F467649
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 597 | 286 | 1194 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100016679|Ga0075428_1000166798 |
| Length | 240 |
| Sequence | VNVQEAATAVDDDADVIELWRTADTPEALHDLPTPPSWHAAAERRIVPADWLRFETYMGEIFTALGMEVDTPGTRETPKRFLEALYDATAGYDGDPKLATLFPAESLGALEAAPSQIIEGPIPFHALCEHHALPFYGVAHVGYIADERILGISKLTRLVRLFARRFTMQERLGEQIADTLLELVGARGVAVHLEASHLCVRMRGVEEHSSTVTTFWRGAFSEPELRQEFLAEVHGRKLVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 48 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 70 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 119 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 121 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 122 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 126 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 127 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 128 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 130 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 131 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 132 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 134 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 135 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 139 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 140 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 141 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 142 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 143 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 144 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 147 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 149 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 150 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 152 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 153 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 154 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 155 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 156 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 157 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 158 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 159 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 160 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 161 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 162 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 163 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 164 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 165 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 166 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 167 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 168 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 169 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 170 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 171 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 172 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 173 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 174 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 175 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 176 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 177 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 178 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 179 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 232 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 233 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 234 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 241 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 281 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 284 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 285 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 286 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.32 |
| Metatranscriptomes | 2.18 |
| Isolates | 0.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.19 |
| Rhizosphere | 95.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075428_100016679 | 3300006844 | Bacteria | 8111 |
| 2 | Ga0070658_10058122 | 3300005327 | Bacteria | 3147 |
| 3 | Ga0070683_100160818 | 3300005329 | Bacteria | 2131 |
| 4 | Ga0070683_100605213 | 3300005329 | Bacteria | 1049 |
| 5 | Ga0068869_100254088 | 3300005334 | Bacteria | 1405 |
| 6 | Ga0070680_100085483 | 3300005336 | Bacteria | 2606 |
| 7 | Ga0070682_100056263 | 3300005337 | Bacteria | 2473 |
| 8 | Ga0070682_100120239 | 3300005337 | Bacteria | 1762 |
| 9 | Ga0070682_100307201 | 3300005337 | Bacteria | 1166 |
| 10 | Ga0070660_100398254 | 3300005339 | Bacteria | 1138 |
| 11 | Ga0070687_100100531 | 3300005343 | Unclassified | 1618 |
| 12 | Ga0070661_100156654 | 3300005344 | Bacteria | 1723 |
| 13 | Ga0070692_10095991 | 3300005345 | Bacteria | 1619 |
| 14 | Ga0070668_100070136 | 3300005347 | Bacteria | 2728 |
| 15 | Ga0070674_100105039 | 3300005356 | Bacteria | 2065 |
| 16 | Ga0070659_100196865 | 3300005366 | Bacteria | 1658 |
| 17 | Ga0070659_100217370 | 3300005366 | Bacteria | 1577 |
| 18 | Ga0070659_100988791 | 3300005366 | Unclassified | 738 |
| 19 | Ga0070714_100004052 | 3300005435 | Bacteria | 11012 |
| 20 | Ga0070714_100058356 | 3300005435 | Bacteria | 3306 |
| 21 | Ga0070713_100018400 | 3300005436 | Bacteria | 5310 |
| 22 | Ga0070713_100020135 | 3300005436 | Bacteria | 5109 |
| 23 | Ga0070701_10257787 | 3300005438 | Bacteria | 1056 |
| 24 | Ga0070711_100271674 | 3300005439 | Unclassified | 1338 |
| 25 | Ga0070705_100059305 | 3300005440 | Bacteria | 2266 |
| 26 | Ga0070700_100124258 | 3300005441 | Bacteria | 1733 |
| 27 | Ga0070663_100236803 | 3300005455 | Bacteria | 1439 |
| 28 | Ga0070662_100042485 | 3300005457 | Bacteria | 3247 |
| 29 | Ga0070681_10003538 | 3300005458 | Bacteria | 14643 |
| 30 | Ga0070681_10023352 | 3300005458 | Bacteria | 6218 |
| 31 | Ga0070681_10030043 | 3300005458 | Bacteria | 5452 |
| 32 | Ga0070681_10043809 | 3300005458 | Bacteria | 4480 |
| 33 | Ga0070681_10055488 | 3300005458 | Bacteria | 3944 |
| 34 | Ga0070681_10306479 | 3300005458 | Bacteria | 1497 |
| 35 | Ga0068867_100376582 | 3300005459 | Bacteria | 1191 |
| 36 | Ga0070706_100102426 | 3300005467 | Bacteria | 2662 |
| 37 | Ga0070707_100001400 | 3300005468 | Bacteria | 23671 |
| 38 | Ga0070707_100016023 | 3300005468 | Bacteria | 7032 |
| 39 | Ga0070698_100190121 | 3300005471 | Bacteria | 1991 |
| 40 | Ga0070698_100277338 | 3300005471 | Unclassified | 1608 |
| 41 | Ga0070698_100353219 | 3300005471 | Unclassified | 1402 |
| 42 | Ga0070699_100091769 | 3300005518 | Bacteria | 2656 |
| 43 | Ga0070679_100004720 | 3300005530 | Bacteria | 12568 |
| 44 | Ga0070679_100050694 | 3300005530 | Bacteria | 4134 |
| 45 | Ga0070679_100136818 | 3300005530 | Bacteria | 2431 |
| 46 | Ga0070679_100183451 | 3300005530 | Bacteria | 2064 |
| 47 | Ga0070679_100525362 | 3300005530 | Bacteria | 1127 |
| 48 | Ga0070684_100274695 | 3300005535 | Unclassified | 1543 |
| 49 | Ga0070684_100942240 | 3300005535 | Unclassified | 809 |
| 50 | Ga0070697_100133227 | 3300005536 | Unclassified | 2085 |
| 51 | Ga0070697_100566553 | 3300005536 | Bacteria | 997 |
| 52 | Ga0068853_100167182 | 3300005539 | Bacteria | 1988 |
| 53 | Ga0070686_100247317 | 3300005544 | Bacteria | 1301 |
| 54 | Ga0070695_100000062 | 3300005545 | Bacteria | 43594 |
| 55 | Ga0070696_100386300 | 3300005546 | Bacteria | 1092 |
| 56 | Ga0070693_100030131 | 3300005547 | Bacteria | 2965 |
| 57 | Ga0070693_100124594 | 3300005547 | Bacteria | 1602 |
| 58 | Ga0070693_100228503 | 3300005547 | Bacteria | 1223 |
| 59 | Ga0070665_100581685 | 3300005548 | Bacteria | 1133 |
| 60 | Ga0068855_100152251 | 3300005563 | Bacteria | 2629 |
| 61 | Ga0068855_100453966 | 3300005563 | Bacteria | 1398 |
| 62 | Ga0068855_100652622 | 3300005563 | Unclassified | 1130 |
| 63 | Ga0068857_100160534 | 3300005577 | Bacteria | 2040 |
| 64 | Ga0068857_100213266 | 3300005577 | Bacteria | 1762 |
| 65 | Ga0068856_100033190 | 3300005614 | Bacteria | 5054 |
| 66 | Ga0068856_100088253 | 3300005614 | Bacteria | 3083 |
| 67 | Ga0068856_100201296 | 3300005614 | Unclassified | 2006 |
| 68 | Ga0070702_100025480 | 3300005615 | Bacteria | 3170 |
| 69 | Ga0068852_100041474 | 3300005616 | Bacteria | 3890 |
| 70 | Ga0068852_100059891 | 3300005616 | Bacteria | 3304 |
| 71 | Ga0068852_101127886 | 3300005616 | Unclassified | 805 |
| 72 | Ga0068861_100249323 | 3300005719 | Bacteria | 1514 |
| 73 | Ga0068863_100085078 | 3300005841 | Bacteria | 2997 |
| 74 | Ga0068863_101068740 | 3300005841 | Bacteria | 811 |
| 75 | Ga0070717_10019632 | 3300006028 | Bacteria | 5304 |
| 76 | Ga0070717_10218265 | 3300006028 | Bacteria | 1675 |
| 77 | Ga0070717_10277275 | 3300006028 | Bacteria | 1486 |
| 78 | Ga0070717_10524451 | 3300006028 | Bacteria | 1072 |
| 79 | Ga0075432_10000461 | 3300006058 | Bacteria | 12043 |
| 80 | Ga0070712_100034964 | 3300006175 | Bacteria | 3408 |
| 81 | Ga0075428_100002927 | 3300006844 | Bacteria | 18606 |
| 82 | Ga0075430_100017091 | 3300006846 | Bacteria | 6180 |
| 83 | Ga0075430_100300246 | 3300006846 | Bacteria | 1328 |
| 84 | Ga0075431_100127465 | 3300006847 | Bacteria | 2626 |
| 85 | Ga0075434_100036845 | 3300006871 | Bacteria | 4839 |
| 86 | Ga0075434_100421601 | 3300006871 | Bacteria | 1356 |
| 87 | Ga0075429_100040850 | 3300006880 | Bacteria | 4038 |
| 88 | Ga0075436_100269749 | 3300006914 | Bacteria | 1215 |
| 89 | Ga0105240_10009653 | 3300009093 | Bacteria | 13646 |
| 90 | Ga0111539_10004184 | 3300009094 | Bacteria | 18936 |
| 91 | Ga0111539_10055617 | 3300009094 | Bacteria | 4704 |
| 92 | Ga0111539_10066203 | 3300009094 | Bacteria | 4267 |
| 93 | Ga0111539_10541230 | 3300009094 | Bacteria | 1356 |
| 94 | Ga0111539_10793758 | 3300009094 | Unclassified | 1102 |
| 95 | Ga0105245_10001379 | 3300009098 | Bacteria | 21999 |
| 96 | Ga0105245_10189447 | 3300009098 | Bacteria | 1969 |
| 97 | Ga0114129_10026232 | 3300009147 | Bacteria | 8253 |
| 98 | Ga0114129_10228502 | 3300009147 | Bacteria | 2507 |
| 99 | Ga0114129_10335419 | 3300009147 | Unclassified | 2007 |
| 100 | Ga0114129_10572581 | 3300009147 | Bacteria | 1466 |
| 101 | Ga0114129_10580879 | 3300009147 | Bacteria | 1454 |
| 102 | Ga0114129_11260233 | 3300009147 | Bacteria | 918 |
| 103 | Ga0114129_11320351 | 3300009147 | Unclassified | 893 |
| 104 | Ga0105241_10679157 | 3300009174 | Unclassified | 938 |
| 105 | Ga0105248_10338034 | 3300009177 | Bacteria | 1695 |
| 106 | Ga0105237_10018792 | 3300009545 | Bacteria | 7148 |
| 107 | Ga0105237_10137338 | 3300009545 | Bacteria | 2439 |
| 108 | Ga0105237_10387975 | 3300009545 | Bacteria | 1401 |
| 109 | Ga0105238_10267696 | 3300009551 | Unclassified | 1689 |
| 110 | Ga0105238_10286853 | 3300009551 | Bacteria | 1628 |
| 111 | Ga0105239_10050860 | 3300010375 | Bacteria | 4544 |
| 112 | Ga0105239_10241824 | 3300010375 | Bacteria | 2026 |
| 113 | Ga0105239_10719920 | 3300010375 | Bacteria | 1141 |
| 114 | Ga0105239_11404775 | 3300010375 | Bacteria | 806 |
| 115 | Ga0105246_10056879 | 3300011119 | Bacteria | 2705 |
| 116 | Ga0105246_10253016 | 3300011119 | Unclassified | 1399 |
| 117 | Ga0157371_10321143 | 3300013102 | Bacteria | 1124 |
| 118 | Ga0157371_10329914 | 3300013102 | Bacteria | 1108 |
| 119 | Ga0157370_10283123 | 3300013104 | Unclassified | 1532 |
| 120 | Ga0157369_10013919 | 3300013105 | Bacteria | 9089 |
| 121 | Ga0157369_10163133 | 3300013105 | Bacteria | 2351 |
| 122 | Ga0157369_10691838 | 3300013105 | Bacteria | 1050 |
| 123 | Ga0157374_10062002 | 3300013296 | Bacteria | 3503 |
| 124 | Ga0157374_10123235 | 3300013296 | Bacteria | 2504 |
| 125 | Ga0163162_11110792 | 3300013306 | Bacteria | 896 |
| 126 | Ga0157372_10011775 | 3300013307 | Bacteria | 9317 |
| 127 | Ga0157372_10118172 | 3300013307 | Bacteria | 3042 |
| 128 | Ga0157372_10148286 | 3300013307 | Bacteria | 2706 |
| 129 | Ga0157372_11345031 | 3300013307 | Unclassified | 824 |
| 130 | Ga0157375_10345948 | 3300013308 | Unclassified | 1652 |
| 131 | Ga0182008_10033388 | 3300014497 | Bacteria | 2582 |
| 132 | Ga0157377_10003916 | 3300014745 | Bacteria | 6784 |
| 133 | Ga0157377_10606714 | 3300014745 | Unclassified | 781 |
| 134 | Ga0157379_10830556 | 3300014968 | Unclassified | 873 |
| 135 | Ga0157376_10029992 | 3300014969 | Bacteria | 4336 |
| 136 | Ga0197907_11490640 | 3300020069 | Bacteria | 1405 |
| 137 | Ga0206356_10224714 | 3300020070 | Bacteria | 1857 |
| 138 | Ga0206356_10474531 | 3300020070 | Bacteria | 3690 |
| 139 | Ga0206356_11724424 | 3300020070 | Bacteria | 1947 |
| 140 | Ga0206350_11402943 | 3300020080 | Bacteria | 1765 |
| 141 | Ga0206354_10376445 | 3300020081 | Bacteria | 1319 |
| 142 | Ga0206353_10414071 | 3300020082 | Bacteria | 1293 |
| 143 | Ga0206353_11003959 | 3300020082 | Bacteria | 1038 |
| 144 | Ga0224712_10004721 | 3300022467 | Bacteria | 3709 |
| 145 | Ga0224712_10074500 | 3300022467 | Bacteria | 1387 |
| 146 | Ga0224712_10105412 | 3300022467 | Bacteria | 1202 |
| 147 | Ga0224712_10166574 | 3300022467 | Bacteria | 986 |
| 148 | Ga0207692_10192016 | 3300025898 | Bacteria | 1196 |
| 149 | Ga0207688_10000393 | 3300025901 | Bacteria | 20500 |
| 150 | Ga0207680_10486881 | 3300025903 | Bacteria | 878 |
| 151 | Ga0207705_10024249 | 3300025909 | Bacteria | 4330 |
| 152 | Ga0207705_10027780 | 3300025909 | Bacteria | 4035 |
| 153 | Ga0207705_10227663 | 3300025909 | Bacteria | 1417 |
| 154 | Ga0207684_10036436 | 3300025910 | Bacteria | 4175 |
| 155 | Ga0207684_10072052 | 3300025910 | Bacteria | 2936 |
| 156 | Ga0207684_10297242 | 3300025910 | Bacteria | 1392 |
| 157 | Ga0207707_10080506 | 3300025912 | Bacteria | 2844 |
| 158 | Ga0207707_10189309 | 3300025912 | Bacteria | 1795 |
| 159 | Ga0207695_10038896 | 3300025913 | Bacteria | 5116 |
| 160 | Ga0207671_10182988 | 3300025914 | Bacteria | 1631 |
| 161 | Ga0207671_10526319 | 3300025914 | Bacteria | 943 |
| 162 | Ga0207693_10001177 | 3300025915 | Bacteria | 23356 |
| 163 | Ga0207693_10242776 | 3300025915 | Bacteria | 1414 |
| 164 | Ga0207660_10133765 | 3300025917 | Bacteria | 1890 |
| 165 | Ga0207662_10091161 | 3300025918 | Bacteria | 1875 |
| 166 | Ga0207657_10015199 | 3300025919 | Bacteria | 7469 |
| 167 | Ga0207649_10032226 | 3300025920 | Bacteria | 3122 |
| 168 | Ga0207652_10056165 | 3300025921 | Bacteria | 3389 |
| 169 | Ga0207652_10092230 | 3300025921 | Bacteria | 2664 |
| 170 | Ga0207652_10110359 | 3300025921 | Bacteria | 2439 |
| 171 | Ga0207652_10183993 | 3300025921 | Bacteria | 1878 |
| 172 | Ga0207652_10254743 | 3300025921 | Bacteria | 1583 |
| 173 | Ga0207646_10006489 | 3300025922 | Bacteria | 12075 |
| 174 | Ga0207646_10016070 | 3300025922 | Bacteria | 7032 |
| 175 | Ga0207687_10042669 | 3300025927 | Bacteria | 3122 |
| 176 | Ga0207687_10189770 | 3300025927 | Bacteria | 1599 |
| 177 | Ga0207687_10212103 | 3300025927 | Bacteria | 1520 |
| 178 | Ga0207687_10454374 | 3300025927 | Bacteria | 1063 |
| 179 | Ga0207700_10067042 | 3300025928 | Bacteria | 2745 |
| 180 | Ga0207700_10152037 | 3300025928 | Bacteria | 1914 |
| 181 | Ga0207664_10044649 | 3300025929 | Bacteria | 3471 |
| 182 | Ga0207664_10051444 | 3300025929 | Bacteria | 3253 |
| 183 | Ga0207644_10028529 | 3300025931 | Bacteria | 3865 |
| 184 | Ga0207690_10072554 | 3300025932 | Bacteria | 2378 |
| 185 | Ga0207690_10573988 | 3300025932 | Unclassified | 919 |
| 186 | Ga0207706_10050042 | 3300025933 | Bacteria | 3693 |
| 187 | Ga0207706_10846155 | 3300025933 | Bacteria | 775 |
| 188 | Ga0207704_10018883 | 3300025938 | Bacteria | 3610 |
| 189 | Ga0207691_10349012 | 3300025940 | Bacteria | 1266 |
| 190 | Ga0207661_10059637 | 3300025944 | Bacteria | 3076 |
| 191 | Ga0207661_10064681 | 3300025944 | Bacteria | 2966 |
| 192 | Ga0207661_10509890 | 3300025944 | Unclassified | 1099 |
| 193 | Ga0207661_10642312 | 3300025944 | Bacteria | 975 |
| 194 | Ga0207679_10249920 | 3300025945 | Bacteria | 1507 |
| 195 | Ga0207667_10272250 | 3300025949 | Bacteria | 1731 |
| 196 | Ga0207667_10325209 | 3300025949 | Bacteria | 1570 |
| 197 | Ga0207667_10523142 | 3300025949 | Unclassified | 1202 |
| 198 | Ga0207651_10222420 | 3300025960 | Bacteria | 1527 |
| 199 | Ga0207668_10098880 | 3300025972 | Bacteria | 2163 |
| 200 | Ga0207668_10419422 | 3300025972 | Bacteria | 1136 |
| 201 | Ga0207640_10141446 | 3300025981 | Bacteria | 1755 |
| 202 | Ga0207658_10241428 | 3300025986 | Bacteria | 1531 |
| 203 | Ga0207678_10373963 | 3300026067 | Bacteria | 1231 |
| 204 | Ga0207708_10077242 | 3300026075 | Bacteria | 2555 |
| 205 | Ga0207702_10122937 | 3300026078 | Bacteria | 2325 |
| 206 | Ga0207702_10164293 | 3300026078 | Unclassified | 2029 |
| 207 | Ga0207641_10240119 | 3300026088 | Bacteria | 1688 |
| 208 | Ga0207648_10451801 | 3300026089 | Bacteria | 1170 |
| 209 | Ga0207674_10003198 | 3300026116 | Bacteria | 20166 |
| 210 | Ga0207674_10067732 | 3300026116 | Bacteria | 3593 |
| 211 | Ga0207674_10655525 | 3300026116 | Bacteria | 1014 |
| 212 | Ga0207675_100147961 | 3300026118 | Bacteria | 2234 |
| 213 | Ga0207698_10063445 | 3300026142 | Bacteria | 2891 |
| 214 | Ga0207428_10000196 | 3300027907 | Bacteria | 84609 |
| 215 | Ga0207428_10008352 | 3300027907 | Bacteria | 9355 |
| 216 | Ga0207428_10067860 | 3300027907 | Unclassified | 2807 |
| 217 | Ga0207428_10137671 | 3300027907 | Bacteria | 1866 |
| 218 | Ga0207428_10651355 | 3300027907 | Bacteria | 756 |
| 219 | Ga0265319_1003263 | 3300028563 | Bacteria | 8538 |
| 220 | Ga0265319_1025988 | 3300028563 | Bacteria | 2090 |
| 221 | Ga0265334_10005333 | 3300028573 | Bacteria | 5618 |
| 222 | Ga0265334_10048256 | 3300028573 | Bacteria | 1640 |
| 223 | Ga0265318_10007631 | 3300028577 | Bacteria | 4872 |
| 224 | Ga0265322_10041621 | 3300028654 | Unclassified | 1308 |
| 225 | Ga0265336_10023906 | 3300028666 | Unclassified | 1934 |
| 226 | Ga0265336_10030451 | 3300028666 | Unclassified | 1680 |
| 227 | Ga0265338_10005100 | 3300028800 | Bacteria | 17325 |
| 228 | Ga0265338_10010298 | 3300028800 | Bacteria | 10988 |
| 229 | Ga0265338_10171299 | 3300028800 | Unclassified | 1664 |
| 230 | Ga0265338_10328811 | 3300028800 | Bacteria | 1104 |
| 231 | Ga0265324_10005245 | 3300029957 | Bacteria | 5636 |
| 232 | Ga0265320_10008292 | 3300031240 | Bacteria | 6364 |
| 233 | Ga0265329_10053788 | 3300031242 | Bacteria | 1279 |
| 234 | Ga0265340_10004374 | 3300031247 | Bacteria | 7910 |
| 235 | Ga0265339_10004548 | 3300031249 | Bacteria | 9442 |
| 236 | Ga0265339_10153415 | 3300031249 | Unclassified | 1163 |
| 237 | Ga0265327_10031711 | 3300031251 | Bacteria | 2966 |
| 238 | Ga0265316_10094519 | 3300031344 | Bacteria | 2277 |
| 239 | Ga0265316_10378938 | 3300031344 | Unclassified | 1021 |
| 240 | Ga0265313_10006513 | 3300031595 | Bacteria | 8249 |
| 241 | Ga0265313_10088361 | 3300031595 | Unclassified | 1395 |
| 242 | Ga0265314_10001285 | 3300031711 | Bacteria | 28515 |
| 243 | Ga0265342_10016174 | 3300031712 | Bacteria | 4882 |
| 244 | Ga0316577_10001616 | 3300031733 | Bacteria | 10751 |
| 245 | Ga0307412_10262243 | 3300031911 | Unclassified | 1348 |
| 246 | Ga0307409_100015275 | 3300031995 | Bacteria | 5033 |
| 247 | Ga0307416_100394456 | 3300032002 | Bacteria | 1419 |
| 248 | Ga0307416_100968447 | 3300032002 | Unclassified | 953 |
| 249 | Ga0307411_10348116 | 3300032005 | Unclassified | 1207 |
| 250 | Ga0307415_100044361 | 3300032126 | Bacteria | 2972 |
| 251 | Ga0307415_100433220 | 3300032126 | Bacteria | 1132 |
| 252 | Ga0373938_0077403 | 3300034957 | Bacteria | 805 |
| 253 | Ga0373945_0013493 | 3300035116 | Bacteria | 2728 |
| 254 | Ga0373960_0035608 | 3300035121 | Bacteria | 1414 |
| 255 | Ga0373943_0041390 | 3300035170 | Bacteria | 2228 |
| 256 | Ga0373942_0068279 | 3300035207 | Bacteria | 1033 |
| 257 | Ga0373935_0109458 | 3300035692 | Bacteria | 1832 |
| 258 | Ga0373933_0036898 | 3300035724 | Bacteria | 2864 |
| 259 | Ga0373933_0166252 | 3300035724 | Unclassified | 1402 |
| 260 | Ga0373937_0100779 | 3300036401 | Unclassified | 2680 |
| 261 | Ga0373937_0103368 | 3300036401 | Bacteria | 2646 |
| 262 | Ga0373937_0224491 | 3300036401 | Bacteria | 1768 |
| 263 | Ga0316582_0025946 | 3300036647 | Bacteria | 3523 |
| 264 | Ga0316584_0012386 | 3300036712 | Bacteria | 6013 |
| 265 | Ga0373925_0020725 | 3300037068 | Bacteria | 4789 |
| 266 | Ga0373925_0412009 | 3300037068 | Bacteria | 1103 |
| 267 | Ga0395899_0356477 | 3300037312 | Unclassified | 977 |
| 268 | Ga0395901_0243648 | 3300038443 | Bacteria | 1874 |
| 269 | Ga0395901_0282417 | 3300038443 | Bacteria | 1724 |
| 270 | Ga0439439_0000336 | 3300041406 | Bacteria | 7587 |
| 271 | Ga0439439_0075496 | 3300041406 | Bacteria | 906 |
| 272 | Ga0439461_0037718 | 3300041410 | Bacteria | 1033 |
| 273 | Ga0451793_1793102 | 3300041452 | Unclassified | 960 |
| 274 | Ga0451807_0736736 | 3300041486 | Bacteria | 1140 |
| 275 | Ga0439433_0010208 | 3300041999 | Bacteria | 2050 |
| 276 | Ga0439448_0042803 | 3300042005 | Bacteria | 1469 |
| 277 | Ga0439449_0041538 | 3300042007 | Bacteria | 1710 |
| 278 | Ga0439462_0005260 | 3300042015 | Bacteria | 3188 |
| 279 | Ga0439446_0014481 | 3300042156 | Bacteria | 2177 |
| 280 | Ga0439446_0034044 | 3300042156 | Bacteria | 1481 |
| 281 | Ga0439434_0006125 | 3300042435 | Bacteria | 3507 |
| 282 | Ga0439434_0009366 | 3300042435 | Bacteria | 2878 |
| 283 | Ga0451577_0090388 | 3300042876 | Unclassified | 2733 |
| 284 | Ga0451577_0205994 | 3300042876 | Bacteria | 1776 |
| 285 | Ga0466969_0089276 | 3300044656 | Unclassified | 1462 |
| 286 | Ga0453683_0000355 | 3300044673 | Bacteria | 55441 |
| 287 | Ga0453683_0087180 | 3300044673 | Bacteria | 1956 |
| 288 | Ga0453683_0126211 | 3300044673 | Bacteria | 1611 |
| 289 | Ga0466965_0061647 | 3300044683 | Unclassified | 1875 |
| 290 | Ga0466965_0076404 | 3300044683 | Unclassified | 1690 |
| 291 | Ga0466965_0147272 | 3300044683 | Bacteria | 1229 |
| 292 | Ga0466961_0004361 | 3300044693 | Bacteria | 8863 |
| 293 | Ga0466961_0013977 | 3300044693 | Bacteria | 5145 |
| 294 | Ga0466961_0014149 | 3300044693 | Bacteria | 5118 |
| 295 | Ga0466963_0000776 | 3300044694 | Bacteria | 15852 |
| 296 | Ga0466963_0003553 | 3300044694 | Bacteria | 8953 |
| 297 | Ga0466963_0004108 | 3300044694 | Bacteria | 8419 |
| 298 | Ga0466963_0005116 | 3300044694 | Bacteria | 7660 |
| 299 | Ga0466963_0007687 | 3300044694 | Bacteria | 6436 |
| 300 | Ga0466963_0016673 | 3300044694 | Bacteria | 4570 |
| 301 | Ga0466963_0019292 | 3300044694 | Bacteria | 4274 |
| 302 | Ga0466963_0053952 | 3300044694 | Bacteria | 2670 |
| 303 | Ga0466963_0104859 | 3300044694 | Unclassified | 1937 |
| 304 | Ga0466963_0139037 | 3300044694 | Bacteria | 1681 |
| 305 | Ga0466963_0188183 | 3300044694 | Bacteria | 1442 |
| 306 | Ga0466963_0438846 | 3300044694 | Bacteria | 921 |
| 307 | Ga0466963_0538526 | 3300044694 | Bacteria | 824 |
| 308 | Ga0466963_0666977 | 3300044694 | Bacteria | 734 |
| 309 | Ga0466964_0005456 | 3300044706 | Bacteria | 4721 |
| 310 | Ga0466964_0012712 | 3300044706 | Bacteria | 3187 |
| 311 | Ga0466964_0083652 | 3300044706 | Bacteria | 1374 |
| 312 | Ga0466964_0108999 | 3300044706 | Bacteria | 1232 |
| 313 | Ga0466964_0284868 | 3300044706 | Bacteria | 827 |
| 314 | Ga0453684_0045770 | 3300044712 | Bacteria | 5830 |
| 315 | Ga0453684_0365527 | 3300044712 | Bacteria | 1623 |
| 316 | Ga0453684_0555865 | 3300044712 | Unclassified | 1264 |
| 317 | Ga0466971_0002654 | 3300044719 | Bacteria | 7552 |
| 318 | Ga0466971_0033734 | 3300044719 | Unclassified | 2293 |
| 319 | Ga0466971_0035954 | 3300044719 | Bacteria | 2221 |
| 320 | Ga0466971_0398143 | 3300044719 | Bacteria | 671 |
| 321 | Ga0466971_0421808 | 3300044719 | Bacteria | 652 |
| 322 | Ga0466968_0003607 | 3300044735 | Bacteria | 5731 |
| 323 | Ga0466968_0006451 | 3300044735 | Bacteria | 4423 |
| 324 | Ga0466968_0008472 | 3300044735 | Bacteria | 3939 |
| 325 | Ga0466968_0032693 | 3300044735 | Unclassified | 2165 |
| 326 | Ga0466968_0066037 | 3300044735 | Bacteria | 1567 |
| 327 | Ga0466970_0033054 | 3300044765 | Bacteria | 2734 |
| 328 | Ga0466957_0002250 | 3300044842 | Bacteria | 10336 |
| 329 | Ga0466957_0006059 | 3300044842 | Bacteria | 6826 |
| 330 | Ga0466957_0016735 | 3300044842 | Bacteria | 4289 |
| 331 | Ga0466957_0020828 | 3300044842 | Bacteria | 3858 |
| 332 | Ga0466957_0111481 | 3300044842 | Bacteria | 1735 |
| 333 | Ga0466959_0001728 | 3300045049 | Bacteria | 13579 |
| 334 | Ga0466959_0040638 | 3300045049 | Bacteria | 3435 |
| 335 | Ga0466959_0578602 | 3300045049 | Unclassified | 756 |
| 336 | Ga0451576_0086028 | 3300045051 | Bacteria | 3270 |
| 337 | Ga0466958_0002506 | 3300045836 | Bacteria | 9254 |
| 338 | Ga0466958_0032534 | 3300045836 | Bacteria | 3103 |
| 339 | Ga0466958_0089662 | 3300045836 | Bacteria | 1901 |
| 340 | Ga0466958_0126669 | 3300045836 | Bacteria | 1601 |
| 341 | Ga0466958_0206977 | 3300045836 | Bacteria | 1249 |
| 342 | Ga0466967_0001226 | 3300045976 | Bacteria | 14472 |
| 343 | Ga0466967_0002310 | 3300045976 | Bacteria | 11778 |
| 344 | Ga0466967_0004340 | 3300045976 | Bacteria | 9538 |
| 345 | Ga0466967_0004811 | 3300045976 | Bacteria | 9203 |
| 346 | Ga0466967_0018003 | 3300045976 | Bacteria | 5633 |
| 347 | Ga0466967_0034211 | 3300045976 | Bacteria | 4310 |
| 348 | Ga0466967_0037090 | 3300045976 | Bacteria | 4168 |
| 349 | Ga0466967_0038655 | 3300045976 | Bacteria | 4094 |
| 350 | Ga0466967_0048143 | 3300045976 | Bacteria | 3721 |
| 351 | Ga0466967_0053771 | 3300045976 | Bacteria | 3541 |
| 352 | Ga0466967_0062801 | 3300045976 | Bacteria | 3298 |
| 353 | Ga0466967_0094468 | 3300045976 | Bacteria | 2723 |
| 354 | Ga0466967_0111819 | 3300045976 | Unclassified | 2510 |
| 355 | Ga0466967_0142246 | 3300045976 | Bacteria | 2235 |
| 356 | Ga0466967_0238705 | 3300045976 | Bacteria | 1733 |
| 357 | Ga0466967_0317202 | 3300045976 | Bacteria | 1502 |
| 358 | Ga0466967_0711086 | 3300045976 | Bacteria | 995 |
| 359 | Ga0495592_0000100 | 3300046454 | Bacteria | 76535 |
| 360 | Ga0495592_0201514 | 3300046454 | Bacteria | 1343 |
| 361 | Ga0495592_0243036 | 3300046454 | Unclassified | 1193 |
| 362 | Ga0495592_0247620 | 3300046454 | Unclassified | 1179 |
| 363 | Ga0495603_0030547 | 3300046455 | Bacteria | 3244 |
| 364 | Ga0495603_0054576 | 3300046455 | Bacteria | 2368 |
| 365 | Ga0495629_0005062 | 3300046459 | Bacteria | 9864 |
| 366 | Ga0495629_0136383 | 3300046459 | Bacteria | 1708 |
| 367 | Ga0495641_0039812 | 3300046461 | Unclassified | 2189 |
| 368 | Ga0495641_0052686 | 3300046461 | Bacteria | 1854 |
| 369 | Ga0495641_0160606 | 3300046461 | Bacteria | 1005 |
| 370 | Ga0495651_0000008 | 3300046462 | Bacteria | 156989 |
| 371 | Ga0495651_0018513 | 3300046462 | Bacteria | 5395 |
| 372 | Ga0495651_0303549 | 3300046462 | Bacteria | 1070 |
| 373 | Ga0495651_0342894 | 3300046462 | Unclassified | 989 |
| 374 | Ga0495653_0000519 | 3300046463 | Bacteria | 29635 |
| 375 | Ga0495653_0005446 | 3300046463 | Bacteria | 10372 |
| 376 | Ga0495653_0039592 | 3300046463 | Bacteria | 3691 |
| 377 | Ga0495653_0098586 | 3300046463 | Unclassified | 2122 |
| 378 | Ga0495653_0192384 | 3300046463 | Bacteria | 1391 |
| 379 | Ga0495580_0345308 | 3300046472 | Bacteria | 1009 |
| 380 | Ga0495582_0073767 | 3300046473 | Bacteria | 1889 |
| 381 | Ga0495582_0363109 | 3300046473 | Bacteria | 834 |
| 382 | Ga0495664_0002921 | 3300046477 | Bacteria | 9224 |
| 383 | Ga0495664_0030604 | 3300046477 | Bacteria | 3154 |
| 384 | Ga0495664_0083209 | 3300046477 | Unclassified | 1920 |
| 385 | Ga0495664_0370754 | 3300046477 | Bacteria | 861 |
| 386 | Ga0495584_0039698 | 3300046491 | Unclassified | 2378 |
| 387 | Ga0495585_0147405 | 3300046492 | Unclassified | 1229 |
| 388 | Ga0495594_0183658 | 3300046499 | Bacteria | 1191 |
| 389 | Ga0495608_0004506 | 3300046511 | Bacteria | 9951 |
| 390 | Ga0495608_0010256 | 3300046511 | Bacteria | 6537 |
| 391 | Ga0495608_0094172 | 3300046511 | Bacteria | 1935 |
| 392 | Ga0495608_0132521 | 3300046511 | Unclassified | 1594 |
| 393 | Ga0495608_0276092 | 3300046511 | Unclassified | 1044 |
| 394 | Ga0495618_0001843 | 3300046514 | Bacteria | 13974 |
| 395 | Ga0495618_0090259 | 3300046514 | Unclassified | 1959 |
| 396 | Ga0495628_0000016 | 3300046516 | Bacteria | 170260 |
| 397 | Ga0495628_0075298 | 3300046516 | Bacteria | 2629 |
| 398 | Ga0495628_0171601 | 3300046516 | Bacteria | 1644 |
| 399 | Ga0495628_0310357 | 3300046516 | Bacteria | 1166 |
| 400 | Ga0495630_0112768 | 3300046517 | Unclassified | 2059 |
| 401 | Ga0495630_0229105 | 3300046517 | Unclassified | 1419 |
| 402 | Ga0495637_0041820 | 3300046520 | Unclassified | 1964 |
| 403 | Ga0495644_0003153 | 3300046523 | Bacteria | 6522 |
| 404 | Ga0495666_0007834 | 3300046526 | Bacteria | 5350 |
| 405 | Ga0495642_0186019 | 3300046528 | Unclassified | 904 |
| 406 | Ga0495652_0000888 | 3300046529 | Bacteria | 34393 |
| 407 | Ga0495652_0046605 | 3300046529 | Bacteria | 3720 |
| 408 | Ga0495652_0077880 | 3300046529 | Bacteria | 2746 |
| 409 | Ga0495652_0117092 | 3300046529 | Bacteria | 2132 |
| 410 | Ga0495652_0140207 | 3300046529 | Bacteria | 1902 |
| 411 | Ga0495652_0250232 | 3300046529 | Unclassified | 1314 |
| 412 | Ga0495640_0047430 | 3300046533 | Bacteria | 2973 |
| 413 | Ga0495640_0172364 | 3300046533 | Bacteria | 1382 |
| 414 | Ga0495586_0104232 | 3300046535 | Bacteria | 1576 |
| 415 | Ga0495587_0000048 | 3300046536 | Bacteria | 105358 |
| 416 | Ga0495587_0006780 | 3300046536 | Bacteria | 7455 |
| 417 | Ga0495609_0120141 | 3300046538 | Unclassified | 1130 |
| 418 | Ga0495645_0000029 | 3300046543 | Bacteria | 113119 |
| 419 | Ga0495645_0106935 | 3300046543 | Bacteria | 1983 |
| 420 | Ga0495645_0130067 | 3300046543 | Unclassified | 1765 |
| 421 | Ga0495667_0010500 | 3300046559 | Bacteria | 6266 |
| 422 | Ga0495667_0077815 | 3300046559 | Bacteria | 2157 |
| 423 | Ga0495667_0090953 | 3300046559 | Bacteria | 1977 |
| 424 | Ga0495667_0136897 | 3300046559 | Unclassified | 1579 |
| 425 | Ga0495667_0305126 | 3300046559 | Bacteria | 1008 |
| 426 | Ga0495667_0463528 | 3300046559 | Bacteria | 795 |
| 427 | Ga0495668_0141400 | 3300046616 | Unclassified | 1317 |
| 428 | Ga0495634_0034560 | 3300046642 | Bacteria | 3468 |
| 429 | Ga0495634_0039971 | 3300046642 | Bacteria | 3192 |
| 430 | Ga0495611_0041340 | 3300046648 | Bacteria | 2056 |
| 431 | Ga0495635_0014662 | 3300046663 | Bacteria | 5483 |
| 432 | Ga0495635_0040523 | 3300046663 | Bacteria | 3218 |
| 433 | Ga0495635_0295439 | 3300046663 | Unclassified | 1086 |
| 434 | Ga0495635_0333185 | 3300046663 | Unclassified | 1014 |
| 435 | Ga0495588_0063384 | 3300046674 | Unclassified | 1917 |
| 436 | Ga0495657_0007230 | 3300046675 | Bacteria | 8606 |
| 437 | Ga0495657_0009916 | 3300046675 | Bacteria | 7187 |
| 438 | Ga0495657_0132909 | 3300046675 | Bacteria | 1557 |
| 439 | Ga0495657_0151961 | 3300046675 | Bacteria | 1437 |
| 440 | Ga0495657_0232777 | 3300046675 | Unclassified | 1114 |
| 441 | Ga0495599_0000181 | 3300046678 | Bacteria | 41303 |
| 442 | Ga0495599_0031839 | 3300046678 | Bacteria | 3310 |
| 443 | Ga0495599_0251985 | 3300046678 | Bacteria | 1074 |
| 444 | Ga0495599_0424923 | 3300046678 | Bacteria | 789 |
| 445 | Ga0495599_0479058 | 3300046678 | Bacteria | 734 |
| 446 | Ga0495623_0000093 | 3300046679 | Bacteria | 53441 |
| 447 | Ga0495646_0000416 | 3300046680 | Bacteria | 22540 |
| 448 | Ga0495647_0036172 | 3300046681 | Unclassified | 1857 |
| 449 | Ga0495658_0001970 | 3300046683 | Bacteria | 10482 |
| 450 | Ga0495658_0122732 | 3300046683 | Bacteria | 1573 |
| 451 | Ga0495658_0358146 | 3300046683 | Bacteria | 928 |
| 452 | Ga0495613_0007818 | 3300046689 | Bacteria | 7953 |
| 453 | Ga0495613_0025593 | 3300046689 | Bacteria | 4397 |
| 454 | Ga0495613_0359485 | 3300046689 | Bacteria | 999 |
| 455 | Ga0495624_0024422 | 3300046690 | Bacteria | 3977 |
| 456 | Ga0495624_0064946 | 3300046690 | Unclassified | 2280 |
| 457 | Ga0495589_0075441 | 3300046794 | Unclassified | 1644 |
| 458 | Ga0495600_0009227 | 3300046809 | Bacteria | 6086 |
| 459 | Ga0495600_0086191 | 3300046809 | Bacteria | 2049 |
| 460 | Ga0495600_0232319 | 3300046809 | Bacteria | 1177 |
| 461 | Ga0495581_0105731 | 3300047315 | Bacteria | 1636 |
| 462 | Ga0495581_0414681 | 3300047315 | Unclassified | 785 |
| 463 | Ga0495604_0000111 | 3300047317 | Bacteria | 68576 |
| 464 | Ga0495604_0022514 | 3300047317 | Bacteria | 5031 |
| 465 | Ga0495674_0059023 | 3300047319 | Bacteria | 3352 |
| 466 | Ga0495674_0656581 | 3300047319 | Unclassified | 826 |
| 467 | Ga0495674_0826089 | 3300047319 | Bacteria | 719 |
| 468 | Ga0495680_0005070 | 3300047322 | Bacteria | 12432 |
| 469 | Ga0495680_0028517 | 3300047322 | Bacteria | 4576 |
| 470 | Ga0495680_0030561 | 3300047322 | Bacteria | 4397 |
| 471 | Ga0495680_0065989 | 3300047322 | Bacteria | 2771 |
| 472 | Ga0495680_0087088 | 3300047322 | Unclassified | 2350 |
| 473 | Ga0495680_0552254 | 3300047322 | Unclassified | 776 |
| 474 | Ga0495675_0000376 | 3300047444 | Bacteria | 30923 |
| 475 | Ga0495675_0156431 | 3300047444 | Bacteria | 1406 |
| 476 | Ga0495684_0003775 | 3300047471 | Bacteria | 11830 |
| 477 | Ga0495684_0310005 | 3300047471 | Bacteria | 1131 |
| 478 | Ga0495684_0405656 | 3300047471 | Bacteria | 956 |
| 479 | Ga0495593_0004272 | 3300047673 | Bacteria | 8496 |
| 480 | Ga0495602_0000141 | 3300048088 | Bacteria | 67940 |
| 481 | Ga0495602_0013005 | 3300048088 | Bacteria | 8518 |
| 482 | Ga0495602_0162177 | 3300048088 | Bacteria | 1744 |
| 483 | Ga0496100_0205444 | 3300048903 | Bacteria | 1438 |
| 484 | Ga0496100_0606052 | 3300048903 | Bacteria | 851 |
| 485 | Ga0496102_0121185 | 3300048905 | Bacteria | 2443 |
| 486 | Ga0496102_0210205 | 3300048905 | Bacteria | 1835 |
| 487 | Ga0496103_0243440 | 3300048906 | Unclassified | 1157 |
| 488 | Ga0496104_0013704 | 3300048907 | Bacteria | 7310 |
| 489 | Ga0496104_0014178 | 3300048907 | Bacteria | 7192 |
| 490 | Ga0496104_0137453 | 3300048907 | Bacteria | 2347 |
| 491 | Ga0496104_0374203 | 3300048907 | Bacteria | 1337 |
| 492 | Ga0496104_0699603 | 3300048907 | Bacteria | 921 |
| 493 | Ga0496105_0003678 | 3300048908 | Bacteria | 11409 |
| 494 | Ga0496105_0047018 | 3300048908 | Bacteria | 3561 |
| 495 | Ga0496108_0009640 | 3300048911 | Bacteria | 7827 |
| 496 | Ga0496108_0192063 | 3300048911 | Unclassified | 1770 |
| 497 | Ga0496109_0106410 | 3300048912 | Bacteria | 2605 |
| 498 | Ga0496109_0205337 | 3300048912 | Bacteria | 1852 |
| 499 | Ga0496110_0253561 | 3300048913 | Bacteria | 1601 |
| 500 | Ga0496111_0143361 | 3300048914 | Unclassified | 1770 |
| 501 | Ga0496112_0531913 | 3300048915 | Bacteria | 1110 |
| 502 | Ga0496114_0097387 | 3300048917 | Unclassified | 2506 |
| 503 | Ga0496114_0180797 | 3300048917 | Bacteria | 1842 |
| 504 | Ga0496114_0250772 | 3300048917 | Bacteria | 1557 |
| 505 | Ga0496115_0275977 | 3300048918 | Unclassified | 1380 |
| 506 | Ga0501031_0020629 | 3300049568 | Bacteria | 4297 |
| 507 | Ga0501031_0087321 | 3300049568 | Bacteria | 2034 |
| 508 | Ga0501034_0566106 | 3300049571 | Bacteria | 1045 |
| 509 | Ga0501036_0115461 | 3300049572 | Unclassified | 2268 |
| 510 | Ga0501038_0345657 | 3300049574 | Bacteria | 1159 |
| 511 | Ga0501040_0066537 | 3300049576 | Bacteria | 2483 |
| 512 | Ga0501040_0229592 | 3300049576 | Bacteria | 1321 |
| 513 | Ga0501040_0427336 | 3300049576 | Bacteria | 952 |
| 514 | Ga0501041_0042299 | 3300049577 | Bacteria | 2769 |
| 515 | Ga0501041_0201071 | 3300049577 | Bacteria | 1249 |
| 516 | Ga0501042_0051192 | 3300049578 | Bacteria | 2946 |
| 517 | Ga0501043_0151825 | 3300049579 | Bacteria | 1813 |
| 518 | Ga0501046_0364345 | 3300049580 | Unclassified | 1048 |
| 519 | Ga0501047_0071581 | 3300049581 | Bacteria | 3337 |
| 520 | Ga0501048_0122811 | 3300049582 | Bacteria | 1835 |
| 521 | Ga0501067_0114280 | 3300049583 | Bacteria | 1501 |
| 522 | Ga0501067_0221035 | 3300049583 | Bacteria | 1055 |
| 523 | Ga0501069_0068378 | 3300049585 | Bacteria | 1988 |
| 524 | Ga0501069_0345074 | 3300049585 | Bacteria | 877 |
| 525 | Ga0501070_0026365 | 3300049586 | Bacteria | 4877 |
| 526 | Ga0501071_0058663 | 3300049587 | Bacteria | 2783 |
| 527 | Ga0501071_0085927 | 3300049587 | Unclassified | 2307 |
| 528 | Ga0501071_0334251 | 3300049587 | Bacteria | 1151 |
| 529 | Ga0501072_0208414 | 3300049588 | Bacteria | 1558 |
| 530 | Ga0501072_0487468 | 3300049588 | Bacteria | 975 |
| 531 | Ga0501072_0626099 | 3300049588 | Unclassified | 848 |
| 532 | Ga0501072_0653644 | 3300049588 | Bacteria | 827 |
| 533 | Ga0501074_0054888 | 3300049590 | Bacteria | 2873 |
| 534 | Ga0501074_0107063 | 3300049590 | Bacteria | 2002 |
| 535 | Ga0501075_0048562 | 3300049591 | Bacteria | 3189 |
| 536 | Ga0501075_0153846 | 3300049591 | Bacteria | 1753 |
| 537 | Ga0501075_0180139 | 3300049591 | Bacteria | 1612 |
| 538 | Ga0501075_0617570 | 3300049591 | Bacteria | 827 |
| 539 | Ga0501076_0021516 | 3300049592 | Bacteria | 4948 |
| 540 | Ga0501076_0322182 | 3300049592 | Bacteria | 1268 |
| 541 | Ga0501077_0017839 | 3300049593 | Bacteria | 4485 |
| 542 | Ga0501077_0072280 | 3300049593 | Bacteria | 2186 |
| 543 | Ga0501079_0329852 | 3300049741 | Bacteria | 1195 |
| 544 | Ga0501080_0111705 | 3300049742 | Bacteria | 2533 |
| 545 | Ga0501080_0245496 | 3300049742 | Bacteria | 1633 |
| 546 | Ga0501080_0286366 | 3300049742 | Bacteria | 1497 |
| 547 | Ga0501081_0135843 | 3300049743 | Bacteria | 1760 |
| 548 | Ga0501083_0151302 | 3300049744 | Bacteria | 1519 |
| 549 | Ga0501083_0173761 | 3300049744 | Bacteria | 1408 |
| 550 | Ga0501035_0245636 | 3300049822 | Bacteria | 1521 |
| 551 | Ga0501044_0807818 | 3300049823 | Unclassified | 817 |
| 552 | Ga0501045_0042774 | 3300049824 | Bacteria | 3298 |
| 553 | Ga0501045_0069038 | 3300049824 | Bacteria | 2597 |
| 554 | nmdc:mga05p37_337159_c2 | 3300050507 | Bacteria | 1385 |
| 555 | nmdc:mga05p37_4691_c2 | 3300050507 | Bacteria | 8253 |
| 556 | nmdc:mga05p37_720913_c1 | 3300050507 | Unclassified | 1104 |
| 557 | nmdc:mga05p37_996793_c1 | 3300050507 | Bacteria | 890 |
| 558 | nmdc:mga09592_13402_c1 | 3300050508 | Bacteria | 6693 |
| 559 | nmdc:mga09592_4692_c1 | 3300050508 | Bacteria | 11062 |
| 560 | nmdc:mga0qj67_54975_c1 | 3300050509 | Bacteria | 3153 |
| 561 | nmdc:mga08y16_114065_c1 | 3300050511 | Unclassified | 2813 |
| 562 | nmdc:mga08y16_33612_c1 | 3300050511 | Bacteria | 5386 |
| 563 | nmdc:mga08y16_59012_c1 | 3300050511 | Bacteria | 4009 |
| 564 | nmdc:mga0n895_199844_c1 | 3300050512 | Bacteria | 2030 |
| 565 | nmdc:mga0n895_4184_c1 | 3300050512 | Bacteria | 11786 |
| 566 | nmdc:mga08x19_244326_c1 | 3300050514 | Bacteria | 1238 |
| 567 | nmdc:mga0a205_37957_c1 | 3300050515 | Bacteria | 4633 |
| 568 | Ga0495601_0000206 | 3300053077 | Bacteria | 31438 |
| 569 | Ga0495601_0007569 | 3300053077 | Bacteria | 6375 |
| 570 | Ga0495601_0012468 | 3300053077 | Bacteria | 5099 |
| 571 | Ga0495601_0067955 | 3300053077 | Bacteria | 2271 |
| 572 | Ga0495601_0129894 | 3300053077 | Unclassified | 1640 |
| 573 | Ga0495601_0267425 | 3300053077 | Bacteria | 1115 |
| 574 | Ga0495612_0023952 | 3300053078 | Bacteria | 2451 |
| 575 | Ga0495612_0037950 | 3300053078 | Unclassified | 1957 |
| 576 | Ga0495612_0149014 | 3300053078 | Bacteria | 1017 |
| 577 | Ga0495595_0005153 | 3300053084 | Bacteria | 5281 |
| 578 | Ga0495595_0055146 | 3300053084 | Bacteria | 1850 |
| 579 | Ga0495619_0000291 | 3300053085 | Bacteria | 35704 |
| 580 | Ga0495619_0130435 | 3300053085 | Unclassified | 1727 |
| 581 | Ga0495619_0237477 | 3300053085 | Bacteria | 1263 |
| 582 | Ga0495619_0373419 | 3300053085 | Bacteria | 985 |
| 583 | Ga0501084_0253122 | 3300054114 | Bacteria | 1486 |
| 584 | Ga0590075_007489 | 3300059424 | Bacteria | 2596 |
| 585 | Ga0587111_0052403 | 3300060346 | Bacteria | 905 |
| 586 | Ga0501082_0280379 | 3300060353 | Unclassified | 1451 |
| 587 | Ga0501082_0326096 | 3300060353 | Bacteria | 1338 |
| 588 | Ga0466962_0005398 | 3300061719 | Bacteria | 6147 |
| 589 | Ga0466962_0012746 | 3300061719 | Bacteria | 4044 |
| 590 | Ga0466962_0025283 | 3300061719 | Bacteria | 2851 |
| 591 | Ga0466962_0108850 | 3300061719 | Bacteria | 1333 |
| 592 | Ga0530510_0036964 | 3300061734 | Unclassified | 3519 |
| 593 | Ga0530510_0334583 | 3300061734 | Unclassified | 1136 |
| 594 | Ga0530510_0392951 | 3300061734 | Bacteria | 1045 |
| 595 | 2947224978 | 2947224130 | Bacteria | 9938529 |
| 596 | 2947225051 | 2947224130 | Bacteria | 9938529 |
| 597 | 2997455877 | 2997451912 | Bacteria | 8492419 |
| 598 | Ga0075428_100016679 | |||
| 599 | Ga0070658_10058122 | |||
| 600 | Ga0070683_100160818 | |||
| 601 | Ga0070683_100605213 | |||
| 602 | Ga0068869_100254088 | |||
| 603 | Ga0070680_100085483 | |||
| 604 | Ga0070682_100056263 | |||
| 605 | Ga0070682_100120239 | |||
| 606 | Ga0070682_100307201 | |||
| 607 | Ga0070660_100398254 | |||
| 608 | Ga0070687_100100531 | |||
| 609 | Ga0070661_100156654 | |||
| 610 | Ga0070692_10095991 | |||
| 611 | Ga0070668_100070136 | |||
| 612 | Ga0070674_100105039 | |||
| 613 | Ga0070659_100196865 | |||
| 614 | Ga0070659_100217370 | |||
| 615 | Ga0070659_100988791 | |||
| 616 | Ga0070714_100004052 | |||
| 617 | Ga0070714_100058356 | |||
| 618 | Ga0070713_100018400 | |||
| 619 | Ga0070713_100020135 | |||
| 620 | Ga0070701_10257787 | |||
| 621 | Ga0070711_100271674 | |||
| 622 | Ga0070705_100059305 | |||
| 623 | Ga0070700_100124258 | |||
| 624 | Ga0070663_100236803 | |||
| 625 | Ga0070662_100042485 | |||
| 626 | Ga0070681_10003538 | |||
| 627 | Ga0070681_10023352 | |||
| 628 | Ga0070681_10030043 | |||
| 629 | Ga0070681_10043809 | |||
| 630 | Ga0070681_10055488 | |||
| 631 | Ga0070681_10306479 | |||
| 632 | Ga0068867_100376582 | |||
| 633 | Ga0070706_100102426 | |||
| 634 | Ga0070707_100001400 | |||
| 635 | Ga0070707_100016023 | |||
| 636 | Ga0070698_100190121 | |||
| 637 | Ga0070698_100277338 | |||
| 638 | Ga0070698_100353219 | |||
| 639 | Ga0070699_100091769 | |||
| 640 | Ga0070679_100004720 | |||
| 641 | Ga0070679_100050694 | |||
| 642 | Ga0070679_100136818 | |||
| 643 | Ga0070679_100183451 | |||
| 644 | Ga0070679_100525362 | |||
| 645 | Ga0070684_100274695 | |||
| 646 | Ga0070684_100942240 | |||
| 647 | Ga0070697_100133227 | |||
| 648 | Ga0070697_100566553 | |||
| 649 | Ga0068853_100167182 | |||
| 650 | Ga0070686_100247317 | |||
| 651 | Ga0070695_100000062 | |||
| 652 | Ga0070696_100386300 | |||
| 653 | Ga0070693_100030131 | |||
| 654 | Ga0070693_100124594 | |||
| 655 | Ga0070693_100228503 | |||
| 656 | Ga0070665_100581685 | |||
| 657 | Ga0068855_100152251 | |||
| 658 | Ga0068855_100453966 | |||
| 659 | Ga0068855_100652622 | |||
| 660 | Ga0068857_100160534 | |||
| 661 | Ga0068857_100213266 | |||
| 662 | Ga0068856_100033190 | |||
| 663 | Ga0068856_100088253 | |||
| 664 | Ga0068856_100201296 | |||
| 665 | Ga0070702_100025480 | |||
| 666 | Ga0068852_100041474 | |||
| 667 | Ga0068852_100059891 | |||
| 668 | Ga0068852_101127886 | |||
| 669 | Ga0068861_100249323 | |||
| 670 | Ga0068863_100085078 | |||
| 671 | Ga0068863_101068740 | |||
| 672 | Ga0070717_10019632 | |||
| 673 | Ga0070717_10218265 | |||
| 674 | Ga0070717_10277275 | |||
| 675 | Ga0070717_10524451 | |||
| 676 | Ga0075432_10000461 | |||
| 677 | Ga0070712_100034964 | |||
| 678 | Ga0075428_100002927 | |||
| 679 | Ga0075430_100017091 | |||
| 680 | Ga0075430_100300246 | |||
| 681 | Ga0075431_100127465 | |||
| 682 | Ga0075434_100036845 | |||
| 683 | Ga0075434_100421601 | |||
| 684 | Ga0075429_100040850 | |||
| 685 | Ga0075436_100269749 | |||
| 686 | Ga0105240_10009653 | |||
| 687 | Ga0111539_10004184 | |||
| 688 | Ga0111539_10055617 | |||
| 689 | Ga0111539_10066203 | |||
| 690 | Ga0111539_10541230 | |||
| 691 | Ga0111539_10793758 | |||
| 692 | Ga0105245_10001379 | |||
| 693 | Ga0105245_10189447 | |||
| 694 | Ga0114129_10026232 | |||
| 695 | Ga0114129_10228502 | |||
| 696 | Ga0114129_10335419 | |||
| 697 | Ga0114129_10572581 | |||
| 698 | Ga0114129_10580879 | |||
| 699 | Ga0114129_11260233 | |||
| 700 | Ga0114129_11320351 | |||
| 701 | Ga0105241_10679157 | |||
| 702 | Ga0105248_10338034 | |||
| 703 | Ga0105237_10018792 | |||
| 704 | Ga0105237_10137338 | |||
| 705 | Ga0105237_10387975 | |||
| 706 | Ga0105238_10267696 | |||
| 707 | Ga0105238_10286853 | |||
| 708 | Ga0105239_10050860 | |||
| 709 | Ga0105239_10241824 | |||
| 710 | Ga0105239_10719920 | |||
| 711 | Ga0105239_11404775 | |||
| 712 | Ga0105246_10056879 | |||
| 713 | Ga0105246_10253016 | |||
| 714 | Ga0157371_10321143 | |||
| 715 | Ga0157371_10329914 | |||
| 716 | Ga0157370_10283123 | |||
| 717 | Ga0157369_10013919 | |||
| 718 | Ga0157369_10163133 | |||
| 719 | Ga0157369_10691838 | |||
| 720 | Ga0157374_10062002 | |||
| 721 | Ga0157374_10123235 | |||
| 722 | Ga0163162_11110792 | |||
| 723 | Ga0157372_10011775 | |||
| 724 | Ga0157372_10118172 | |||
| 725 | Ga0157372_10148286 | |||
| 726 | Ga0157372_11345031 | |||
| 727 | Ga0157375_10345948 | |||
| 728 | Ga0182008_10033388 | |||
| 729 | Ga0157377_10003916 | |||
| 730 | Ga0157377_10606714 | |||
| 731 | Ga0157379_10830556 | |||
| 732 | Ga0157376_10029992 | |||
| 733 | Ga0197907_11490640 | |||
| 734 | Ga0206356_10224714 | |||
| 735 | Ga0206356_10474531 | |||
| 736 | Ga0206356_11724424 | |||
| 737 | Ga0206350_11402943 | |||
| 738 | Ga0206354_10376445 | |||
| 739 | Ga0206353_10414071 | |||
| 740 | Ga0206353_11003959 | |||
| 741 | Ga0224712_10004721 | |||
| 742 | Ga0224712_10074500 | |||
| 743 | Ga0224712_10105412 | |||
| 744 | Ga0224712_10166574 | |||
| 745 | Ga0207692_10192016 | |||
| 746 | Ga0207688_10000393 | |||
| 747 | Ga0207680_10486881 | |||
| 748 | Ga0207705_10024249 | |||
| 749 | Ga0207705_10027780 | |||
| 750 | Ga0207705_10227663 | |||
| 751 | Ga0207684_10036436 | |||
| 752 | Ga0207684_10072052 | |||
| 753 | Ga0207684_10297242 | |||
| 754 | Ga0207707_10080506 | |||
| 755 | Ga0207707_10189309 | |||
| 756 | Ga0207695_10038896 | |||
| 757 | Ga0207671_10182988 | |||
| 758 | Ga0207671_10526319 | |||
| 759 | Ga0207693_10001177 | |||
| 760 | Ga0207693_10242776 | |||
| 761 | Ga0207660_10133765 | |||
| 762 | Ga0207662_10091161 | |||
| 763 | Ga0207657_10015199 | |||
| 764 | Ga0207649_10032226 | |||
| 765 | Ga0207652_10056165 | |||
| 766 | Ga0207652_10092230 | |||
| 767 | Ga0207652_10110359 | |||
| 768 | Ga0207652_10183993 | |||
| 769 | Ga0207652_10254743 | |||
| 770 | Ga0207646_10006489 | |||
| 771 | Ga0207646_10016070 | |||
| 772 | Ga0207687_10042669 | |||
| 773 | Ga0207687_10189770 | |||
| 774 | Ga0207687_10212103 | |||
| 775 | Ga0207687_10454374 | |||
| 776 | Ga0207700_10067042 | |||
| 777 | Ga0207700_10152037 | |||
| 778 | Ga0207664_10044649 | |||
| 779 | Ga0207664_10051444 | |||
| 780 | Ga0207644_10028529 | |||
| 781 | Ga0207690_10072554 | |||
| 782 | Ga0207690_10573988 | |||
| 783 | Ga0207706_10050042 | |||
| 784 | Ga0207706_10846155 | |||
| 785 | Ga0207704_10018883 | |||
| 786 | Ga0207691_10349012 | |||
| 787 | Ga0207661_10059637 | |||
| 788 | Ga0207661_10064681 | |||
| 789 | Ga0207661_10509890 | |||
| 790 | Ga0207661_10642312 | |||
| 791 | Ga0207679_10249920 | |||
| 792 | Ga0207667_10272250 | |||
| 793 | Ga0207667_10325209 | |||
| 794 | Ga0207667_10523142 | |||
| 795 | Ga0207651_10222420 | |||
| 796 | Ga0207668_10098880 | |||
| 797 | Ga0207668_10419422 | |||
| 798 | Ga0207640_10141446 | |||
| 799 | Ga0207658_10241428 | |||
| 800 | Ga0207678_10373963 | |||
| 801 | Ga0207708_10077242 | |||
| 802 | Ga0207702_10122937 | |||
| 803 | Ga0207702_10164293 | |||
| 804 | Ga0207641_10240119 | |||
| 805 | Ga0207648_10451801 | |||
| 806 | Ga0207674_10003198 | |||
| 807 | Ga0207674_10067732 | |||
| 808 | Ga0207674_10655525 | |||
| 809 | Ga0207675_100147961 | |||
| 810 | Ga0207698_10063445 | |||
| 811 | Ga0207428_10000196 | |||
| 812 | Ga0207428_10008352 | |||
| 813 | Ga0207428_10067860 | |||
| 814 | Ga0207428_10137671 | |||
| 815 | Ga0207428_10651355 | |||
| 816 | Ga0265319_1003263 | |||
| 817 | Ga0265319_1025988 | |||
| 818 | Ga0265334_10005333 | |||
| 819 | Ga0265334_10048256 | |||
| 820 | Ga0265318_10007631 | |||
| 821 | Ga0265322_10041621 | |||
| 822 | Ga0265336_10023906 | |||
| 823 | Ga0265336_10030451 | |||
| 824 | Ga0265338_10005100 | |||
| 825 | Ga0265338_10010298 | |||
| 826 | Ga0265338_10171299 | |||
| 827 | Ga0265338_10328811 | |||
| 828 | Ga0265324_10005245 | |||
| 829 | Ga0265320_10008292 | |||
| 830 | Ga0265329_10053788 | |||
| 831 | Ga0265340_10004374 | |||
| 832 | Ga0265339_10004548 | |||
| 833 | Ga0265339_10153415 | |||
| 834 | Ga0265327_10031711 | |||
| 835 | Ga0265316_10094519 | |||
| 836 | Ga0265316_10378938 | |||
| 837 | Ga0265313_10006513 | |||
| 838 | Ga0265313_10088361 | |||
| 839 | Ga0265314_10001285 | |||
| 840 | Ga0265342_10016174 | |||
| 841 | Ga0316577_10001616 | |||
| 842 | Ga0307412_10262243 | |||
| 843 | Ga0307409_100015275 | |||
| 844 | Ga0307416_100394456 | |||
| 845 | Ga0307416_100968447 | |||
| 846 | Ga0307411_10348116 | |||
| 847 | Ga0307415_100044361 | |||
| 848 | Ga0307415_100433220 | |||
| 849 | Ga0373938_0077403 | |||
| 850 | Ga0373945_0013493 | |||
| 851 | Ga0373960_0035608 | |||
| 852 | Ga0373943_0041390 | |||
| 853 | Ga0373942_0068279 | |||
| 854 | Ga0373935_0109458 | |||
| 855 | Ga0373933_0036898 | |||
| 856 | Ga0373933_0166252 | |||
| 857 | Ga0373937_0100779 | |||
| 858 | Ga0373937_0103368 | |||
| 859 | Ga0373937_0224491 | |||
| 860 | Ga0316582_0025946 | |||
| 861 | Ga0316584_0012386 | |||
| 862 | Ga0373925_0020725 | |||
| 863 | Ga0373925_0412009 | |||
| 864 | Ga0395899_0356477 | |||
| 865 | Ga0395901_0243648 | |||
| 866 | Ga0395901_0282417 | |||
| 867 | Ga0439439_0000336 | |||
| 868 | Ga0439439_0075496 | |||
| 869 | Ga0439461_0037718 | |||
| 870 | Ga0451793_1793102 | |||
| 871 | Ga0451807_0736736 | |||
| 872 | Ga0439433_0010208 | |||
| 873 | Ga0439448_0042803 | |||
| 874 | Ga0439449_0041538 | |||
| 875 | Ga0439462_0005260 | |||
| 876 | Ga0439446_0014481 | |||
| 877 | Ga0439446_0034044 | |||
| 878 | Ga0439434_0006125 | |||
| 879 | Ga0439434_0009366 | |||
| 880 | Ga0451577_0090388 | |||
| 881 | Ga0451577_0205994 | |||
| 882 | Ga0466969_0089276 | |||
| 883 | Ga0453683_0000355 | |||
| 884 | Ga0453683_0087180 | |||
| 885 | Ga0453683_0126211 | |||
| 886 | Ga0466965_0061647 | |||
| 887 | Ga0466965_0076404 | |||
| 888 | Ga0466965_0147272 | |||
| 889 | Ga0466961_0004361 | |||
| 890 | Ga0466961_0013977 | |||
| 891 | Ga0466961_0014149 | |||
| 892 | Ga0466963_0000776 | |||
| 893 | Ga0466963_0003553 | |||
| 894 | Ga0466963_0004108 | |||
| 895 | Ga0466963_0005116 | |||
| 896 | Ga0466963_0007687 | |||
| 897 | Ga0466963_0016673 | |||
| 898 | Ga0466963_0019292 | |||
| 899 | Ga0466963_0053952 | |||
| 900 | Ga0466963_0104859 | |||
| 901 | Ga0466963_0139037 | |||
| 902 | Ga0466963_0188183 | |||
| 903 | Ga0466963_0438846 | |||
| 904 | Ga0466963_0538526 | |||
| 905 | Ga0466963_0666977 | |||
| 906 | Ga0466964_0005456 | |||
| 907 | Ga0466964_0012712 | |||
| 908 | Ga0466964_0083652 | |||
| 909 | Ga0466964_0108999 | |||
| 910 | Ga0466964_0284868 | |||
| 911 | Ga0453684_0045770 | |||
| 912 | Ga0453684_0365527 | |||
| 913 | Ga0453684_0555865 | |||
| 914 | Ga0466971_0002654 | |||
| 915 | Ga0466971_0033734 | |||
| 916 | Ga0466971_0035954 | |||
| 917 | Ga0466971_0398143 | |||
| 918 | Ga0466971_0421808 | |||
| 919 | Ga0466968_0003607 | |||
| 920 | Ga0466968_0006451 | |||
| 921 | Ga0466968_0008472 | |||
| 922 | Ga0466968_0032693 | |||
| 923 | Ga0466968_0066037 | |||
| 924 | Ga0466970_0033054 | |||
| 925 | Ga0466957_0002250 | |||
| 926 | Ga0466957_0006059 | |||
| 927 | Ga0466957_0016735 | |||
| 928 | Ga0466957_0020828 | |||
| 929 | Ga0466957_0111481 | |||
| 930 | Ga0466959_0001728 | |||
| 931 | Ga0466959_0040638 | |||
| 932 | Ga0466959_0578602 | |||
| 933 | Ga0451576_0086028 | |||
| 934 | Ga0466958_0002506 | |||
| 935 | Ga0466958_0032534 | |||
| 936 | Ga0466958_0089662 | |||
| 937 | Ga0466958_0126669 | |||
| 938 | Ga0466958_0206977 | |||
| 939 | Ga0466967_0001226 | |||
| 940 | Ga0466967_0002310 | |||
| 941 | Ga0466967_0004340 | |||
| 942 | Ga0466967_0004811 | |||
| 943 | Ga0466967_0018003 | |||
| 944 | Ga0466967_0034211 | |||
| 945 | Ga0466967_0037090 | |||
| 946 | Ga0466967_0038655 | |||
| 947 | Ga0466967_0048143 | |||
| 948 | Ga0466967_0053771 | |||
| 949 | Ga0466967_0062801 | |||
| 950 | Ga0466967_0094468 | |||
| 951 | Ga0466967_0111819 | |||
| 952 | Ga0466967_0142246 | |||
| 953 | Ga0466967_0238705 | |||
| 954 | Ga0466967_0317202 | |||
| 955 | Ga0466967_0711086 | |||
| 956 | Ga0495592_0000100 | |||
| 957 | Ga0495592_0201514 | |||
| 958 | Ga0495592_0243036 | |||
| 959 | Ga0495592_0247620 | |||
| 960 | Ga0495603_0030547 | |||
| 961 | Ga0495603_0054576 | |||
| 962 | Ga0495629_0005062 | |||
| 963 | Ga0495629_0136383 | |||
| 964 | Ga0495641_0039812 | |||
| 965 | Ga0495641_0052686 | |||
| 966 | Ga0495641_0160606 | |||
| 967 | Ga0495651_0000008 | |||
| 968 | Ga0495651_0018513 | |||
| 969 | Ga0495651_0303549 | |||
| 970 | Ga0495651_0342894 | |||
| 971 | Ga0495653_0000519 | |||
| 972 | Ga0495653_0005446 | |||
| 973 | Ga0495653_0039592 | |||
| 974 | Ga0495653_0098586 | |||
| 975 | Ga0495653_0192384 | |||
| 976 | Ga0495580_0345308 | |||
| 977 | Ga0495582_0073767 | |||
| 978 | Ga0495582_0363109 | |||
| 979 | Ga0495664_0002921 | |||
| 980 | Ga0495664_0030604 | |||
| 981 | Ga0495664_0083209 | |||
| 982 | Ga0495664_0370754 | |||
| 983 | Ga0495584_0039698 | |||
| 984 | Ga0495585_0147405 | |||
| 985 | Ga0495594_0183658 | |||
| 986 | Ga0495608_0004506 | |||
| 987 | Ga0495608_0010256 | |||
| 988 | Ga0495608_0094172 | |||
| 989 | Ga0495608_0132521 | |||
| 990 | Ga0495608_0276092 | |||
| 991 | Ga0495618_0001843 | |||
| 992 | Ga0495618_0090259 | |||
| 993 | Ga0495628_0000016 | |||
| 994 | Ga0495628_0075298 | |||
| 995 | Ga0495628_0171601 | |||
| 996 | Ga0495628_0310357 | |||
| 997 | Ga0495630_0112768 | |||
| 998 | Ga0495630_0229105 | |||
| 999 | Ga0495637_0041820 | |||
| 1000 | Ga0495644_0003153 | |||
| 1001 | Ga0495666_0007834 | |||
| 1002 | Ga0495642_0186019 | |||
| 1003 | Ga0495652_0000888 | |||
| 1004 | Ga0495652_0046605 | |||
| 1005 | Ga0495652_0077880 | |||
| 1006 | Ga0495652_0117092 | |||
| 1007 | Ga0495652_0140207 | |||
| 1008 | Ga0495652_0250232 | |||
| 1009 | Ga0495640_0047430 | |||
| 1010 | Ga0495640_0172364 | |||
| 1011 | Ga0495586_0104232 | |||
| 1012 | Ga0495587_0000048 | |||
| 1013 | Ga0495587_0006780 | |||
| 1014 | Ga0495609_0120141 | |||
| 1015 | Ga0495645_0000029 | |||
| 1016 | Ga0495645_0106935 | |||
| 1017 | Ga0495645_0130067 | |||
| 1018 | Ga0495667_0010500 | |||
| 1019 | Ga0495667_0077815 | |||
| 1020 | Ga0495667_0090953 | |||
| 1021 | Ga0495667_0136897 | |||
| 1022 | Ga0495667_0305126 | |||
| 1023 | Ga0495667_0463528 | |||
| 1024 | Ga0495668_0141400 | |||
| 1025 | Ga0495634_0034560 | |||
| 1026 | Ga0495634_0039971 | |||
| 1027 | Ga0495611_0041340 | |||
| 1028 | Ga0495635_0014662 | |||
| 1029 | Ga0495635_0040523 | |||
| 1030 | Ga0495635_0295439 | |||
| 1031 | Ga0495635_0333185 | |||
| 1032 | Ga0495588_0063384 | |||
| 1033 | Ga0495657_0007230 | |||
| 1034 | Ga0495657_0009916 | |||
| 1035 | Ga0495657_0132909 | |||
| 1036 | Ga0495657_0151961 | |||
| 1037 | Ga0495657_0232777 | |||
| 1038 | Ga0495599_0000181 | |||
| 1039 | Ga0495599_0031839 | |||
| 1040 | Ga0495599_0251985 | |||
| 1041 | Ga0495599_0424923 | |||
| 1042 | Ga0495599_0479058 | |||
| 1043 | Ga0495623_0000093 | |||
| 1044 | Ga0495646_0000416 | |||
| 1045 | Ga0495647_0036172 | |||
| 1046 | Ga0495658_0001970 | |||
| 1047 | Ga0495658_0122732 | |||
| 1048 | Ga0495658_0358146 | |||
| 1049 | Ga0495613_0007818 | |||
| 1050 | Ga0495613_0025593 | |||
| 1051 | Ga0495613_0359485 | |||
| 1052 | Ga0495624_0024422 | |||
| 1053 | Ga0495624_0064946 | |||
| 1054 | Ga0495589_0075441 | |||
| 1055 | Ga0495600_0009227 | |||
| 1056 | Ga0495600_0086191 | |||
| 1057 | Ga0495600_0232319 | |||
| 1058 | Ga0495581_0105731 | |||
| 1059 | Ga0495581_0414681 | |||
| 1060 | Ga0495604_0000111 | |||
| 1061 | Ga0495604_0022514 | |||
| 1062 | Ga0495674_0059023 | |||
| 1063 | Ga0495674_0656581 | |||
| 1064 | Ga0495674_0826089 | |||
| 1065 | Ga0495680_0005070 | |||
| 1066 | Ga0495680_0028517 | |||
| 1067 | Ga0495680_0030561 | |||
| 1068 | Ga0495680_0065989 | |||
| 1069 | Ga0495680_0087088 | |||
| 1070 | Ga0495680_0552254 | |||
| 1071 | Ga0495675_0000376 | |||
| 1072 | Ga0495675_0156431 | |||
| 1073 | Ga0495684_0003775 | |||
| 1074 | Ga0495684_0310005 | |||
| 1075 | Ga0495684_0405656 | |||
| 1076 | Ga0495593_0004272 | |||
| 1077 | Ga0495602_0000141 | |||
| 1078 | Ga0495602_0013005 | |||
| 1079 | Ga0495602_0162177 | |||
| 1080 | Ga0496100_0205444 | |||
| 1081 | Ga0496100_0606052 | |||
| 1082 | Ga0496102_0121185 | |||
| 1083 | Ga0496102_0210205 | |||
| 1084 | Ga0496103_0243440 | |||
| 1085 | Ga0496104_0013704 | |||
| 1086 | Ga0496104_0014178 | |||
| 1087 | Ga0496104_0137453 | |||
| 1088 | Ga0496104_0374203 | |||
| 1089 | Ga0496104_0699603 | |||
| 1090 | Ga0496105_0003678 | |||
| 1091 | Ga0496105_0047018 | |||
| 1092 | Ga0496108_0009640 | |||
| 1093 | Ga0496108_0192063 | |||
| 1094 | Ga0496109_0106410 | |||
| 1095 | Ga0496109_0205337 | |||
| 1096 | Ga0496110_0253561 | |||
| 1097 | Ga0496111_0143361 | |||
| 1098 | Ga0496112_0531913 | |||
| 1099 | Ga0496114_0097387 | |||
| 1100 | Ga0496114_0180797 | |||
| 1101 | Ga0496114_0250772 | |||
| 1102 | Ga0496115_0275977 | |||
| 1103 | Ga0501031_0020629 | |||
| 1104 | Ga0501031_0087321 | |||
| 1105 | Ga0501034_0566106 | |||
| 1106 | Ga0501036_0115461 | |||
| 1107 | Ga0501038_0345657 | |||
| 1108 | Ga0501040_0066537 | |||
| 1109 | Ga0501040_0229592 | |||
| 1110 | Ga0501040_0427336 | |||
| 1111 | Ga0501041_0042299 | |||
| 1112 | Ga0501041_0201071 | |||
| 1113 | Ga0501042_0051192 | |||
| 1114 | Ga0501043_0151825 | |||
| 1115 | Ga0501046_0364345 | |||
| 1116 | Ga0501047_0071581 | |||
| 1117 | Ga0501048_0122811 | |||
| 1118 | Ga0501067_0114280 | |||
| 1119 | Ga0501067_0221035 | |||
| 1120 | Ga0501069_0068378 | |||
| 1121 | Ga0501069_0345074 | |||
| 1122 | Ga0501070_0026365 | |||
| 1123 | Ga0501071_0058663 | |||
| 1124 | Ga0501071_0085927 | |||
| 1125 | Ga0501071_0334251 | |||
| 1126 | Ga0501072_0208414 | |||
| 1127 | Ga0501072_0487468 | |||
| 1128 | Ga0501072_0626099 | |||
| 1129 | Ga0501072_0653644 | |||
| 1130 | Ga0501074_0054888 | |||
| 1131 | Ga0501074_0107063 | |||
| 1132 | Ga0501075_0048562 | |||
| 1133 | Ga0501075_0153846 | |||
| 1134 | Ga0501075_0180139 | |||
| 1135 | Ga0501075_0617570 | |||
| 1136 | Ga0501076_0021516 | |||
| 1137 | Ga0501076_0322182 | |||
| 1138 | Ga0501077_0017839 | |||
| 1139 | Ga0501077_0072280 | |||
| 1140 | Ga0501079_0329852 | |||
| 1141 | Ga0501080_0111705 | |||
| 1142 | Ga0501080_0245496 | |||
| 1143 | Ga0501080_0286366 | |||
| 1144 | Ga0501081_0135843 | |||
| 1145 | Ga0501083_0151302 | |||
| 1146 | Ga0501083_0173761 | |||
| 1147 | Ga0501035_0245636 | |||
| 1148 | Ga0501044_0807818 | |||
| 1149 | Ga0501045_0042774 | |||
| 1150 | Ga0501045_0069038 | |||
| 1151 | nmdc:mga05p37_337159_c2 | |||
| 1152 | nmdc:mga05p37_4691_c2 | |||
| 1153 | nmdc:mga05p37_720913_c1 | |||
| 1154 | nmdc:mga05p37_996793_c1 | |||
| 1155 | nmdc:mga09592_13402_c1 | |||
| 1156 | nmdc:mga09592_4692_c1 | |||
| 1157 | nmdc:mga0qj67_54975_c1 | |||
| 1158 | nmdc:mga08y16_114065_c1 | |||
| 1159 | nmdc:mga08y16_33612_c1 | |||
| 1160 | nmdc:mga08y16_59012_c1 | |||
| 1161 | nmdc:mga0n895_199844_c1 | |||
| 1162 | nmdc:mga0n895_4184_c1 | |||
| 1163 | nmdc:mga08x19_244326_c1 | |||
| 1164 | nmdc:mga0a205_37957_c1 | |||
| 1165 | Ga0495601_0000206 | |||
| 1166 | Ga0495601_0007569 | |||
| 1167 | Ga0495601_0012468 | |||
| 1168 | Ga0495601_0067955 | |||
| 1169 | Ga0495601_0129894 | |||
| 1170 | Ga0495601_0267425 | |||
| 1171 | Ga0495612_0023952 | |||
| 1172 | Ga0495612_0037950 | |||
| 1173 | Ga0495612_0149014 | |||
| 1174 | Ga0495595_0005153 | |||
| 1175 | Ga0495595_0055146 | |||
| 1176 | Ga0495619_0000291 | |||
| 1177 | Ga0495619_0130435 | |||
| 1178 | Ga0495619_0237477 | |||
| 1179 | Ga0495619_0373419 | |||
| 1180 | Ga0501084_0253122 | |||
| 1181 | Ga0590075_007489 | |||
| 1182 | Ga0587111_0052403 | |||
| 1183 | Ga0501082_0280379 | |||
| 1184 | Ga0501082_0326096 | |||
| 1185 | Ga0466962_0005398 | |||
| 1186 | Ga0466962_0012746 | |||
| 1187 | Ga0466962_0025283 | |||
| 1188 | Ga0466962_0108850 | |||
| 1189 | Ga0530510_0036964 | |||
| 1190 | Ga0530510_0334583 | |||
| 1191 | Ga0530510_0392951 | |||
| 1192 | 2947224978 | |||
| 1193 | 2947225051 | |||
| 1194 | 2997455877 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6z89-assembly1.cif.gz_C-2 | human gtp cyclohydrolase i in complex with allosteric inhibitor | 0.9564 | 91 | 225 |
| 6z89-assembly1.cif.gz_C-2 | human gtp cyclohydrolase i in complex with allosteric inhibitor | 0.9334 | 91 | 225 |
| 6z88-assembly1.cif.gz_B | human gtp cyclohydrolase i in complex with allosteric inhibitor | 0.917 | 40 | 225 |
| 1wm9-assembly1.cif.gz_A | structure of gtp cyclohydrolase i from thermus thermophilus hb8 | 0.9136 | 36 | 226 |
| 6z85-assembly1.cif.gz_A | inhibitory human gtp cyclohydrolase i - gfrp complex | 0.9134 | 42 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4uqfA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9761 | 105 | 225 | 3.30.1130.10 |
| af_A0A1D6DUT0_342_468_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9447 | 107 | 225 | 3.30.1130.10 |
| 1a8rA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9338 | 90 | 224 | 3.30.1130.10 |
| af_Q8I5H7_254_381_3.30.1130.10 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9132 | 91 | 216 | 3.30.1130.10 |
| 1a8rA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8879 | 90 | 224 | 3.30.1130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G1NCP7-F1-model_v4 | GTP cyclohydrolase I (EC 3.5.4.16) | 0.9677 | 105 | 225 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0006730 GO:0008270 GO:0046654 |
| AF-A0A0G4MU50-F1-model_v4 | GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) | 0.9667 | 108 | 225 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0008270 GO:0046654 GO:0046656 |
| AF-A0A6B3N329-F1-model_v4 | GTP cyclohydrolase I (EC 3.5.4.16) | 0.966 | 106 | 225 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0006730 GO:0008270 GO:0046654 |
| AF-A0A539CVM0-F1-model_v4 | GTP cyclohydrolase I (EC 3.5.4.16) | 0.9649 | 108 | 225 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0006730 GO:0008270 GO:0046654 |
| AF-A0A382BGG5-F1-model_v4 | GTP cyclohydrolase I (EC 3.5.4.16) | 0.9631 | 120 | 225 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0008270 GO:0046654 |