821
243 Ga0496120_0005160 3300048923 Bacteria 10549
244 Ga0496120_0168652 3300048923 Bacteria 1085
245 Ga0496124_0127042 3300048927 Bacteria 2030
246 Ga0496125_0165015 3300048928 Bacteria 1498
247 Ga0496126_0186258 3300048929 Bacteria 1760
248 Ga0496126_0222607 3300048929 Bacteria 1584
249 Ga0501031_0011450 3300049568 Bacteria 5779
250 Ga0501032_0106385 3300049569 Bacteria 1858
251 Ga0501033_0008414 3300049570 Bacteria 7989
252 Ga0501033_0017343 3300049570 Bacteria 5442
253 Ga0501034_0000012 3300049571 Bacteria 310504
254 Ga0501034_0073226 3300049571 Bacteria 3434
255 Ga0501034_0085484 3300049571 Bacteria 3156
256 Ga0501034_0123203 3300049571 Bacteria 2578
257 Ga0501034_0131001 3300049571 Bacteria 2491
258 Ga0501034_0486558 3300049571 Bacteria 1149
259 Ga0501037_0049680 3300049573 Bacteria 3071
260 Ga0501039_0146804 3300049575 Bacteria 1853
261 Ga0501039_0157762 3300049575 Bacteria 1783
262 Ga0501040_0033555 3300049576 Bacteria 3478
263 Ga0501040_0063606 3300049576 Bacteria 2539
264 Ga0501041_0045808 3300049577 Bacteria 2660
265 Ga0501042_0025846 3300049578 Bacteria 4127
266 Ga0501042_0065139 3300049578 Bacteria 2604
267 Ga0501042_0128823 3300049578 Bacteria 1823
268 Ga0501043_0025998 3300049579 Bacteria 4592
269 Ga0501046_0045176 3300049580 Bacteria 3500
270 Ga0501046_0078857 3300049580 Bacteria 2547
271 Ga0501046_0184005 3300049580 Bacteria 1561
272 Ga0501048_0472667 3300049582 Bacteria 898
273 Ga0501067_0046953 3300049583 Bacteria 2396
274 Ga0501068_0048361 3300049584 Bacteria 2568
275 Ga0501070_0083102 3300049586 Bacteria 2651
276 Ga0501070_0147802 3300049586 Bacteria 1939
277 Ga0501071_0121599 3300049587 Bacteria 1935
278 Ga0501071_0196493 3300049587 Bacteria 1514
279 Ga0501071_0337537 3300049587 Bacteria 1146
280 Ga0501072_0037842 3300049588 Bacteria 3784
281 Ga0501072_0272828 3300049588 Bacteria 1346
282 Ga0501073_0068323 3300049589 Bacteria 2477
283 Ga0501074_0013750 3300049590 Bacteria 5885
284 Ga0501076_0036925 3300049592 Bacteria 3830
285 Ga0501079_0281738 3300049741 Bacteria 1300
286 Ga0501079_0295832 3300049741 Bacteria 1266
287 Ga0501080_0030021 3300049742 Bacteria 5062
288 Ga0501081_0092771 3300049743 Bacteria 2125
289 Ga0501083_0024054 3300049744 Bacteria 4223
290 Ga0501083_0055976 3300049744 Bacteria 2643
291 Ga0501083_0124570 3300049744 Bacteria 1689
292 Ga0501035_0007073 3300049822 Bacteria 10488
293 Ga0501044_0120601 3300049823 Bacteria 2624
294 Ga0501044_0204816 3300049823 Bacteria 1930
295 nmdc:mga03683_12203_c1 3300050489 Bacteria 3133
296 nmdc:mga00v17_181398_c1 3300050491 Bacteria 1358
297 nmdc:mga00v17_238519_c1 3300050491 Bacteria 1179
298 nmdc:mga0yw44_266061_c1 3300050492 Bacteria 1144
299 nmdc:mga0yw44_70391_c1 3300050492 Bacteria 2169
300 nmdc:mga0k408_145240_c1 3300050493 Bacteria 1412
301 nmdc:mga0k408_32057_c1 3300050493 Bacteria 3002
302 nmdc:mga06z11_109288_c1 3300050494 Bacteria 1529
303 nmdc:mga04h51_55503_c1 3300050495 Bacteria 1342
304 nmdc:mga07m45_107181_c1 3300050496 Bacteria 1608
305 nmdc:mga07m45_33171_c1 3300050496 Bacteria 2867
306 nmdc:mga05p37_81063_c1 3300050507 Bacteria 3997
307 Ga0500566_0054057 3300053094 Bacteria 2290
308 Ga0500555_010155 3300053103 Bacteria 2695
309 Ga0500568_0000143 3300053139 Bacteria 63442
310 Ga0500568_0081392 3300053139 Bacteria 1229
311 Ga0500604_0035128 3300053151 Bacteria 1490
312 Ga0500604_0056309 3300053151 Bacteria 1225
313 Ga0500627_0129057 3300053158 Bacteria 1141
314 Ga0500609_015196 3300053731 Bacteria 1043
315 Ga0501084_0175680 3300054114 Bacteria 1808
316 Ga0587080_012430 3300059503 Bacteria 1286
317 Ga0587080_021984 3300059503 Bacteria 1053
318 Ga0587079_004231 3300059647 Bacteria 1936
319 Ga0501082_0023080 3300060353 Bacteria 5364
320 Ga0501082_0284458 3300060353 Bacteria 1439
321 Ga0501082_0686628 3300060353 Bacteria 896
322 Ga0530510_0007800 3300061734 Bacteria 7463

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038726 Ga0400490_38288 Ga0400490_38288_2885_3574 227
2 3300005445 Ga0070708_100347438 Ga0070708_1003474382 228
3 3300049575 Ga0501039_0157762 Ga0501039_0157762_11_748 235
4 3300049576 Ga0501040_0033555 Ga0501040_0033555_325_1062 235
5 3300049577 Ga0501041_0045808 Ga0501041_0045808_265_1002 235
6 3300049578 Ga0501042_0025846 Ga0501042_0025846_1090_1827 235
7 3300049580 Ga0501046_0184005 Ga0501046_0184005_111_848 235
8 3300049587 Ga0501071_0121599 Ga0501071_0121599_257_994 235
9 3300049588 Ga0501072_0037842 Ga0501072_0037842_1658_2395 235
10 3300049592 Ga0501076_0036925 Ga0501076_0036925_361_1098 235
11 3300049741 Ga0501079_0295832 Ga0501079_0295832_463_1200 235
12 3300049743 Ga0501081_0092771 Ga0501081_0092771_103_840 235
13 3300061734 Ga0530510_0007800 Ga0530510_0007800_1322_2059 235
14 iso_pu_bacteria 2856349417 2856354872 235
15 iso_pu_bacteria 2881861095 2881867258 235
16 3300049576 Ga0501040_0063606 Ga0501040_0063606_1139_1879 236
17 3300049578 Ga0501042_0128823 Ga0501042_0128823_769_1509 236
18 3300060353 Ga0501082_0686628 Ga0501082_0686628_135_878 236
19 3300050495 nmdc:mga04h51_55503_c1 nmdc:mga04h51_55503_c1_613_1332 238
20 iso_pu_bacteria 2878788777 2878794836 238
21 3300041451 Ga0451791_1385014 Ga0451791_1385014_337_1104 241
22 3300046512 Ga0495610_0011182 Ga0495610_0011182_4188_4955 241
23 3300046519 Ga0495632_0070539 Ga0495632_0070539_608_1375 241
24 3300046522 Ga0495643_0119456 Ga0495643_0119456_94_861 241
25 3300050496 nmdc:mga07m45_33171_c1 nmdc:mga07m45_33171_c1_712_1479 241
26 3300005985 Ga0081539_10079114 Ga0081539_100791143 243
27 3300027252 Ga0209973_1005851 Ga0209973_10058512 244
28 3300028794 Ga0307515_10000109 Ga0307515_10000109134 244
29 3300028794 Ga0307515_10008086 Ga0307515_100080866 244
30 3300028794 Ga0307515_10036146 Ga0307515_100361465 244
31 3300030522 Ga0307512_10011673 Ga0307512_100116737 244
32 3300031456 Ga0307513_10010428 Ga0307513_1001042810 244
33 3300031616 Ga0307508_10000237 Ga0307508_1000023730 244
34 3300031649 Ga0307514_10004431 Ga0307514_100044319 244
35 3300033179 Ga0307507_10085199 Ga0307507_100851993 244
36 3300037471 Ga0395905_0052544 Ga0395905_0052544_772_1575 244
37 iso_pu_bacteria 2585428062 2587757132 244
38 3300005843 Ga0068860_100011496 Ga0068860_10001149610 245
39 3300006353 Ga0075370_10019264 Ga0075370_100192644 245
40 3300009147 Ga0114129_10019439 Ga0114129_100194397 245
41 3300031507 Ga0307509_10078874 Ga0307509_100788743 245
42 3300031730 Ga0307516_10033702 Ga0307516_100337025 245
43 3300036401 Ga0373937_0084373 Ga0373937_0084373_809_1600 245
44 3300045836 Ga0466958_0033742 Ga0466958_0033742_695_1489 245
45 3300045976 Ga0466967_0152701 Ga0466967_0152701_597_1391 245
46 3300046660 Ga0495625_0003882 Ga0495625_0003882_639_1430 245
47 3300050493 nmdc:mga0k408_32057_c1 nmdc:mga0k408_32057_c1_237_1028 245
48 3300050507 nmdc:mga05p37_81063_c1 nmdc:mga05p37_81063_c1_739_1530 245
49 3300053094 Ga0500566_0054057 Ga0500566_0054057_306_1169 245
50 3300005334 Ga0068869_100312815 Ga0068869_1003128152 246
51 3300005614 Ga0068856_100044312 Ga0068856_1000443122 246
52 3300005842 Ga0068858_100621515 Ga0068858_1006215151 246
53 3300006177 Ga0075362_10220791 Ga0075362_102207911 246
54 3300009098 Ga0105245_10126388 Ga0105245_101263882 246
55 3300009148 Ga0105243_10033886 Ga0105243_100338863 246
56 3300009174 Ga0105241_10046212 Ga0105241_100462123 246
57 3300014969 Ga0157376_10011284 Ga0157376_100112847 246
58 3300025303 Ga0209051_1000808 Ga0209051_10008089 246
59 3300025935 Ga0207709_10018244 Ga0207709_100182443 246
60 3300025942 Ga0207689_10081644 Ga0207689_100816442 246
61 3300026035 Ga0207703_10492602 Ga0207703_104926022 246
62 3300028794 Ga0307515_10000080 Ga0307515_10000080145 246
63 3300031251 Ga0265327_10000108 Ga0265327_1000010891 246
64 3300031507 Ga0307509_10147911 Ga0307509_101479112 246
65 3300037466 Ga0395898_0247762 Ga0395898_0247762_575_1387 246
66 3300039447 Ga0436361_0496708 Ga0436361_0496708_671_1480 246
67 3300044673 Ga0453683_0167382 Ga0453683_0167382_313_1137 246
68 3300047472 Ga0495686_0001214 Ga0495686_0001214_18972_19793 246
69 3300003911 JGI25405J52794_10012454 JGI25405J52794_100124542 248
70 3300049568 Ga0501031_0011450 Ga0501031_0011450_2459_3214 248
71 3300049570 Ga0501033_0008414 Ga0501033_0008414_6158_6913 248
72 3300049573 Ga0501037_0049680 Ga0501037_0049680_1280_2035 248
73 3300049575 Ga0501039_0146804 Ga0501039_0146804_399_1154 248
74 3300049578 Ga0501042_0065139 Ga0501042_0065139_1171_1926 248
75 3300049579 Ga0501043_0025998 Ga0501043_0025998_3502_4257 248
76 3300049580 Ga0501046_0045176 Ga0501046_0045176_1207_1962 248
77 3300049582 Ga0501048_0472667 Ga0501048_0472667_73_828 248
78 3300049583 Ga0501067_0046953 Ga0501067_0046953_1269_2024 248
79 3300049587 Ga0501071_0196493 Ga0501071_0196493_610_1365 248
80 3300049588 Ga0501072_0272828 Ga0501072_0272828_430_1185 248
81 3300049590 Ga0501074_0013750 Ga0501074_0013750_82_837 248
82 3300049742 Ga0501080_0030021 Ga0501080_0030021_4004_4759 248
83 3300049744 Ga0501083_0055976 Ga0501083_0055976_555_1310 248
84 3300060353 Ga0501082_0023080 Ga0501082_0023080_2191_2946 248
85 iso_pu_bacteria 2898795034 2898796593 249
86 3300049570 Ga0501033_0017343 Ga0501033_0017343_4493_5266 251
87 3300049571 Ga0501034_0131001 Ga0501034_0131001_879_1652 251
88 3300049586 Ga0501070_0083102 Ga0501070_0083102_1375_2148 251
89 3300049589 Ga0501073_0068323 Ga0501073_0068323_724_1497 251
90 3300049822 Ga0501035_0007073 Ga0501035_0007073_3757_4530 251
91 iso_pu_bacteria 2508501123 2509114031 251
92 iso_pu_bacteria 2508501127 2509140752 251
93 iso_pu_bacteria 2509276018 2509368547 251
94 iso_pu_bacteria 2510065059 2510314827 251
95 iso_pu_bacteria 2512875016 2512934056 251
96 iso_pu_bacteria 2513237164 2514038695 251
97 iso_pu_bacteria 2513237305 2514418240 251
98 iso_pu_bacteria 2588253730 2588520196 251
99 iso_pu_bacteria 2597489875 2597810391 251
100 iso_pu_bacteria 2599185301 2599935261 251
101 iso_pu_bacteria 2643221595 2643983774 251
102 iso_pu_bacteria 2643221627 2644155907 251
103 iso_pu_bacteria 2687453392 2688595801 251
104 iso_pu_bacteria 2693429783 2694627977 251
105 iso_pu_bacteria 2693429784 2694636226 251
106 iso_pu_bacteria 2721755686 2723573051 251
107 iso_pu_bacteria 2756170246 2756674872 251
108 iso_pu_bacteria 2791355123 2792746989 251
109 iso_pu_bacteria 2841734538 2841736222 251
110 iso_pu_bacteria 2844002411 2844003651 251
111 iso_pu_bacteria 2844009547 2844010606 251
112 iso_pu_bacteria 2847670302 2847673360 251
113 iso_pu_bacteria 2847686936 2847689870 251
114 iso_pu_bacteria 2856314179 2856319171 251
115 iso_pu_bacteria 2856320880 2856322228 251
116 iso_pu_bacteria 2856328259 2856332713 251
117 iso_pu_bacteria 2856334872 2856340700 251
118 iso_pu_bacteria 2856342000 2856342842 251
119 iso_pu_bacteria 2856356410 2856363364 251
120 iso_pu_bacteria 2856364286 2856369975 251
121 iso_pu_bacteria 2857349434 2857352830 251
122 iso_pu_bacteria 2857367948 2857369257 251
123 iso_pu_bacteria 2869162929 2869165341 251
124 iso_pu_bacteria 2869234852 2869236951 251
125 iso_pu_bacteria 2869249662 2869255856 251
126 iso_pu_bacteria 2869256925 2869257096 251
127 iso_pu_bacteria 2869264136 2869265113 251
128 iso_pu_bacteria 2869271264 2869277353 251
129 iso_pu_bacteria 2869278585 2869284677 251
130 iso_pu_bacteria 2869285874 2869290782 251
131 iso_pu_bacteria 2871429161 2871433064 251
132 iso_pu_bacteria 2871435913 2871438859 251
133 iso_pu_bacteria 2871444079 2871447978 251
134 iso_pu_bacteria 2871451962 2871452185 251
135 iso_pu_bacteria 2871459585 2871465921 251
136 iso_pu_bacteria 2871466892 2871472940 251
137 iso_pu_bacteria 2871474448 2871475652 251
138 iso_pu_bacteria 2871481445 2871484381 251
139 iso_pu_bacteria 2871488783 2871489652 251
140 iso_pu_bacteria 2871495908 2871502297 251
141 iso_pu_bacteria 2874109183 2874109491 251
142 iso_pu_bacteria 2874116593 2874122029 251
143 iso_pu_bacteria 2874123672 2874124234 251
144 iso_pu_bacteria 2874131515 2874138689 251
145 iso_pu_bacteria 2874139085 2874143003 251
146 iso_pu_bacteria 2874146452 2874153775 251
147 iso_pu_bacteria 2874155637 2874161040 251
148 iso_pu_bacteria 2874162495 2874168335 251
149 iso_pu_bacteria 2874168670 2874172212 251
150 iso_pu_bacteria 2876363079 2876363686 251
151 iso_pu_bacteria 2876369609 2876376014 251
152 iso_pu_bacteria 2876377896 2876381381 251
153 iso_pu_bacteria 2876386047 2876386048 251
154 iso_pu_bacteria 2876392853 2876397138 251
155 iso_pu_bacteria 2876399893 2876403787 251
156 iso_pu_bacteria 2876413966 2876419080 251
157 iso_pu_bacteria 2876420981 2876424493 251
158 iso_pu_bacteria 2878035449 2878039560 251
159 iso_pu_bacteria 2878730984 2878731908 251
160 iso_pu_bacteria 2878738818 2878740928 251
161 iso_pu_bacteria 2878745973 2878750677 251
162 iso_pu_bacteria 2878753008 2878754312 251
163 iso_pu_bacteria 2878760144 2878766188 251
164 iso_pu_bacteria 2878767105 2878773389 251
165 iso_pu_bacteria 2878774303 2878778244 251
166 iso_pu_bacteria 2878781027 2878785542 251
167 iso_pu_bacteria 2881147464 2881148228 251
168 iso_pu_bacteria 2881155292 2881159188 251
169 iso_pu_bacteria 2881161766 2881164884 251
170 iso_pu_bacteria 2881845957 2881852275 251
171 iso_pu_bacteria 2881853255 2881856290 251
172 iso_pu_bacteria 2882632389 2882634583 251
173 iso_pu_bacteria 2882912400 2882913262 251
174 iso_pu_bacteria 2885305155 2885306759 251
175 iso_pu_bacteria 2885312484 2885314316 251
176 iso_pu_bacteria 2885318864 2885323613 251
177 iso_pu_bacteria 2885326080 2885332987 251
178 iso_pu_bacteria 2885334103 2885335733 251
179 iso_pu_bacteria 2885342637 2885344603 251
180 iso_pu_bacteria 2885350715 2885355667 251
181 iso_pu_bacteria 2888337043 2888343447 251
182 iso_pu_bacteria 2888343758 2888344182 251
183 iso_pu_bacteria 2888350351 2888353058 251
184 iso_pu_bacteria 2889010040 2889014804 251
185 iso_pu_bacteria 2889016732 2889020112 251
186 iso_pu_bacteria 2903448605 2903454229 251
187 iso_pu_bacteria 2903492973 2903496284 251
188 iso_pu_bacteria 2903492973 2903497373 251
189 iso_pu_bacteria 2903513507 2903517505 251
190 iso_pu_bacteria 2903521522 2903523253 251
191 iso_pu_bacteria 2903528002 2903529292 251
192 iso_pu_bacteria 2903540706 2903547234 251
193 iso_pu_bacteria 2904659560 2904663892 251
194 iso_pu_bacteria 2906308376 2906313602 251
195 iso_pu_bacteria 2906321335 2906326311 251
196 iso_pu_bacteria 2906328253 2906334268 251
197 iso_pu_bacteria 2906354277 2906360654 251
198 iso_pu_bacteria 2906363423 2906369756 251
199 iso_pu_bacteria 2906370794 2906372836 251
200 iso_pu_bacteria 2906378014 2906384939 251
201 iso_pu_bacteria 2906393657 2906394005 251
202 iso_pu_bacteria 2906401398 2906407734 251
203 iso_pu_bacteria 2906408224 2906408500 251
204 iso_pu_bacteria 2906414383 2906419243 251
205 iso_pu_bacteria 2922130491 2922132601 251
206 iso_pu_bacteria 2922151315 2922154957 251
207 iso_pu_bacteria 2922158528 2922159725 251
208 iso_pu_bacteria 2922172374 2922174387 251
209 iso_pu_bacteria 2922178524 2922181928 251
210 iso_pu_bacteria 2922185730 2922193606 251
211 iso_pu_bacteria 2924710171 2924717162 251
212 iso_pu_bacteria 2924718760 2924723589 251
213 iso_pu_bacteria 2924726620 2924728927 251
214 iso_pu_bacteria 2924733363 2924736510 251
215 iso_pu_bacteria 2924748358 2924748631 251
216 iso_pu_bacteria 2924754689 2924756973 251
217 iso_pu_bacteria 2924776078 2924778529 251
218 iso_pu_bacteria 2924784321 2924785000 251
219 iso_pu_bacteria 2937813078 2937820093 251
220 iso_pu_bacteria 2937822353 2937826500 251
221 iso_pu_bacteria 2937836603 2937840592 251
222 iso_pu_bacteria 2937848649 2937849571 251
223 iso_pu_bacteria 2937861824 2937866109 251
224 iso_pu_bacteria 2937877337 2937878837 251
225 iso_pu_bacteria 2937891427 2937897364 251
226 iso_pu_bacteria 2937972304 2937974382 251
227 iso_pu_bacteria 2937980651 2937985213 251
228 iso_pu_bacteria 2937994558 2938001097 251
229 iso_pu_bacteria 2938014810 2938019702 251
230 iso_pu_bacteria 2958034702 2958041468 251
231 iso_pu_bacteria 2958041894 2958042442 251
232 iso_pu_bacteria 2958064165 2958069536 251
233 iso_pu_bacteria 2958071322 2958077183 251
234 iso_pu_bacteria 2958084443 2958085988 251
235 iso_pu_bacteria 2958092219 2958098951 251
236 iso_pu_bacteria 2958100919 2958101963 251
237 iso_pu_bacteria 2958108152 2958112524 251
238 iso_pu_bacteria 2958115193 2958119249 251
239 iso_pu_bacteria 2958122699 2958123250 251
240 iso_pu_bacteria 2958130278 2958135182 251
241 iso_pu_bacteria 2958144490 2958147314 251
242 iso_pu_bacteria 2958165035 2958171363 251
243 iso_pu_bacteria 2958172287 2958174406 251
244 iso_pu_bacteria 2958179912 2958184211 251
245 iso_pu_bacteria 2961077736 2961082266 251
246 iso_pu_bacteria 2961114664 2961118968 251
247 iso_pu_bacteria 2961127735 2961131471 251
248 iso_pu_bacteria 2961136820 2961140514 251
249 iso_pu_bacteria 2961163497 2961169804 251
250 iso_pu_bacteria 2961170736 2961176369 251
251 iso_pu_bacteria 2961183825 2961190668 251
252 iso_pu_bacteria 2963644680 2963645146 251
253 iso_pu_bacteria 2965018300 2965024564 251
254 iso_pu_bacteria 2965025482 2965030162 251
255 iso_pu_bacteria 2965040258 2965044011 251
256 iso_pu_bacteria 2965062239 2965062396 251
257 iso_pu_bacteria 2965089291 2965096601 251
258 iso_pu_bacteria 2965102966 2965109872 251
259 iso_pu_bacteria 2965110997 2965119196 251
260 iso_pu_bacteria 2965119406 2965127210 251
261 iso_pu_bacteria 2967996073 2967996716 251
262 iso_pu_bacteria 2968003550 2968004778 251
263 iso_pu_bacteria 2968016561 2968022988 251
264 iso_pu_bacteria 2968083720 2968089955 251
265 iso_pu_bacteria 2968091066 2968093680 251
266 iso_pu_bacteria 2968097103 2968098510 251
267 iso_pu_bacteria 2968110612 2968115031 251
268 iso_pu_bacteria 2968117919 2968122765 251
269 iso_pu_bacteria 2968128360 2968133887 251
270 iso_pu_bacteria 2968171901 2968178196 251
271 iso_pu_bacteria 2970469710 2970475573 251
272 iso_pu_bacteria 2970489779 2970492394 251
273 iso_pu_bacteria 2970503327 2970509040 251
274 iso_pu_bacteria 2970510686 2970510881 251
275 iso_pu_bacteria 2970524798 2970525893 251
276 iso_pu_bacteria 2970532167 2970532181 251
277 iso_pu_bacteria 2970540015 2970544446 251
278 iso_pu_bacteria 2970547951 2970550136 251
279 iso_pu_bacteria 2970554993 2970561042 251
280 iso_pu_bacteria 2970593180 2970599288 251
281 iso_pu_bacteria 2970619444 2970623877 251
282 iso_pu_bacteria 2970627176 2970628676 251
283 iso_pu_bacteria 2977821940 2977823526 251
284 iso_pu_bacteria 2977828996 2977835405 251
285 iso_pu_bacteria 2977843712 2977850363 251
286 iso_pu_bacteria 2977851361 2977855242 251
287 iso_pu_bacteria 2977858184 2977860387 251
288 iso_pu_bacteria 2977864932 2977870236 251
289 iso_pu_bacteria 2977872689 2977879640 251
290 iso_pu_bacteria 2977898635 2977899345 251
291 iso_pu_bacteria 2977907340 2977911560 251
292 iso_pu_bacteria 2977915119 2977919643 251
293 iso_pu_bacteria 2977922695 2977925725 251
294 iso_pu_bacteria 2977935797 2977938200 251
295 iso_pu_bacteria 2977942078 2977943449 251
296 iso_pu_bacteria 2977950692 2977954487 251
297 iso_pu_bacteria 2977957713 2977965263 251
298 iso_pu_bacteria 2977971508 2977977549 251
299 iso_pu_bacteria 2977986579 2977987136 251
300 iso_pu_bacteria 2979710463 2979714684 251
301 iso_pu_bacteria 2979742915 2979746476 251
302 iso_pu_bacteria 2979764755 2979769025 251
303 iso_pu_bacteria 2979772303 2979774346 251
304 iso_pu_bacteria 2979779861 2979781798 251
305 iso_pu_bacteria 2979793036 2979798628 251
306 iso_pu_bacteria 2979808191 2979813719 251
307 iso_pu_bacteria 2987636660 2987641422 251
308 iso_pu_bacteria 2987645492 2987648705 251
309 iso_pu_bacteria 2987652177 2987656408 251
310 iso_pu_bacteria 2987659509 2987666028 251
311 iso_pu_bacteria 2987666974 2987669346 251
312 iso_pu_bacteria 2987673487 2987675261 251
313 iso_pu_bacteria 2996341866 2996342431 251
314 iso_pu_bacteria 2996348954 2996355817 251
315 iso_pu_bacteria 2996386984 2996387512 251
316 iso_pu_bacteria 3000135777 3000137169 251
317 iso_pu_bacteria 3004167301 3004173035 251
318 iso_pu_bacteria 3004188549 3004195051 251
319 iso_pu_bacteria 3004195979 3004202820 251
320 iso_pu_bacteria 3004203850 3004210231 251
321 iso_pu_bacteria 3004211236 3004217263 251
322 iso_pu_bacteria 3004218560 3004220471 251
323 iso_pu_bacteria 3004232784 3004233463 251
324 iso_pu_bacteria 3004239961 3004245834 251
325 iso_pu_bacteria 3004248173 3004254517 251
326 iso_pu_bacteria 3004268573 3004275068 251
327 iso_pu_bacteria 3004275668 3004282243 251
328 iso_pu_bacteria 3004289098 3004293744 251
329 iso_pu_bacteria 3004334049 3004337590 251
330 iso_pu_bacteria 637000159 637077206 251
331 iso_pu_bacteria 649633066 649870368 251
332 iso_pu_bacteria 8004300914 8004304036 251
333 iso_pu_bacteria 8004361976 8004364815 251
334 iso_pu_bacteria 8004374579 8004375888 251
335 iso_pu_bacteria 8004387939 8004393071 251
336 iso_pu_bacteria 8004445564 8004452202 251
337 iso_pu_bacteria 8004633249 8004638401 251
338 iso_pu_bacteria 8004640170 8004641559 251
339 iso_pu_bacteria 8004695233 8004695696 251
340 iso_pu_bacteria 8004703790 8004706833 251
341 iso_pu_bacteria 8004714634 8004719858 251
342 iso_pu_bacteria 8004727605 8004734838 251
343 iso_pu_bacteria 8055617313 8055617706 251
344 3300005539 Ga0068853_100009928 Ga0068853_1000099286 252
345 3300005548 Ga0070665_100011955 Ga0070665_1000119558 252
346 3300009545 Ga0105237_10000397 Ga0105237_1000039746 252
347 3300010375 Ga0105239_10002841 Ga0105239_100028416 252
348 3300025303 Ga0209051_1071368 Ga0209051_10713681 252
349 3300025914 Ga0207671_10001048 Ga0207671_100010489 252
350 3300026041 Ga0207639_10003335 Ga0207639_100033353 252
351 3300028379 Ga0268266_10000257 Ga0268266_1000025747 252
352 3300028577 Ga0265318_10013352 Ga0265318_100133524 252
353 3300031235 Ga0265330_10081275 Ga0265330_100812752 252
354 3300031238 Ga0265332_10067902 Ga0265332_100679022 252
355 3300031247 Ga0265340_10028955 Ga0265340_100289552 252
356 3300031249 Ga0265339_10037055 Ga0265339_100370552 252
357 3300031344 Ga0265316_10013087 Ga0265316_100130877 252
358 3300031595 Ga0265313_10011274 Ga0265313_100112745 252
359 3300031711 Ga0265314_10010039 Ga0265314_100100396 252
360 3300031712 Ga0265342_10103097 Ga0265342_101030972 252
361 3300031730 Ga0307516_10056906 Ga0307516_100569062 252
362 3300038443 Ga0395901_0741673 Ga0395901_0741673_39_815 252
363 iso_pu_bacteria 2889790730 2889792027 252
364 iso_pu_bacteria 2889914905 2889918344 252
365 3300005327 Ga0070658_10010514 Ga0070658_100105145 253
366 3300005548 Ga0070665_100091268 Ga0070665_1000912682 253
367 3300005563 Ga0068855_100033938 Ga0068855_1000339384 253
368 3300005614 Ga0068856_100806677 Ga0068856_1008066772 253
369 3300006048 Ga0075363_100140581 Ga0075363_1001405812 253
370 3300009098 Ga0105245_10233703 Ga0105245_102337032 253
371 3300009551 Ga0105238_10406399 Ga0105238_104063992 253
372 3300013296 Ga0157374_10118073 Ga0157374_101180733 253
373 3300025909 Ga0207705_10007543 Ga0207705_100075434 253
374 3300025924 Ga0207694_10378017 Ga0207694_103780171 253
375 3300025927 Ga0207687_10381464 Ga0207687_103814642 253
376 3300025949 Ga0207667_10019765 Ga0207667_100197654 253
377 3300026067 Ga0207678_10221294 Ga0207678_102212941 253
378 3300026078 Ga0207702_10717547 Ga0207702_107175472 253
379 3300031241 Ga0265325_10068662 Ga0265325_100686622 253
380 3300031595 Ga0265313_10048089 Ga0265313_100480891 253
381 3300032004 Ga0307414_10155783 Ga0307414_101557832 253
382 3300047472 Ga0495686_0052477 Ga0495686_0052477_340_1125 253
383 3300049571 Ga0501034_0073226 Ga0501034_0073226_150_935 253
384 3300049571 Ga0501034_0486558 Ga0501034_0486558_88_885 253
385 3300049580 Ga0501046_0078857 Ga0501046_0078857_966_1751 253
386 3300049584 Ga0501068_0048361 Ga0501068_0048361_519_1304 253
387 3300049586 Ga0501070_0147802 Ga0501070_0147802_961_1746 253
388 3300049744 Ga0501083_0024054 Ga0501083_0024054_1936_2721 253
389 3300049744 Ga0501083_0124570 Ga0501083_0124570_762_1547 253
390 3300049823 Ga0501044_0120601 Ga0501044_0120601_1346_2131 253
391 3300049823 Ga0501044_0204816 Ga0501044_0204816_868_1647 253
392 3300050492 nmdc:mga0yw44_266061_c1 nmdc:mga0yw44_266061_c1_221_1006 253
393 3300053139 Ga0500568_0000143 Ga0500568_0000143_60005_60793 253
394 3300053151 Ga0500604_0056309 Ga0500604_0056309_124_909 253
395 3300053158 Ga0500627_0129057 Ga0500627_0129057_225_1010 253
396 3300060353 Ga0501082_0284458 Ga0501082_0284458_261_1046 253
397 iso_pu_bacteria 2643221550 2643770648 253
398 iso_pu_bacteria 2643221564 2643838238 253
399 iso_pu_bacteria 2869169390 2869173704 253
400 iso_pu_bacteria 2869242130 2869245192 253
401 iso_pu_bacteria 2876406927 2876407916 253
402 iso_pu_bacteria 2906386501 2906392848 253
403 iso_pu_bacteria 2924741084 2924745488 253
404 iso_pu_bacteria 2965032056 2965038631 253
405 iso_pu_bacteria 2965047637 2965054738 253
406 iso_pu_bacteria 2968138860 2968139008 253
407 iso_pu_bacteria 8056875544 8056877598 253
408 3300025914 Ga0207671_10334095 Ga0207671_103340952 254
409 3300031235 Ga0265330_10102042 Ga0265330_101020422 254
410 3300031235 Ga0265330_10141773 Ga0265330_101417731 254
411 3300031241 Ga0265325_10013585 Ga0265325_100135852 254
412 3300031241 Ga0265325_10042452 Ga0265325_100424522 254
413 3300031247 Ga0265340_10003628 Ga0265340_1000362810 254
414 3300031247 Ga0265340_10099612 Ga0265340_100996122 254
415 3300031249 Ga0265339_10014648 Ga0265339_100146482 254
416 3300031249 Ga0265339_10062419 Ga0265339_100624191 254
417 3300031344 Ga0265316_10032893 Ga0265316_100328933 254
418 3300031344 Ga0265316_10241089 Ga0265316_102410891 254
419 3300031595 Ga0265313_10000481 Ga0265313_1000048131 254
420 3300031595 Ga0265313_10040664 Ga0265313_100406642 254
421 3300031595 Ga0265313_10138671 Ga0265313_101386711 254
422 3300031712 Ga0265342_10000926 Ga0265342_1000092622 254
423 3300031712 Ga0265342_10083849 Ga0265342_100838492 254
424 3300001979 JGI24740J21852_10015027 JGI24740J21852_100150272 255
425 3300001979 JGI24740J21852_10044383 JGI24740J21852_100443832 255
426 3300001989 JGI24739J22299_10024458 JGI24739J22299_100244582 255
427 3300001989 JGI24739J22299_10026984 JGI24739J22299_100269842 255
428 3300002067 JGI24735J21928_10038964 JGI24735J21928_100389642 255
429 3300002741 JGI25157J39369_1000470 JGI25157J39369_10004707 255
430 3300003214 JGI25165J46597_1000078 JGI25165J46597_1000078129 255
431 3300003762 Ga0055542_1001263 Ga0055542_100126311 255
432 3300005328 Ga0070676_10029445 Ga0070676_100294452 255
433 3300005339 Ga0070660_100007424 Ga0070660_1000074248 255
434 3300005339 Ga0070660_100046380 Ga0070660_1000463802 255
435 3300005344 Ga0070661_100188212 Ga0070661_1001882122 255
436 3300005347 Ga0070668_100137728 Ga0070668_1001377282 255
437 3300005347 Ga0070668_100222390 Ga0070668_1002223901 255
438 3300005353 Ga0070669_100137730 Ga0070669_1001377301 255
439 3300005355 Ga0070671_100421062 Ga0070671_1004210622 255
440 3300005356 Ga0070674_100160071 Ga0070674_1001600712 255
441 3300005366 Ga0070659_100229581 Ga0070659_1002295812 255
442 3300005367 Ga0070667_100106299 Ga0070667_1001062991 255
443 3300005456 Ga0070678_100094669 Ga0070678_1000946692 255
444 3300005459 Ga0068867_100118734 Ga0068867_1001187342 255
445 3300005459 Ga0068867_100327695 Ga0068867_1003276952 255
446 3300005459 Ga0068867_100702033 Ga0068867_1007020331 255
447 3300005535 Ga0070684_100089357 Ga0070684_1000893572 255
448 3300005539 Ga0068853_100021907 Ga0068853_1000219072 255
449 3300005539 Ga0068853_100359257 Ga0068853_1003592572 255
450 3300005548 Ga0070665_100516886 Ga0070665_1005168862 255
451 3300005564 Ga0070664_100167619 Ga0070664_1001676191 255
452 3300005577 Ga0068857_100057740 Ga0068857_1000577403 255
453 3300005577 Ga0068857_100178026 Ga0068857_1001780262 255
454 3300005578 Ga0068854_100025684 Ga0068854_1000256844 255
455 3300005578 Ga0068854_100533907 Ga0068854_1005339072 255
456 3300005614 Ga0068856_100027277 Ga0068856_1000272775 255
457 3300005937 Ga0081455_10270701 Ga0081455_102707012 255
458 3300006038 Ga0075365_10007236 Ga0075365_100072367 255
459 3300006042 Ga0075368_10124113 Ga0075368_101241132 255
460 3300006048 Ga0075363_100085186 Ga0075363_1000851862 255
461 3300006048 Ga0075363_100112404 Ga0075363_1001124042 255
462 3300006048 Ga0075363_100176476 Ga0075363_1001764762 255
463 3300006177 Ga0075362_10050548 Ga0075362_100505482 255
464 3300006178 Ga0075367_10123876 Ga0075367_101238762 255
465 3300006178 Ga0075367_10126793 Ga0075367_101267932 255
466 3300006186 Ga0075369_10016027 Ga0075369_100160272 255
467 3300006186 Ga0075369_10226581 Ga0075369_102265811 255
468 3300006881 Ga0068865_100388801 Ga0068865_1003888012 255
469 3300009093 Ga0105240_10540024 Ga0105240_105400242 255
470 3300009098 Ga0105245_10383542 Ga0105245_103835422 255
471 3300009098 Ga0105245_10452530 Ga0105245_104525301 255
472 3300009148 Ga0105243_10280733 Ga0105243_102807332 255
473 3300009148 Ga0105243_10663355 Ga0105243_106633551 255
474 3300009174 Ga0105241_10139203 Ga0105241_101392032 255
475 3300009176 Ga0105242_10501270 Ga0105242_105012702 255
476 3300009545 Ga0105237_10051914 Ga0105237_100519143 255
477 3300009551 Ga0105238_10001985 Ga0105238_1000198515 255
478 3300009553 Ga0105249_10769741 Ga0105249_107697411 255
479 3300011119 Ga0105246_10060750 Ga0105246_100607502 255
480 3300011119 Ga0105246_10400880 Ga0105246_104008802 255
481 3300013100 Ga0157373_10200194 Ga0157373_102001942 255
482 3300013102 Ga0157371_10059934 Ga0157371_100599342 255
483 3300013104 Ga0157370_10351590 Ga0157370_103515902 255
484 3300013105 Ga0157369_10433988 Ga0157369_104339881 255
485 3300013296 Ga0157374_10217456 Ga0157374_102174562 255
486 3300013307 Ga0157372_10137067 Ga0157372_101370672 255
487 3300017792 Ga0163161_10256618 Ga0163161_102566182 255
488 3300025250 Ga0209026_1000151 Ga0209026_100015178 255
489 3300025254 Ga0209148_1000032 Ga0209148_1000032488 255
490 3300025256 Ga0209759_1000076 Ga0209759_10000768 255
491 3300025261 Ga0209233_1000150 Ga0209233_100015052 255
492 3300025272 Ga0209455_1000085 Ga0209455_1000085184 255
493 3300025297 Ga0209758_1009953 Ga0209758_10099532 255
494 3300025315 Ga0207697_10020847 Ga0207697_100208472 255
495 3300025321 Ga0207656_10101513 Ga0207656_101015131 255
496 3300025904 Ga0207647_10041417 Ga0207647_100414172 255
497 3300025904 Ga0207647_10077972 Ga0207647_100779722 255
498 3300025907 Ga0207645_10026019 Ga0207645_100260193 255
499 3300025907 Ga0207645_10031988 Ga0207645_100319883 255
500 3300025909 Ga0207705_10019453 Ga0207705_100194532 255
501 3300025911 Ga0207654_10154310 Ga0207654_101543102 255
502 3300025913 Ga0207695_10102999 Ga0207695_101029993 255
503 3300025913 Ga0207695_10223463 Ga0207695_102234632 255
504 3300025913 Ga0207695_10454748 Ga0207695_104547482 255
505 3300025914 Ga0207671_10025314 Ga0207671_100253144 255
506 3300025914 Ga0207671_10161209 Ga0207671_101612092 255
507 3300025914 Ga0207671_10211926 Ga0207671_102119262 255
508 3300025914 Ga0207671_10281461 Ga0207671_102814612 255
509 3300025919 Ga0207657_10019972 Ga0207657_100199723 255
510 3300025919 Ga0207657_10136675 Ga0207657_101366752 255
511 3300025922 Ga0207646_10053639 Ga0207646_100536393 255
512 3300025924 Ga0207694_10046775 Ga0207694_100467752 255
513 3300025924 Ga0207694_10338357 Ga0207694_103383571 255
514 3300025926 Ga0207659_10136275 Ga0207659_101362752 255
515 3300025932 Ga0207690_10060981 Ga0207690_100609812 255
516 3300025937 Ga0207669_10039242 Ga0207669_100392423 255
517 3300025940 Ga0207691_10074888 Ga0207691_100748883 255
518 3300025941 Ga0207711_10098376 Ga0207711_100983763 255
519 3300025945 Ga0207679_10281947 Ga0207679_102819472 255
520 3300025960 Ga0207651_10048219 Ga0207651_100482192 255
521 3300025961 Ga0207712_10465241 Ga0207712_104652411 255
522 3300025981 Ga0207640_10009959 Ga0207640_100099592 255
523 3300026041 Ga0207639_10011379 Ga0207639_100113798 255
524 3300026067 Ga0207678_10146767 Ga0207678_101467672 255
525 3300026067 Ga0207678_10448740 Ga0207678_104487401 255
526 3300026089 Ga0207648_10058818 Ga0207648_100588181 255
527 3300026089 Ga0207648_10309294 Ga0207648_103092941 255
528 3300026116 Ga0207674_10263262 Ga0207674_102632621 255
529 3300026121 Ga0207683_10076330 Ga0207683_100763302 255
530 3300028379 Ga0268266_10503803 Ga0268266_105038032 255
531 3300028381 Ga0268264_10560098 Ga0268264_105600982 255
532 3300031548 Ga0307408_100228903 Ga0307408_1002289032 255
533 3300031548 Ga0307408_100261609 Ga0307408_1002616092 255
534 3300031730 Ga0307516_10176898 Ga0307516_101768982 255
535 3300031901 Ga0307406_10407423 Ga0307406_104074232 255
536 3300031911 Ga0307412_10235773 Ga0307412_102357732 255
537 3300031995 Ga0307409_100811215 Ga0307409_1008112151 255
538 3300037418 Ga0395900_0025835 Ga0395900_0025835_4575_5345 255
539 3300037418 Ga0395900_0712750 Ga0395900_0712750_37_807 255
540 3300037471 Ga0395905_0245857 Ga0395905_0245857_365_1135 255
541 3300037471 Ga0395905_0370543 Ga0395905_0370543_516_1286 255
542 3300037471 Ga0395905_0420554 Ga0395905_0420554_144_914 255
543 3300038443 Ga0395901_0366207 Ga0395901_0366207_333_1103 255
544 3300039093 Ga0400489_07665 Ga0400489_07665_27035_27865 255
545 3300039093 Ga0400489_32701 Ga0400489_32701_67101_67913 255
546 3300042001 Ga0439441_007092 Ga0439441_007092_597_1370 255
547 3300044901 Ga0466960_0061952 Ga0466960_0061952_1018_1788 255
548 3300045976 Ga0466967_0933504 Ga0466967_0933504_72_842 255
549 3300046460 Ga0495638_0051289 Ga0495638_0051289_1773_2540 255
550 3300046460 Ga0495638_0119102 Ga0495638_0119102_439_1206 255
551 3300046519 Ga0495632_0126054 Ga0495632_0126054_65_832 255
552 3300046616 Ga0495668_0070029 Ga0495668_0070029_939_1706 255
553 3300047443 Ga0495687_051064 Ga0495687_051064_62_829 255
554 3300048091 Ga0495626_0054808 Ga0495626_0054808_1039_1806 255
555 3300048905 Ga0496102_0328707 Ga0496102_0328707_199_969 255
556 3300048905 Ga0496102_0329255 Ga0496102_0329255_390_1172 255
557 3300048911 Ga0496108_0434467 Ga0496108_0434467_71_841 255
558 3300048913 Ga0496110_0476990 Ga0496110_0476990_226_993 255
559 3300048915 Ga0496112_0121023 Ga0496112_0121023_889_1656 255
560 3300048915 Ga0496112_0284770 Ga0496112_0284770_772_1542 255
561 3300048916 Ga0496113_0373160 Ga0496113_0373160_262_1029 255
562 3300048917 Ga0496114_0099963 Ga0496114_0099963_1345_2115 255
563 3300048920 Ga0496117_0283795 Ga0496117_0283795_56_823 255
564 3300048921 Ga0496118_0051085 Ga0496118_0051085_914_1681 255
565 3300048922 Ga0496119_0041198 Ga0496119_0041198_178_945 255
566 3300048922 Ga0496119_0043891 Ga0496119_0043891_1062_1832 255
567 3300048923 Ga0496120_0005160 Ga0496120_0005160_4307_5077 255
568 3300048923 Ga0496120_0168652 Ga0496120_0168652_60_914 255
569 3300048927 Ga0496124_0127042 Ga0496124_0127042_1088_1855 255
570 3300048928 Ga0496125_0165015 Ga0496125_0165015_371_1141 255
571 3300048929 Ga0496126_0186258 Ga0496126_0186258_929_1699 255
572 3300048929 Ga0496126_0222607 Ga0496126_0222607_684_1451 255
573 3300049569 Ga0501032_0106385 Ga0501032_0106385_610_1380 255
574 3300049571 Ga0501034_0000012 Ga0501034_0000012_266926_267696 255
575 3300049571 Ga0501034_0085484 Ga0501034_0085484_2357_3133 255
576 3300049571 Ga0501034_0123203 Ga0501034_0123203_608_1381 255
577 3300049587 Ga0501071_0337537 Ga0501071_0337537_64_894 255
578 3300049741 Ga0501079_0281738 Ga0501079_0281738_236_1006 255
579 3300050489 nmdc:mga03683_12203_c1 nmdc:mga03683_12203_c1_26_796 255
580 3300050491 nmdc:mga00v17_181398_c1 nmdc:mga00v17_181398_c1_433_1203 255
581 3300050491 nmdc:mga00v17_238519_c1 nmdc:mga00v17_238519_c1_171_938 255
582 3300050492 nmdc:mga0yw44_70391_c1 nmdc:mga0yw44_70391_c1_116_883 255
583 3300050493 nmdc:mga0k408_145240_c1 nmdc:mga0k408_145240_c1_584_1354 255
584 3300050494 nmdc:mga06z11_109288_c1 nmdc:mga06z11_109288_c1_92_865 255
585 3300050496 nmdc:mga07m45_107181_c1 nmdc:mga07m45_107181_c1_245_1012 255
586 3300053103 Ga0500555_010155 Ga0500555_010155_1361_2131 255
587 3300053139 Ga0500568_0081392 Ga0500568_0081392_281_1048 255
588 3300053151 Ga0500604_0035128 Ga0500604_0035128_443_1210 255
589 3300053731 Ga0500609_015196 Ga0500609_015196_244_1011 255
590 3300054114 Ga0501084_0175680 Ga0501084_0175680_673_1491 255
591 3300059503 Ga0587080_012430 Ga0587080_012430_69_839 255
592 3300059503 Ga0587080_021984 Ga0587080_021984_177_947 255
593 3300059647 Ga0587079_004231 Ga0587079_004231_1078_1845 255
594 iso_pu_bacteria 2503198000 2503198479 255
595 iso_pu_bacteria 2509276022 2509393534 255
596 iso_pu_bacteria 2512875024 2512962345 255
597 iso_pu_bacteria 2513237090 2513610661 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

49

204

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9026 4 233
4jbw-assembly1.cif.gz_A crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.9021 5 232
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.8992 5 232
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.8991 4 231
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.8979 5 232
ID Description Score Start End Superfamily
af_P37388_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9514 4 245 3.40.50.300
af_P37388_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9437 4 245 3.40.50.300
af_P0AAF3_1_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9334 1 243 3.40.50.300
af_P04983_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9308 4 250 3.40.50.300
af_P32721_2_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9287 4 245 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7U3CSC7-F1-model_v4 deleted 0.955 2 245
AF-A0A2T0UCU5-F1-model_v4 Monosaccharide ABC transporter ATP-binding protein (CUT2 family) 0.9539 6 246 GO:0005524
GO:0016887
AF-A0A6J6IZJ1-F1-model_v4 Unannotated protein 0.9538 1 250 GO:0005524
GO:0016887
AF-A0A3B9Q488-F1-model_v4 D-xylose ABC transporter ATP-binding protein 0.9538 4 250 GO:0005524
GO:0016887
AF-A4AIX1-F1-model_v4 ABC sugar transporter, ATPase subunit 0.9537 2 246 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.48 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map