F467519

General Info

Members Datasets Scaffolds Average Seq Length
596 300 596 262

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100000271|Ga0070708_10000027128
Length 299
Sequence MDAGPSVREKKVSSVTEVLARNIVESGRRAAARSDTSAGTEKRSATFRVWRGAGPTGELRDYSTNVSEGMVVLDAIHQIQAETAGDLAVRWNCKAGKCGSCSAEINGMPRLMCMTRLSELDLKQPVTVEPMRAFPPVKDLVTDVSSNFRAKKRIRRFTPRPPDAPDGTWRMAQADADRVQEFRKCVECFLCQDVCHVLRDHHLHEQFIGPRLLVHAAQLEMHPLDILDRTDDLKESHGIGYCNITKCCTRVCPENIIITDNAIIPLKERVVDKHYDPLRKLVRLVRGRKSADRHQGGAR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
161 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
162 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
178 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
179 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
180 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
201 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
202 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
203 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
264 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
265 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
266 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
267 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
268 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
269 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
270 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
271 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
272 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
273 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
274 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
275 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
276 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
294 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
295 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
296 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
297 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
298 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 3.36
Rhizosphere 94.8
Stem 0
Stem Tuber 0
Unclassified 1.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10017229 3300003203 Bacteria 2991
2 Ga0065707_10105631 3300005295 Bacteria 2636
3 Ga0070658_10194464 3300005327 Bacteria 1710
4 Ga0070683_100137155 3300005329 Bacteria 2317
5 Ga0070683_100382569 3300005329 Bacteria 1341
6 Ga0070690_100041436 3300005330 Bacteria 2915
7 Ga0070670_100010608 3300005331 Bacteria 7868
8 Ga0070670_100191353 3300005331 Bacteria 1777
9 Ga0070666_10065940 3300005335 Bacteria 2457
10 Ga0070680_100025541 3300005336 Bacteria 4722
11 Ga0070680_100125505 3300005336 Bacteria 2145
12 Ga0070680_100136895 3300005336 Bacteria 2052
13 Ga0070680_100229225 3300005336 Bacteria 1569
14 Ga0070682_100000710 3300005337 Bacteria 19958
15 Ga0070682_100002480 3300005337 Bacteria 10190
16 Ga0070682_100081945 3300005337 Bacteria 2090
17 Ga0068868_100020746 3300005338 Bacteria 4943
18 Ga0068868_100088743 3300005338 Bacteria 2489
19 Ga0070660_100292614 3300005339 Bacteria 1334
20 Ga0070689_100347784 3300005340 Bacteria 1243
21 Ga0070687_100004175 3300005343 Bacteria 5723
22 Ga0070661_100001310 3300005344 Bacteria 17458
23 Ga0070692_10022170 3300005345 Bacteria 3100
24 Ga0070668_100035893 3300005347 Bacteria 3783
25 Ga0070668_100325558 3300005347 Bacteria 1295
26 Ga0070669_100003973 3300005353 Bacteria 10700
27 Ga0070675_100072690 3300005354 Bacteria 2855
28 Ga0070675_100317604 3300005354 Bacteria 1376
29 Ga0070671_100058419 3300005355 Bacteria 3211
30 Ga0070671_100373518 3300005355 Bacteria 1218
31 Ga0070674_100010992 3300005356 Bacteria 5491
32 Ga0070674_100034310 3300005356 Bacteria 3388
33 Ga0070674_100781873 3300005356 Bacteria 823
34 Ga0070673_100029311 3300005364 Bacteria 4103
35 Ga0070673_100036426 3300005364 Bacteria 3740
36 Ga0070659_100282113 3300005366 Bacteria 1382
37 Ga0070709_10314855 3300005434 Bacteria 1147
38 Ga0070713_100035908 3300005436 Bacteria 3995
39 Ga0070713_100083974 3300005436 Bacteria 2724
40 Ga0070705_100005309 3300005440 Bacteria 6270
41 Ga0070705_100191399 3300005440 Bacteria 1395
42 Ga0070705_100373802 3300005440 Bacteria 1047
43 Ga0070694_100166151 3300005444 Bacteria 1623
44 Ga0070708_100000150 3300005445 Bacteria 48256
45 Ga0070708_100000271 3300005445 Bacteria 38546
46 Ga0070708_100002538 3300005445 Bacteria 14094
47 Ga0070678_100007796 3300005456 Bacteria 6370
48 Ga0070678_100107527 3300005456 Bacteria 2176
49 Ga0070678_100245178 3300005456 Bacteria 1500
50 Ga0070662_100013849 3300005457 Bacteria 5373
51 Ga0070681_10000857 3300005458 Bacteria 25575
52 Ga0070681_10002590 3300005458 Bacteria 16583
53 Ga0070681_10018811 3300005458 Bacteria 6912
54 Ga0070681_10024902 3300005458 Bacteria 6021
55 Ga0070681_10114175 3300005458 Bacteria 2640
56 Ga0070681_10153883 3300005458 Bacteria 2225
57 Ga0070681_10179506 3300005458 Bacteria 2039
58 Ga0070681_10556348 3300005458 Bacteria 1061
59 Ga0068867_100044511 3300005459 Bacteria 3252
60 Ga0068867_100076893 3300005459 Bacteria 2507
61 Ga0068867_100088174 3300005459 Bacteria 2351
62 Ga0068867_100099888 3300005459 Bacteria 2215
63 Ga0070685_10002842 3300005466 Bacteria 8844
64 Ga0070706_100056056 3300005467 Bacteria 3637
65 Ga0070706_100242830 3300005467 Bacteria 1682
66 Ga0070706_100433055 3300005467 Bacteria 1224
67 Ga0070706_100491534 3300005467 Bacteria 1142
68 Ga0070706_100510812 3300005467 Bacteria 1118
69 Ga0070707_100001174 3300005468 Bacteria 25766
70 Ga0070707_100054158 3300005468 Bacteria 3846
71 Ga0070698_100006078 3300005471 Bacteria 13151
72 Ga0070698_100111270 3300005471 Bacteria 2704
73 Ga0070698_100315943 3300005471 Unclassified 1493
74 Ga0070699_100000005 3300005518 Bacteria 384287
75 Ga0070699_100003942 3300005518 Bacteria 13111
76 Ga0070699_100029764 3300005518 Bacteria 4709
77 Ga0070699_100078038 3300005518 Bacteria 2884
78 Ga0070699_100100447 3300005518 Bacteria 2536
79 Ga0070699_100122772 3300005518 Bacteria 2285
80 Ga0070699_100237226 3300005518 Bacteria 1627
81 Ga0070699_100287808 3300005518 Bacteria 1473
82 Ga0070679_100007892 3300005530 Bacteria 9985
83 Ga0070679_100015761 3300005530 Bacteria 7271
84 Ga0070679_100017895 3300005530 Bacteria 6864
85 Ga0070679_100035556 3300005530 Bacteria 4943
86 Ga0070679_100103902 3300005530 Bacteria 2827
87 Ga0070679_100104393 3300005530 Bacteria 2820
88 Ga0070679_100147606 3300005530 Bacteria 2329
89 Ga0070684_100003277 3300005535 Bacteria 12122
90 Ga0070684_100031153 3300005535 Bacteria 4538
91 Ga0070684_100273905 3300005535 Bacteria 1545
92 Ga0070697_100014045 3300005536 Bacteria 6290
93 Ga0070697_100060051 3300005536 Bacteria 3098
94 Ga0070697_100063258 3300005536 Bacteria 3021
95 Ga0070697_100186023 3300005536 Bacteria 1761
96 Ga0068853_100040406 3300005539 Bacteria 3980
97 Ga0070695_100004909 3300005545 Bacteria 7886
98 Ga0070695_100118354 3300005545 Bacteria 1809
99 Ga0070696_100003441 3300005546 Bacteria 10542
100 Ga0070696_100023539 3300005546 Bacteria 4187
101 Ga0070693_100040926 3300005547 Bacteria 2604
102 Ga0070693_100076263 3300005547 Bacteria 1987
103 Ga0070693_100096984 3300005547 Bacteria 1788
104 Ga0070665_100000235 3300005548 Bacteria 91903
105 Ga0070665_100468714 3300005548 Bacteria 1270
106 Ga0070665_100681705 3300005548 Bacteria 1041
107 Ga0070704_100235221 3300005549 Bacteria 1497
108 Ga0068855_100000575 3300005563 Bacteria 45015
109 Ga0068855_100012943 3300005563 Bacteria 10064
110 Ga0068855_100253672 3300005563 Bacteria 1962
111 Ga0068855_100507749 3300005563 Bacteria 1309
112 Ga0070664_100031389 3300005564 Bacteria 4438
113 Ga0068854_100066028 3300005578 Bacteria 2632
114 Ga0068856_100103255 3300005614 Bacteria 2844
115 Ga0068856_100269024 3300005614 Bacteria 1720
116 Ga0070702_100081001 3300005615 Bacteria 1944
117 Ga0068852_100113591 3300005616 Bacteria 2467
118 Ga0068859_100012017 3300005617 Bacteria 8698
119 Ga0068859_100047750 3300005617 Bacteria 4301
120 Ga0068859_100925459 3300005617 Bacteria 956
121 Ga0068864_100007082 3300005618 Bacteria 9207
122 Ga0068864_100148696 3300005618 Bacteria 2120
123 Ga0068864_100241638 3300005618 Bacteria 1673
124 Ga0068866_10010943 3300005718 Bacteria 3907
125 Ga0068861_100246884 3300005719 Bacteria 1521
126 Ga0068863_100025379 3300005841 Bacteria 5651
127 Ga0068863_100057293 3300005841 Bacteria 3688
128 Ga0068858_100247436 3300005842 Bacteria 1693
129 Ga0068860_100023785 3300005843 Bacteria 5922
130 Ga0068860_100024771 3300005843 Bacteria 5796
131 Ga0068862_100050605 3300005844 Bacteria 3551
132 Ga0081539_10000091 3300005985 Bacteria 211445
133 Ga0070717_10062619 3300006028 Bacteria 3085
134 Ga0070716_100011673 3300006173 Bacteria 4427
135 Ga0070712_100138142 3300006175 Bacteria 1856
136 Ga0070712_100320561 3300006175 Bacteria 1260
137 Ga0097621_100027482 3300006237 Bacteria 4475
138 Ga0068871_100053092 3300006358 Bacteria 3284
139 Ga0068871_100063521 3300006358 Bacteria 3020
140 Ga0068871_100609138 3300006358 Bacteria 994
141 Ga0075428_100001555 3300006844 Bacteria 24580
142 Ga0075428_100051720 3300006844 Bacteria 4505
143 Ga0075430_100123577 3300006846 Bacteria 2157
144 Ga0075431_100001632 3300006847 Bacteria 20964
145 Ga0075431_100003524 3300006847 Bacteria 15165
146 Ga0075431_100491609 3300006847 Bacteria 1219
147 Ga0075431_100687100 3300006847 Bacteria 1002
148 Ga0075433_10060876 3300006852 Bacteria 3307
149 Ga0075433_10069658 3300006852 Bacteria 3090
150 Ga0075434_100007650 3300006871 Bacteria 9994
151 Ga0075429_100089045 3300006880 Bacteria 2690
152 Ga0075429_100110910 3300006880 Bacteria 2398
153 Ga0068865_100114059 3300006881 Bacteria 1998
154 Ga0068865_100274402 3300006881 Bacteria 1340
155 Ga0075436_100003368 3300006914 Bacteria 10942
156 Ga0075436_100022284 3300006914 Bacteria 4350
157 Ga0075436_100037247 3300006914 Bacteria 3358
158 Ga0075436_100038046 3300006914 Bacteria 3321
159 Ga0075436_100039972 3300006914 Bacteria 3236
160 Ga0075436_100062553 3300006914 Bacteria 2572
161 Ga0097620_100012017 3300006931 Bacteria 8698
162 Ga0097620_100047752 3300006931 Bacteria 4301
163 Ga0097620_100925314 3300006931 Bacteria 956
164 Ga0099794_10004013 3300007265 Bacteria 5719
165 Ga0099794_10043250 3300007265 Bacteria 2150
166 Ga0105240_10008739 3300009093 Bacteria 14440
167 Ga0105240_10014013 3300009093 Bacteria 10967
168 Ga0105240_10244731 3300009093 Bacteria 2077
169 Ga0105240_10328423 3300009093 Bacteria 1741
170 Ga0111539_10006462 3300009094 Bacteria 15101
171 Ga0111539_10075466 3300009094 Bacteria 3971
172 Ga0111539_10169662 3300009094 Bacteria 2549
173 Ga0111539_10173720 3300009094 Bacteria 2517
174 Ga0111539_10289002 3300009094 Bacteria 1908
175 Ga0111539_10692852 3300009094 Bacteria 1186
176 Ga0105245_10093148 3300009098 Bacteria 2776
177 Ga0114129_10002846 3300009147 Bacteria 24191
178 Ga0114129_10027932 3300009147 Bacteria 7990
179 Ga0114129_10107625 3300009147 Bacteria 3850
180 Ga0114129_10134232 3300009147 Bacteria 3397
181 Ga0114129_10266290 3300009147 Bacteria 2294
182 Ga0105243_10533500 3300009148 Bacteria 1118
183 Ga0105241_10070001 3300009174 Bacteria 2721
184 Ga0105241_10202623 3300009174 Bacteria 1658
185 Ga0105242_10337491 3300009176 Bacteria 1388
186 Ga0105248_10733977 3300009177 Bacteria 1114
187 Ga0105249_10013892 3300009553 Bacteria 7118
188 Ga0105249_10655131 3300009553 Bacteria 1108
189 Ga0105239_10834002 3300010375 Bacteria 1057
190 Ga0105246_10109761 3300011119 Bacteria 2024
191 Ga0157373_10025551 3300013100 Bacteria 4270
192 Ga0157373_10117117 3300013100 Bacteria 1872
193 Ga0157373_10150025 3300013100 Bacteria 1640
194 Ga0157370_10006717 3300013104 Bacteria 12625
195 Ga0157370_10080409 3300013104 Bacteria 3068
196 Ga0157369_10033617 3300013105 Bacteria 5634
197 Ga0157369_10043043 3300013105 Bacteria 4923
198 Ga0157369_10056684 3300013105 Bacteria 4228
199 Ga0157369_10443507 3300013105 Bacteria 1344
200 Ga0157369_10554746 3300013105 Bacteria 1187
201 Ga0157374_10111858 3300013296 Bacteria 2627
202 Ga0157374_10368430 3300013296 Bacteria 1429
203 Ga0157378_10007378 3300013297 Bacteria 9606
204 Ga0157378_10024734 3300013297 Bacteria 5287
205 Ga0157378_10173681 3300013297 Bacteria 2023
206 Ga0157378_10241680 3300013297 Bacteria 1725
207 Ga0157378_10922664 3300013297 Bacteria 905
208 Ga0163162_10274092 3300013306 Bacteria 1819
209 Ga0163162_10619351 3300013306 Bacteria 1208
210 Ga0157372_10011796 3300013307 Bacteria 9308
211 Ga0157372_10012338 3300013307 Bacteria 9106
212 Ga0157372_10198457 3300013307 Bacteria 2324
213 Ga0157372_10378680 3300013307 Bacteria 1649
214 Ga0157375_10027751 3300013308 Bacteria 5296
215 Ga0157375_10051227 3300013308 Bacteria 4053
216 Ga0157375_10410420 3300013308 Bacteria 1520
217 Ga0157375_11177121 3300013308 Bacteria 899
218 Ga0163163_10088641 3300014325 Bacteria 3105
219 Ga0157380_10141601 3300014326 Bacteria 2067
220 Ga0157376_10045238 3300014969 Bacteria 3623
221 Ga0157376_10187671 3300014969 Bacteria 1894
222 Ga0163161_10002047 3300017792 Bacteria 14607
223 Ga0163161_10014823 3300017792 Bacteria 5431
224 Ga0163161_10167405 3300017792 Bacteria 1679
225 Ga0213872_10013176 3300021361 Bacteria 3877
226 Ga0213872_10021808 3300021361 Unclassified 2950
227 Ga0213872_10042231 3300021361 Bacteria 2080
228 Ga0213876_10001571 3300021384 Bacteria 14045
229 Ga0213875_10028127 3300021388 Bacteria 2673
230 Ga0213871_10072475 3300021441 Bacteria 975
231 Ga0207692_10151740 3300025898 Bacteria 1327
232 Ga0207642_10013605 3300025899 Bacteria 2974
233 Ga0207680_10024793 3300025903 Bacteria 3297
234 Ga0207699_10015130 3300025906 Bacteria 4002
235 Ga0207699_10297747 3300025906 Bacteria 1126
236 Ga0207645_10208441 3300025907 Bacteria 1287
237 Ga0207645_10277388 3300025907 Bacteria 1113
238 Ga0207705_10018139 3300025909 Bacteria 5031
239 Ga0207705_10020682 3300025909 Bacteria 4700
240 Ga0207705_10136625 3300025909 Bacteria 1828
241 Ga0207684_10134990 3300025910 Bacteria 2118
242 Ga0207684_10164411 3300025910 Bacteria 1912
243 Ga0207684_10262314 3300025910 Bacteria 1491
244 Ga0207684_10326243 3300025910 Bacteria 1323
245 Ga0207684_10375075 3300025910 Bacteria 1224
246 Ga0207707_10000988 3300025912 Bacteria 27336
247 Ga0207707_10001924 3300025912 Bacteria 18876
248 Ga0207707_10005051 3300025912 Bacteria 11577
249 Ga0207707_10010257 3300025912 Bacteria 8130
250 Ga0207707_10019747 3300025912 Bacteria 5883
251 Ga0207707_10121967 3300025912 Bacteria 2279
252 Ga0207707_10175904 3300025912 Bacteria 1870
253 Ga0207707_10187450 3300025912 Bacteria 1805
254 Ga0207695_10004228 3300025913 Bacteria 19737
255 Ga0207695_10027148 3300025913 Bacteria 6377
256 Ga0207695_10102843 3300025913 Bacteria 2849
257 Ga0207695_10652942 3300025913 Bacteria 933
258 Ga0207671_10041096 3300025914 Bacteria 3422
259 Ga0207693_10190446 3300025915 Bacteria 1614
260 Ga0207660_10032323 3300025917 Bacteria 3611
261 Ga0207660_10043414 3300025917 Bacteria 3160
262 Ga0207660_10106663 3300025917 Bacteria 2101
263 Ga0207660_10177324 3300025917 Bacteria 1653
264 Ga0207660_10229879 3300025917 Bacteria 1458
265 Ga0207662_10010864 3300025918 Bacteria 5033
266 Ga0207657_10160618 3300025919 Bacteria 1825
267 Ga0207649_10031648 3300025920 Bacteria 3146
268 Ga0207649_10090584 3300025920 Bacteria 2001
269 Ga0207652_10005896 3300025921 Bacteria 9915
270 Ga0207652_10026167 3300025921 Bacteria 4856
271 Ga0207652_10102889 3300025921 Bacteria 2524
272 Ga0207652_10134250 3300025921 Bacteria 2209
273 Ga0207652_10173015 3300025921 Bacteria 1938
274 Ga0207652_10248762 3300025921 Bacteria 1603
275 Ga0207652_10812644 3300025921 Bacteria 830
276 Ga0207646_10002046 3300025922 Bacteria 24232
277 Ga0207646_10148669 3300025922 Bacteria 2112
278 Ga0207646_10215295 3300025922 Bacteria 1735
279 Ga0207681_10295189 3300025923 Bacteria 1281
280 Ga0207650_10012022 3300025925 Bacteria 5967
281 Ga0207700_10054036 3300025928 Bacteria 3013
282 Ga0207644_10020000 3300025931 Bacteria 4548
283 Ga0207644_10078344 3300025931 Bacteria 2436
284 Ga0207644_10328887 3300025931 Bacteria 1237
285 Ga0207690_10013583 3300025932 Bacteria 4895
286 Ga0207690_10192323 3300025932 Bacteria 1544
287 Ga0207690_10198248 3300025932 Bacteria 1523
288 Ga0207706_10033383 3300025933 Bacteria 4582
289 Ga0207686_10113600 3300025934 Bacteria 1831
290 Ga0207709_10167988 3300025935 Bacteria 1537
291 Ga0207670_10575579 3300025936 Bacteria 922
292 Ga0207669_10010153 3300025937 Bacteria 4522
293 Ga0207669_10180170 3300025937 Bacteria 1514
294 Ga0207704_10383507 3300025938 Bacteria 1104
295 Ga0207704_10567351 3300025938 Bacteria 925
296 Ga0207665_10000353 3300025939 Bacteria 31856
297 Ga0207665_10055518 3300025939 Bacteria 2672
298 Ga0207691_10097612 3300025940 Bacteria 2626
299 Ga0207691_10108308 3300025940 Bacteria 2473
300 Ga0207661_10000775 3300025944 Bacteria 20758
301 Ga0207661_10168838 3300025944 Bacteria 1903
302 Ga0207661_10205556 3300025944 Bacteria 1733
303 Ga0207661_10232053 3300025944 Bacteria 1634
304 Ga0207667_10027040 3300025949 Bacteria 6255
305 Ga0207667_10254877 3300025949 Bacteria 1795
306 Ga0207651_10172249 3300025960 Bacteria 1708
307 Ga0207712_10022359 3300025961 Bacteria 4162
308 Ga0207712_10105962 3300025961 Bacteria 2099
309 Ga0207668_10016839 3300025972 Bacteria 4571
310 Ga0207640_10137328 3300025981 Bacteria 1777
311 Ga0207658_10442895 3300025986 Bacteria 1149
312 Ga0207677_10196345 3300026023 Bacteria 1600
313 Ga0207703_10147675 3300026035 Bacteria 2047
314 Ga0207703_10498966 3300026035 Bacteria 1142
315 Ga0207678_10017222 3300026067 Bacteria 6344
316 Ga0207678_10347988 3300026067 Bacteria 1278
317 Ga0207708_10023395 3300026075 Bacteria 4669
318 Ga0207702_10122128 3300026078 Bacteria 2333
319 Ga0207702_10207962 3300026078 Bacteria 1818
320 Ga0207648_10007202 3300026089 Bacteria 10969
321 Ga0207648_10054948 3300026089 Bacteria 3476
322 Ga0207648_10085312 3300026089 Bacteria 2755
323 Ga0207676_10115574 3300026095 Bacteria 2253
324 Ga0207676_10129457 3300026095 Bacteria 2143
325 Ga0207676_10174355 3300026095 Bacteria 1877
326 Ga0207675_100172658 3300026118 Bacteria 2067
327 Ga0207683_10009043 3300026121 Bacteria 8488
328 Ga0207683_10016563 3300026121 Bacteria 6276
329 Ga0207683_10081509 3300026121 Archaea 2872
330 Ga0207683_10318879 3300026121 Bacteria 1423
331 Ga0207698_10526839 3300026142 Bacteria 1154
332 Ga0209969_1016459 3300027360 Bacteria 1085
333 Ga0209968_1001405 3300027526 Bacteria 3649
334 Ga0209968_1009733 3300027526 Bacteria 1473
335 Ga0209999_1001616 3300027543 Bacteria 3883
336 Ga0209588_1011956 3300027671 Bacteria 2629
337 Ga0209588_1135890 3300027671 Bacteria 783
338 Ga0209966_1005202 3300027695 Bacteria 2228
339 Ga0209998_10002325 3300027717 Bacteria 4391
340 Ga0207428_10181076 3300027907 Bacteria 1592
341 Ga0268266_10000147 3300028379 Bacteria 135216
342 Ga0268265_10054755 3300028380 Bacteria 3029
343 Ga0268264_10023004 3300028381 Bacteria 5085
344 Ga0265319_1000004 3300028563 Bacteria 305085
345 Ga0265336_10029635 3300028666 Bacteria 1707
346 Ga0265760_10039952 3300031090 Bacteria 1397
347 Ga0307408_100003808 3300031548 Bacteria 10273
348 Ga0265313_10009188 3300031595 Bacteria 6447
349 Ga0307508_10124616 3300031616 Bacteria 2179
350 Ga0307405_10005701 3300031731 Bacteria 6042
351 Ga0307405_10043508 3300031731 Bacteria 2740
352 Ga0307405_10201092 3300031731 Bacteria 1447
353 Ga0307413_10009128 3300031824 Bacteria 4729
354 Ga0307413_10010709 3300031824 Bacteria 4466
355 Ga0307413_10199943 3300031824 Bacteria 1442
356 Ga0307410_10003284 3300031852 Bacteria 8079
357 Ga0307410_10005033 3300031852 Bacteria 6941
358 Ga0307410_10037232 3300031852 Bacteria 3175
359 Ga0307410_10088625 3300031852 Bacteria 2191
360 Ga0307410_10156285 3300031852 Bacteria 1703
361 Ga0307410_10177177 3300031852 Bacteria 1611
362 Ga0307410_10240955 3300031852 Bacteria 1401
363 Ga0307410_10247833 3300031852 Bacteria 1384
364 Ga0307406_10006231 3300031901 Bacteria 6568
365 Ga0307406_10012889 3300031901 Bacteria 4776
366 Ga0307406_10034267 3300031901 Bacteria 3114
367 Ga0307406_10099979 3300031901 Bacteria 1973
368 Ga0307407_10000525 3300031903 Bacteria 11926
369 Ga0307407_10016117 3300031903 Bacteria 3712
370 Ga0307407_10086790 3300031903 Bacteria 1907
371 Ga0307407_10389000 3300031903 Bacteria 998
372 Ga0307412_10003596 3300031911 Bacteria 8610
373 Ga0307412_10063257 3300031911 Bacteria 2495
374 Ga0307412_10063730 3300031911 Bacteria 2488
375 Ga0307409_100013872 3300031995 Bacteria 5211
376 Ga0307409_100053436 3300031995 Bacteria 3103
377 Ga0307409_100226129 3300031995 Bacteria 1692
378 Ga0307409_100734613 3300031995 Bacteria 990
379 Ga0307416_100006835 3300032002 Bacteria 7178
380 Ga0307416_100018075 3300032002 Bacteria 4955
381 Ga0307416_100024505 3300032002 Bacteria 4406
382 Ga0307416_100026289 3300032002 Bacteria 4286
383 Ga0307416_100034294 3300032002 Bacteria 3860
384 Ga0307416_100074539 3300032002 Bacteria 2836
385 Ga0307416_100203742 3300032002 Bacteria 1880
386 Ga0307416_100386956 3300032002 Bacteria 1431
387 Ga0307414_10092247 3300032004 Bacteria 2254
388 Ga0307414_10122832 3300032004 Bacteria 2000
389 Ga0307414_10396110 3300032004 Bacteria 1198
390 Ga0307414_10733227 3300032004 Bacteria 897
391 Ga0307411_10012071 3300032005 Bacteria 4693
392 Ga0307411_10036009 3300032005 Bacteria 3096
393 Ga0307411_10123284 3300032005 Bacteria 1879
394 Ga0307415_100007943 3300032126 Bacteria 5842
395 Ga0307415_100066855 3300032126 Bacteria 2510
396 Ga0307415_100088369 3300032126 Bacteria 2236
397 Ga0307415_100203956 3300032126 Bacteria 1571
398 Ga0373959_0008725 3300034820 Bacteria 1733
399 Ga0373929_0012445 3300035085 Bacteria 1617
400 Ga0373940_0051516 3300035088 Bacteria 1158
401 Ga0373951_0054871 3300035091 Bacteria 987
402 Ga0373923_0010301 3300035111 Bacteria 3397
403 Ga0373932_0041022 3300035112 Bacteria 1336
404 Ga0373954_0005888 3300035118 Bacteria 5329
405 Ga0373956_0001960 3300035119 Bacteria 8521
406 Ga0373957_0097194 3300035120 Bacteria 1176
407 Ga0373943_0008709 3300035170 Bacteria 4549
408 Ga0373955_0060645 3300035172 Bacteria 2087
409 Ga0373942_0046770 3300035207 Bacteria 1200
410 Ga0373935_0020533 3300035692 Bacteria 4037
411 Ga0373927_0001201 3300035695 Bacteria 19664
412 Ga0373927_0030297 3300035695 Bacteria 3530
413 Ga0373927_0164434 3300035695 Bacteria 1454
414 Ga0373933_0009245 3300035724 Bacteria 5381
415 Ga0373937_0002168 3300036401 Bacteria 16442
416 Ga0373937_0002247 3300036401 Bacteria 16119
417 Ga0373937_0015906 3300036401 Bacteria 6672
418 Ga0373937_0026952 3300036401 Bacteria 5195
419 Ga0395905_0027078 3300037471 Bacteria 5406
420 Ga0395905_0652979 3300037471 Bacteria 954
421 Ga0436364_0501893 3300037853 Bacteria 3109
422 Ga0436364_0917857 3300037853 Bacteria 3300
423 Ga0436364_1121491 3300037853 Bacteria 1340
424 Ga0436365_0980681 3300039437 Bacteria 16656
425 Ga0436365_0983332 3300039437 Bacteria 2832
426 Ga0436360_0242098 3300039438 Bacteria 4776
427 Ga0436361_0684364 3300039447 Bacteria 6544
428 Ga0436361_1153452 3300039447 Bacteria 2148
429 Ga0436363_0977531 3300039450 Bacteria 1228
430 Ga0436362_0010689 3300039453 Bacteria 2020
431 Ga0439433_0019348 3300041999 Bacteria 1517
432 Ga0439446_0044601 3300042156 Bacteria 1312
433 Ga0439434_0053311 3300042435 Bacteria 1256
434 Ga0439435_0067669 3300042436 Bacteria 1052
435 Ga0466969_0062408 3300044656 Bacteria 1808
436 Ga0453683_0051454 3300044673 Bacteria 2580
437 Ga0466966_0056711 3300044684 Bacteria 2478
438 Ga0466963_0048087 3300044694 Bacteria 2817
439 Ga0466959_0082416 3300045049 Bacteria 2317
440 Ga0451576_0399755 3300045051 Bacteria 1440
441 Ga0495592_0152671 3300046454 Bacteria 1596
442 Ga0495629_0194325 3300046459 Bacteria 1404
443 Ga0495580_0018051 3300046472 Bacteria 5260
444 Ga0495580_0079826 3300046472 Bacteria 2282
445 Ga0495580_0108070 3300046472 Bacteria 1931
446 Ga0495582_0069203 3300046473 Bacteria 1951
447 Ga0495639_0029958 3300046475 Bacteria 2417
448 Ga0495664_0153361 3300046477 Bacteria 1397
449 Ga0495594_0008475 3300046499 Bacteria 5298
450 Ga0495594_0009198 3300046499 Bacteria 5098
451 Ga0495594_0264769 3300046499 Bacteria 979
452 Ga0495608_0016070 3300046511 Bacteria 5179
453 Ga0495618_0142191 3300046514 Bacteria 1534
454 Ga0495630_0006389 3300046517 Bacteria 8381
455 Ga0495630_0131266 3300046517 Bacteria 1902
456 Ga0495666_0072230 3300046526 Bacteria 1639
457 Ga0495652_0049795 3300046529 Bacteria 3584
458 Ga0495640_0045808 3300046533 Bacteria 3034
459 Ga0495640_0136344 3300046533 Bacteria 1585
460 Ga0495586_0017163 3300046535 Bacteria 3847
461 Ga0495587_0000482 3300046536 Bacteria 27682
462 Ga0495587_0082549 3300046536 Bacteria 1862
463 Ga0495621_0021169 3300046539 Bacteria 2141
464 Ga0495645_0000281 3300046543 Bacteria 37502
465 Ga0495667_0010652 3300046559 Bacteria 6216
466 Ga0495667_0063289 3300046559 Bacteria 2422
467 Ga0495634_0029490 3300046642 Bacteria 3798
468 Ga0495635_0008778 3300046663 Bacteria 7057
469 Ga0495635_0039748 3300046663 Bacteria 3253
470 Ga0495657_0002538 3300046675 Bacteria 15310
471 Ga0495599_0012658 3300046678 Bacteria 5203
472 Ga0495599_0116796 3300046678 Bacteria 1660
473 Ga0495623_0001495 3300046679 Bacteria 15855
474 Ga0495623_0051016 3300046679 Bacteria 2619
475 Ga0495623_0062236 3300046679 Bacteria 2339
476 Ga0495623_0271947 3300046679 Bacteria 946
477 Ga0495647_0041888 3300046681 Bacteria 1746
478 Ga0495658_0125763 3300046683 Bacteria 1555
479 Ga0495658_0170850 3300046683 Bacteria 1345
480 Ga0495613_0030875 3300046689 Bacteria 3980
481 Ga0495613_0189869 3300046689 Bacteria 1452
482 Ga0495624_0002683 3300046690 Bacteria 13415
483 Ga0495624_0138564 3300046690 Bacteria 1491
484 Ga0495600_0014660 3300046809 Bacteria 4941
485 Ga0495600_0051736 3300046809 Bacteria 2681
486 Ga0495604_0001304 3300047317 Bacteria 20380
487 Ga0495604_0039649 3300047317 Bacteria 3701
488 Ga0495674_0034066 3300047319 Bacteria 4607
489 Ga0495680_0009874 3300047322 Bacteria 8555
490 Ga0495680_0275651 3300047322 Bacteria 1187
491 Ga0495675_0019969 3300047444 Bacteria 4258
492 Ga0495684_0057858 3300047471 Bacteria 2954
493 Ga0495684_0242180 3300047471 Bacteria 1315
494 Ga0495684_0253435 3300047471 Bacteria 1279
495 Ga0495593_0007439 3300047673 Bacteria 6408
496 Ga0495602_0029451 3300048088 Bacteria 5227
497 Ga0496101_0059169 3300048904 Bacteria 2777
498 Ga0496102_0064133 3300048905 Bacteria 3365
499 Ga0496102_0113242 3300048905 Bacteria 2531
500 Ga0496104_0202899 3300048907 Bacteria 1895
501 Ga0496105_0107794 3300048908 Bacteria 2300
502 Ga0496105_0151613 3300048908 Bacteria 1905
503 Ga0496108_0001699 3300048911 Bacteria 17458
504 Ga0496108_0034487 3300048911 Bacteria 4205
505 Ga0496109_0001520 3300048912 Bacteria 19309
506 Ga0496109_0069828 3300048912 Bacteria 3223
507 Ga0496110_0043763 3300048913 Bacteria 3910
508 Ga0496111_0019386 3300048914 Bacteria 4723
509 Ga0496112_0025175 3300048915 Bacteria 5711
510 Ga0496112_0336874 3300048915 Bacteria 1452
511 Ga0496112_0342824 3300048915 Bacteria 1437
512 Ga0496112_0480810 3300048915 Bacteria 1178
513 Ga0496113_0000045 3300048916 Bacteria 51839
514 Ga0496113_0433832 3300048916 Bacteria 1055
515 Ga0496114_0004558 3300048917 Bacteria 10762
516 Ga0496114_0071373 3300048917 Bacteria 2918
517 Ga0501040_0145748 3300049576 Bacteria 1669
518 Ga0501041_0182574 3300049577 Bacteria 1313
519 Ga0501042_0026072 3300049578 Bacteria 4109
520 Ga0501042_0322134 3300049578 Bacteria 1117
521 Ga0501046_0000007 3300049580 Bacteria 356002
522 Ga0501046_0347306 3300049580 Bacteria 1078
523 Ga0501047_0002779 3300049581 Bacteria 16630
524 Ga0501048_0005345 3300049582 Bacteria 9774
525 Ga0501048_0047088 3300049582 Bacteria 3077
526 Ga0501076_0144807 3300049592 Bacteria 1932
527 Ga0501076_0222047 3300049592 Bacteria 1544
528 Ga0501202_002164 3300049652 Bacteria 3271
529 Ga0501216_001839 3300049660 Bacteria 2929
530 Ga0501217_008724 3300049661 Bacteria 2196
531 Ga0501224_025270 3300049664 Bacteria 888
532 Ga0501230_014762 3300049667 Bacteria 1287
533 Ga0501233_015316 3300049668 Bacteria 1577
534 Ga0501235_001140 3300049669 Bacteria 5574
535 Ga0501249_003903 3300049679 Bacteria 3012
536 Ga0501251_011038 3300049681 Bacteria 1070
537 Ga0501252_006973 3300049682 Bacteria 1269
538 Ga0501259_010116 3300049688 Bacteria 1539
539 Ga0501221_004359 3300049704 Bacteria 2346
540 Ga0501225_0002931 3300049705 Bacteria 5234
541 Ga0501234_003567 3300049707 Bacteria 2444
542 Ga0501079_0282735 3300049741 Bacteria 1297
543 Ga0501081_0124794 3300049743 Bacteria 1836
544 Ga0501081_0199377 3300049743 Bacteria 1451
545 Ga0501083_0000032 3300049744 Bacteria 102761
546 Ga0501268_007645 3300049765 Bacteria 1617
547 Ga0501035_0028247 3300049822 Bacteria 5121
548 Ga0501044_0385959 3300049823 Bacteria 1315
549 Ga0501045_0035278 3300049824 Bacteria 3631
550 Ga0501045_0183038 3300049824 Bacteria 1561
551 Ga0501212_006197 3300049851 Bacteria 1606
552 nmdc:mga05p37_154290_c1 3300050507 Bacteria 2807
553 nmdc:mga05p37_29_c1 3300050507 Bacteria 114400
554 nmdc:mga05p37_498005_c1 3300050507 Bacteria 1399
555 nmdc:mga05p37_96891_c1 3300050507 Bacteria 3634
556 nmdc:mga09592_14387_c1 3300050508 Bacteria 6458
557 nmdc:mga0qj67_48814_c1 3300050509 Bacteria 3344
558 nmdc:mga06r32_14295_c1 3300050510 Bacteria 7200
559 nmdc:mga06r32_167161_c1 3300050510 Bacteria 2183
560 nmdc:mga06r32_396020_c1 3300050510 Bacteria 1363
561 nmdc:mga06r32_429834_c1 3300050510 Bacteria 1301
562 nmdc:mga06r32_5842_c1 3300050510 Bacteria 11076
563 nmdc:mga06r32_664687_c1 3300050510 Bacteria 1009
564 nmdc:mga06r32_87717_c1 3300050510 Bacteria 3036
565 nmdc:mga08y16_107673_c1 3300050511 Bacteria 2902
566 nmdc:mga08y16_12052_c1 3300050511 Bacteria 9084
567 nmdc:mga08y16_178568_c1 3300050511 Bacteria 2205
568 nmdc:mga08y16_196218_c1 3300050511 Bacteria 2092
569 nmdc:mga08y16_201352_c1 3300050511 Bacteria 2063
570 nmdc:mga08y16_363798_c1 3300050511 Bacteria 1485
571 nmdc:mga08y16_4064_c1 3300050511 Bacteria 15280
572 nmdc:mga08y16_50788_c1 3300050511 Bacteria 4339
573 nmdc:mga08y16_65981_c1 3300050511 Bacteria 3777
574 nmdc:mga08y16_817407_c1 3300050511 Bacteria 924
575 nmdc:mga0n895_113412_c1 3300050512 Bacteria 2728
576 nmdc:mga0n895_406234_c1 3300050512 Bacteria 1377
577 nmdc:mga08x19_1980_c1 3300050514 Bacteria 12546
578 nmdc:mga08x19_19932_c1 3300050514 Bacteria 4124
579 nmdc:mga08x19_285771_c1 3300050514 Bacteria 1144
580 nmdc:mga08x19_34822_c1 3300050514 Bacteria 3184
581 nmdc:mga08x19_384_c1 3300050514 Bacteria 31046
582 nmdc:mga08x19_57610_c1 3300050514 Bacteria 2511
583 nmdc:mga08x19_74283_c1 3300050514 Bacteria 2221
584 nmdc:mga0a205_102432_c1 3300050515 Bacteria 2761
585 nmdc:mga0a205_311843_c1 3300050515 Bacteria 1445
586 nmdc:mga0a205_362495_c1 3300050515 Bacteria 1316
587 nmdc:mga0a205_63829_c1 3300050515 Bacteria 3557
588 Ga0500556_0015581 3300053104 Bacteria 2348
589 Ga0500628_000158 3300053129 Bacteria 13094
590 Ga0590071_000045 3300059421 Bacteria 31970
591 Ga0590074_004409 3300059423 Bacteria 2327
592 Ga0590075_003436 3300059424 Bacteria 3766
593 Ga0590077_000522 3300059426 Bacteria 10624
594 Ga0501082_0095547 3300060353 Bacteria 2569
595 Ga0501082_0353527 3300060353 Bacteria 1281
596 Ga0530510_0585526 3300061734 Bacteria 848

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0064133 Ga0496102_0064133_35_733 227
2 3300005617 Ga0068859_100925459 Ga0068859_1009254592 231
3 3300006931 Ga0097620_100925314 Ga0097620_1009253141 231
4 3300025938 Ga0207704_10567351 Ga0207704_105673511 231
5 3300005434 Ga0070709_10314855 Ga0070709_103148552 236
6 3300048905 Ga0496102_0113242 Ga0496102_0113242_1297_2061 236
7 3300050514 nmdc:mga08x19_34822_c1 nmdc:mga08x19_34822_c1_952_1716 236
8 3300005336 Ga0070680_100025541 Ga0070680_1000255412 238
9 3300025912 Ga0207707_10010257 Ga0207707_100102576 238
10 3300025917 Ga0207660_10229879 Ga0207660_102298792 238
11 3300025921 Ga0207652_10134250 Ga0207652_101342502 238
12 3300031731 Ga0307405_10043508 Ga0307405_100435083 238
13 3300031852 Ga0307410_10037232 Ga0307410_100372323 238
14 3300031903 Ga0307407_10000525 Ga0307407_100005255 238
15 3300031911 Ga0307412_10003596 Ga0307412_100035965 238
16 3300032002 Ga0307416_100026289 Ga0307416_1000262893 238
17 3300032005 Ga0307411_10036009 Ga0307411_100360092 238
18 3300005518 Ga0070699_100029764 Ga0070699_1000297641 239
19 3300006914 Ga0075436_100062553 Ga0075436_1000625532 239
20 3300050512 nmdc:mga0n895_406234_c1 nmdc:mga0n895_406234_c1_87_842 239
21 3300031903 Ga0307407_10086790 Ga0307407_100867902 241
22 3300032002 Ga0307416_100386956 Ga0307416_1003869562 241
23 3300006847 Ga0075431_100491609 Ga0075431_1004916092 242
24 3300041999 Ga0439433_0019348 Ga0439433_0019348_403_1140 242
25 3300050510 nmdc:mga06r32_396020_c1 nmdc:mga06r32_396020_c1_272_1009 242
26 3300050510 nmdc:mga06r32_429834_c1 nmdc:mga06r32_429834_c1_283_1020 242
27 3300050510 nmdc:mga06r32_664687_c1 nmdc:mga06r32_664687_c1_187_924 242
28 3300053104 Ga0500556_0015581 Ga0500556_0015581_1117_1857 242
29 3300061734 Ga0530510_0585526 Ga0530510_0585526_26_829 242
30 3300046539 Ga0495621_0021169 Ga0495621_0021169_1377_2120 243
31 3300005841 Ga0068863_100025379 Ga0068863_1000253792 244
32 3300035091 Ga0373951_0054871 Ga0373951_0054871_29_862 244
33 3300048908 Ga0496105_0151613 Ga0496105_0151613_83_916 244
34 3300048911 Ga0496108_0001699 Ga0496108_0001699_16461_17294 244
35 3300048911 Ga0496108_0034487 Ga0496108_0034487_1823_2656 244
36 3300048912 Ga0496109_0001520 Ga0496109_0001520_1007_1840 244
37 3300048913 Ga0496110_0043763 Ga0496110_0043763_2177_3010 244
38 3300048914 Ga0496111_0019386 Ga0496111_0019386_2500_3333 244
39 3300048915 Ga0496112_0480810 Ga0496112_0480810_223_1056 244
40 3300048916 Ga0496113_0000045 Ga0496113_0000045_800_1633 244
41 3300048916 Ga0496113_0433832 Ga0496113_0433832_78_911 244
42 3300005354 Ga0070675_100317604 Ga0070675_1003176042 245
43 3300005440 Ga0070705_100373802 Ga0070705_1003738022 245
44 3300006844 Ga0075428_100001555 Ga0075428_1000015551 245
45 3300006880 Ga0075429_100089045 Ga0075429_1000890452 245
46 3300009094 Ga0111539_10173720 Ga0111539_101737202 245
47 3300042436 Ga0439435_0067669 Ga0439435_0067669_255_992 245
48 3300045051 Ga0451576_0399755 Ga0451576_0399755_388_1134 245
49 3300046683 Ga0495658_0170850 Ga0495658_0170850_447_1187 245
50 3300050510 nmdc:mga06r32_87717_c1 nmdc:mga06r32_87717_c1_1469_2209 245
51 3300050511 nmdc:mga08y16_201352_c1 nmdc:mga08y16_201352_c1_914_1651 245
52 3300005340 Ga0070689_100347784 Ga0070689_1003477842 246
53 3300005347 Ga0070668_100325558 Ga0070668_1003255581 246
54 3300005440 Ga0070705_100191399 Ga0070705_1001913991 246
55 3300005466 Ga0070685_10002842 Ga0070685_100028424 246
56 3300005467 Ga0070706_100242830 Ga0070706_1002428302 246
57 3300005467 Ga0070706_100510812 Ga0070706_1005108122 246
58 3300005471 Ga0070698_100006078 Ga0070698_10000607811 246
59 3300005518 Ga0070699_100000005 Ga0070699_100000005250 246
60 3300005518 Ga0070699_100003942 Ga0070699_1000039424 246
61 3300005518 Ga0070699_100100447 Ga0070699_1001004472 246
62 3300005518 Ga0070699_100287808 Ga0070699_1002878082 246
63 3300005548 Ga0070665_100000235 Ga0070665_10000023520 246
64 3300005564 Ga0070664_100031389 Ga0070664_1000313892 246
65 3300005618 Ga0068864_100148696 Ga0068864_1001486963 246
66 3300005618 Ga0068864_100241638 Ga0068864_1002416381 246
67 3300005843 Ga0068860_100024771 Ga0068860_1000247713 246
68 3300006358 Ga0068871_100053092 Ga0068871_1000530922 246
69 3300006881 Ga0068865_100274402 Ga0068865_1002744022 246
70 3300007265 Ga0099794_10043250 Ga0099794_100432502 246
71 3300009094 Ga0111539_10006462 Ga0111539_1000646210 246
72 3300009094 Ga0111539_10289002 Ga0111539_102890022 246
73 3300009147 Ga0114129_10134232 Ga0114129_101342326 246
74 3300009147 Ga0114129_10266290 Ga0114129_102662902 246
75 3300009553 Ga0105249_10655131 Ga0105249_106551311 246
76 3300013296 Ga0157374_10111858 Ga0157374_101118582 246
77 3300014969 Ga0157376_10045238 Ga0157376_100452383 246
78 3300025907 Ga0207645_10277388 Ga0207645_102773882 246
79 3300025910 Ga0207684_10164411 Ga0207684_101644112 246
80 3300025925 Ga0207650_10012022 Ga0207650_100120224 246
81 3300025931 Ga0207644_10328887 Ga0207644_103288872 246
82 3300025935 Ga0207709_10167988 Ga0207709_101679882 246
83 3300025938 Ga0207704_10383507 Ga0207704_103835072 246
84 3300026095 Ga0207676_10129457 Ga0207676_101294572 246
85 3300028379 Ga0268266_10000147 Ga0268266_1000014746 246
86 3300031616 Ga0307508_10124616 Ga0307508_101246163 246
87 3300032004 Ga0307414_10733227 Ga0307414_107332271 246
88 3300035085 Ga0373929_0012445 Ga0373929_0012445_431_1171 246
89 3300039450 Ga0436363_0977531 Ga0436363_0977531_459_1199 246
90 3300044673 Ga0453683_0051454 Ga0453683_0051454_1258_2001 246
91 3300044694 Ga0466963_0048087 Ga0466963_0048087_1470_2210 246
92 3300046473 Ga0495582_0069203 Ga0495582_0069203_811_1593 246
93 3300046477 Ga0495664_0153361 Ga0495664_0153361_435_1217 246
94 3300046499 Ga0495594_0009198 Ga0495594_0009198_75_857 246
95 3300046514 Ga0495618_0142191 Ga0495618_0142191_651_1433 246
96 3300046517 Ga0495630_0131266 Ga0495630_0131266_710_1492 246
97 3300046526 Ga0495666_0072230 Ga0495666_0072230_550_1332 246
98 3300046533 Ga0495640_0045808 Ga0495640_0045808_858_1640 246
99 3300046642 Ga0495634_0029490 Ga0495634_0029490_87_869 246
100 3300046681 Ga0495647_0041888 Ga0495647_0041888_121_903 246
101 3300046683 Ga0495658_0125763 Ga0495658_0125763_146_928 246
102 3300046689 Ga0495613_0189869 Ga0495613_0189869_446_1228 246
103 3300046690 Ga0495624_0138564 Ga0495624_0138564_382_1164 246
104 3300047319 Ga0495674_0034066 Ga0495674_0034066_360_1142 246
105 3300047471 Ga0495684_0242180 Ga0495684_0242180_214_996 246
106 3300048907 Ga0496104_0202899 Ga0496104_0202899_726_1466 246
107 3300049578 Ga0501042_0322134 Ga0501042_0322134_292_1032 246
108 3300049592 Ga0501076_0222047 Ga0501076_0222047_522_1262 246
109 3300049743 Ga0501081_0199377 Ga0501081_0199377_331_1077 246
110 3300050507 nmdc:mga05p37_154290_c1 nmdc:mga05p37_154290_c1_455_1195 246
111 3300050507 nmdc:mga05p37_498005_c1 nmdc:mga05p37_498005_c1_582_1325 246
112 3300050511 nmdc:mga08y16_107673_c1 nmdc:mga08y16_107673_c1_1323_2069 246
113 3300050511 nmdc:mga08y16_12052_c1 nmdc:mga08y16_12052_c1_441_1184 246
114 3300050511 nmdc:mga08y16_4064_c1 nmdc:mga08y16_4064_c1_5991_6731 246
115 3300050511 nmdc:mga08y16_65981_c1 nmdc:mga08y16_65981_c1_193_933 246
116 3300050515 nmdc:mga0a205_311843_c1 nmdc:mga0a205_311843_c1_424_1167 246
117 3300053129 Ga0500628_000158 Ga0500628_000158_7098_7955 246
118 3300059421 Ga0590071_000045 Ga0590071_000045_10084_10824 246
119 3300059423 Ga0590074_004409 Ga0590074_004409_1053_1793 246
120 3300059424 Ga0590075_003436 Ga0590075_003436_2435_3175 246
121 3300059426 Ga0590077_000522 Ga0590077_000522_6296_7036 246
122 3300005329 Ga0070683_100137155 Ga0070683_1001371552 247
123 3300005331 Ga0070670_100010608 Ga0070670_1000106083 247
124 3300005336 Ga0070680_100229225 Ga0070680_1002292252 247
125 3300005344 Ga0070661_100001310 Ga0070661_10000131014 247
126 3300005347 Ga0070668_100035893 Ga0070668_1000358933 247
127 3300005356 Ga0070674_100781873 Ga0070674_1007818731 247
128 3300005440 Ga0070705_100005309 Ga0070705_1000053092 247
129 3300005445 Ga0070708_100002538 Ga0070708_1000025386 247
130 3300005456 Ga0070678_100007796 Ga0070678_1000077962 247
131 3300005456 Ga0070678_100245178 Ga0070678_1002451782 247
132 3300005459 Ga0068867_100076893 Ga0068867_1000768934 247
133 3300005530 Ga0070679_100103902 Ga0070679_1001039022 247
134 3300005530 Ga0070679_100104393 Ga0070679_1001043933 247
135 3300005530 Ga0070679_100147606 Ga0070679_1001476063 247
136 3300005535 Ga0070684_100273905 Ga0070684_1002739052 247
137 3300005536 Ga0070697_100060051 Ga0070697_1000600512 247
138 3300005548 Ga0070665_100468714 Ga0070665_1004687142 247
139 3300005548 Ga0070665_100681705 Ga0070665_1006817052 247
140 3300005617 Ga0068859_100012017 Ga0068859_1000120173 247
141 3300005617 Ga0068859_100047750 Ga0068859_1000477505 247
142 3300005618 Ga0068864_100007082 Ga0068864_1000070828 247
143 3300005719 Ga0068861_100246884 Ga0068861_1002468842 247
144 3300005841 Ga0068863_100057293 Ga0068863_1000572934 247
145 3300005842 Ga0068858_100247436 Ga0068858_1002474361 247
146 3300005843 Ga0068860_100023785 Ga0068860_1000237857 247
147 3300005844 Ga0068862_100050605 Ga0068862_1000506055 247
148 3300006028 Ga0070717_10062619 Ga0070717_100626192 247
149 3300006237 Ga0097621_100027482 Ga0097621_1000274822 247
150 3300006358 Ga0068871_100609138 Ga0068871_1006091382 247
151 3300006847 Ga0075431_100001632 Ga0075431_10000163222 247
152 3300006847 Ga0075431_100687100 Ga0075431_1006871001 247
153 3300006880 Ga0075429_100110910 Ga0075429_1001109102 247
154 3300006914 Ga0075436_100038046 Ga0075436_1000380462 247
155 3300006931 Ga0097620_100012017 Ga0097620_1000120173 247
156 3300006931 Ga0097620_100047752 Ga0097620_1000477522 247
157 3300007265 Ga0099794_10004013 Ga0099794_100040134 247
158 3300009094 Ga0111539_10692852 Ga0111539_106928522 247
159 3300009174 Ga0105241_10202623 Ga0105241_102026232 247
160 3300009176 Ga0105242_10337491 Ga0105242_103374912 247
161 3300009553 Ga0105249_10013892 Ga0105249_100138925 247
162 3300013297 Ga0157378_10173681 Ga0157378_101736812 247
163 3300013306 Ga0163162_10274092 Ga0163162_102740922 247
164 3300013307 Ga0157372_10198457 Ga0157372_101984572 247
165 3300013308 Ga0157375_10027751 Ga0157375_100277517 247
166 3300013308 Ga0157375_11177121 Ga0157375_111771211 247
167 3300014325 Ga0163163_10088641 Ga0163163_100886413 247
168 3300014326 Ga0157380_10141601 Ga0157380_101416013 247
169 3300017792 Ga0163161_10002047 Ga0163161_100020475 247
170 3300021361 Ga0213872_10013176 Ga0213872_100131762 247
171 3300021361 Ga0213872_10021808 Ga0213872_100218082 247
172 3300021361 Ga0213872_10042231 Ga0213872_100422311 247
173 3300025910 Ga0207684_10134990 Ga0207684_101349902 247
174 3300025912 Ga0207707_10187450 Ga0207707_101874502 247
175 3300025919 Ga0207657_10160618 Ga0207657_101606182 247
176 3300025920 Ga0207649_10031648 Ga0207649_100316483 247
177 3300025921 Ga0207652_10102889 Ga0207652_101028892 247
178 3300025921 Ga0207652_10173015 Ga0207652_101730152 247
179 3300025940 Ga0207691_10108308 Ga0207691_101083082 247
180 3300025944 Ga0207661_10168838 Ga0207661_101688382 247
181 3300025944 Ga0207661_10205556 Ga0207661_102055562 247
182 3300025961 Ga0207712_10022359 Ga0207712_100223594 247
183 3300025961 Ga0207712_10105962 Ga0207712_101059622 247
184 3300025972 Ga0207668_10016839 Ga0207668_100168394 247
185 3300026035 Ga0207703_10147675 Ga0207703_101476753 247
186 3300026035 Ga0207703_10498966 Ga0207703_104989662 247
187 3300026089 Ga0207648_10085312 Ga0207648_100853124 247
188 3300026095 Ga0207676_10115574 Ga0207676_101155741 247
189 3300026118 Ga0207675_100172658 Ga0207675_1001726583 247
190 3300026121 Ga0207683_10009043 Ga0207683_100090434 247
191 3300026121 Ga0207683_10081509 Ga0207683_100815091 247
192 3300026121 Ga0207683_10318879 Ga0207683_103188793 247
193 3300027671 Ga0209588_1011956 Ga0209588_10119563 247
194 3300028380 Ga0268265_10054755 Ga0268265_100547555 247
195 3300028381 Ga0268264_10023004 Ga0268264_100230045 247
196 3300031090 Ga0265760_10039952 Ga0265760_100399522 247
197 3300031548 Ga0307408_100003808 Ga0307408_1000038082 247
198 3300031731 Ga0307405_10005701 Ga0307405_100057015 247
199 3300031824 Ga0307413_10010709 Ga0307413_100107092 247
200 3300031852 Ga0307410_10005033 Ga0307410_100050335 247
201 3300031901 Ga0307406_10006231 Ga0307406_100062314 247
202 3300031903 Ga0307407_10016117 Ga0307407_100161174 247
203 3300031903 Ga0307407_10389000 Ga0307407_103890001 247
204 3300031911 Ga0307412_10063257 Ga0307412_100632572 247
205 3300031995 Ga0307409_100053436 Ga0307409_1000534362 247
206 3300032002 Ga0307416_100006835 Ga0307416_1000068355 247
207 3300032005 Ga0307411_10012071 Ga0307411_100120712 247
208 3300032126 Ga0307415_100007943 Ga0307415_1000079434 247
209 3300032126 Ga0307415_100088369 Ga0307415_1000883691 247
210 3300039437 Ga0436365_0983332 Ga0436365_0983332_1307_2053 247
211 3300039438 Ga0436360_0242098 Ga0436360_0242098_1590_2336 247
212 3300039447 Ga0436361_0684364 Ga0436361_0684364_316_1062 247
213 3300039447 Ga0436361_1153452 Ga0436361_1153452_274_1020 247
214 3300044656 Ga0466969_0062408 Ga0466969_0062408_866_1609 247
215 3300045049 Ga0466959_0082416 Ga0466959_0082416_15_758 247
216 3300046679 Ga0495623_0051016 Ga0495623_0051016_1860_2603 247
217 3300048915 Ga0496112_0342824 Ga0496112_0342824_309_1052 247
218 3300049576 Ga0501040_0145748 Ga0501040_0145748_731_1474 247
219 3300049664 Ga0501224_025270 Ga0501224_025270_52_795 247
220 3300050508 nmdc:mga09592_14387_c1 nmdc:mga09592_14387_c1_4753_5496 247
221 3300050510 nmdc:mga06r32_14295_c1 nmdc:mga06r32_14295_c1_6079_6822 247
222 3300050511 nmdc:mga08y16_196218_c1 nmdc:mga08y16_196218_c1_779_1525 247
223 3300050511 nmdc:mga08y16_363798_c1 nmdc:mga08y16_363798_c1_130_876 247
224 3300050511 nmdc:mga08y16_50788_c1 nmdc:mga08y16_50788_c1_994_1740 247
225 3300050512 nmdc:mga0n895_113412_c1 nmdc:mga0n895_113412_c1_261_1010 247
226 3300050514 nmdc:mga08x19_19932_c1 nmdc:mga08x19_19932_c1_2268_3011 247
227 3300050515 nmdc:mga0a205_102432_c1 nmdc:mga0a205_102432_c1_168_923 247
228 3300060353 Ga0501082_0353527 Ga0501082_0353527_144_887 247
229 3300005330 Ga0070690_100041436 Ga0070690_1000414361 248
230 3300005331 Ga0070670_100191353 Ga0070670_1001913532 248
231 3300005335 Ga0070666_10065940 Ga0070666_100659403 248
232 3300005338 Ga0068868_100088743 Ga0068868_1000887431 248
233 3300005354 Ga0070675_100072690 Ga0070675_1000726903 248
234 3300005355 Ga0070671_100058419 Ga0070671_1000584192 248
235 3300005364 Ga0070673_100029311 Ga0070673_1000293112 248
236 3300005436 Ga0070713_100035908 Ga0070713_1000359083 248
237 3300005458 Ga0070681_10024902 Ga0070681_100249025 248
238 3300005458 Ga0070681_10556348 Ga0070681_105563482 248
239 3300005467 Ga0070706_100433055 Ga0070706_1004330551 248
240 3300005530 Ga0070679_100017895 Ga0070679_1000178952 248
241 3300005615 Ga0070702_100081001 Ga0070702_1000810013 248
242 3300006358 Ga0068871_100063521 Ga0068871_1000635212 248
243 3300006844 Ga0075428_100051720 Ga0075428_1000517204 248
244 3300006852 Ga0075433_10069658 Ga0075433_100696583 248
245 3300006881 Ga0068865_100114059 Ga0068865_1001140593 248
246 3300006914 Ga0075436_100037247 Ga0075436_1000372473 248
247 3300009093 Ga0105240_10008739 Ga0105240_1000873913 248
248 3300009094 Ga0111539_10075466 Ga0111539_100754664 248
249 3300009094 Ga0111539_10169662 Ga0111539_101696622 248
250 3300009098 Ga0105245_10093148 Ga0105245_100931482 248
251 3300009147 Ga0114129_10002846 Ga0114129_1000284619 248
252 3300009148 Ga0105243_10533500 Ga0105243_105335002 248
253 3300009177 Ga0105248_10733977 Ga0105248_107339772 248
254 3300011119 Ga0105246_10109761 Ga0105246_101097613 248
255 3300013308 Ga0157375_10051227 Ga0157375_100512274 248
256 3300013308 Ga0157375_10410420 Ga0157375_104104202 248
257 3300014969 Ga0157376_10187671 Ga0157376_101876711 248
258 3300017792 Ga0163161_10014823 Ga0163161_100148233 248
259 3300021384 Ga0213876_10001571 Ga0213876_1000157114 248
260 3300021441 Ga0213871_10072475 Ga0213871_100724751 248
261 3300025903 Ga0207680_10024793 Ga0207680_100247932 248
262 3300025910 Ga0207684_10375075 Ga0207684_103750752 248
263 3300025912 Ga0207707_10019747 Ga0207707_100197472 248
264 3300025913 Ga0207695_10027148 Ga0207695_100271489 248
265 3300025914 Ga0207671_10041096 Ga0207671_100410962 248
266 3300025923 Ga0207681_10295189 Ga0207681_102951892 248
267 3300025928 Ga0207700_10054036 Ga0207700_100540363 248
268 3300025931 Ga0207644_10078344 Ga0207644_100783442 248
269 3300025934 Ga0207686_10113600 Ga0207686_101136002 248
270 3300025936 Ga0207670_10575579 Ga0207670_105755792 248
271 3300025940 Ga0207691_10097612 Ga0207691_100976123 248
272 3300025960 Ga0207651_10172249 Ga0207651_101722492 248
273 3300025986 Ga0207658_10442895 Ga0207658_104428952 248
274 3300026023 Ga0207677_10196345 Ga0207677_101963452 248
275 3300026095 Ga0207676_10174355 Ga0207676_101743552 248
276 3300026142 Ga0207698_10526839 Ga0207698_105268392 248
277 3300027671 Ga0209588_1135890 Ga0209588_11358901 248
278 3300028666 Ga0265336_10029635 Ga0265336_100296352 248
279 3300031852 Ga0307410_10247833 Ga0307410_102478333 248
280 3300035111 Ga0373923_0010301 Ga0373923_0010301_2113_2859 248
281 3300035692 Ga0373935_0020533 Ga0373935_0020533_1071_1817 248
282 3300035695 Ga0373927_0030297 Ga0373927_0030297_2208_2954 248
283 3300036401 Ga0373937_0002247 Ga0373937_0002247_9128_9874 248
284 3300036401 Ga0373937_0026952 Ga0373937_0026952_3873_4619 248
285 3300037853 Ga0436364_0917857 Ga0436364_0917857_937_1683 248
286 3300037853 Ga0436364_1121491 Ga0436364_1121491_46_792 248
287 3300039437 Ga0436365_0980681 Ga0436365_0980681_12073_12819 248
288 3300039453 Ga0436362_0010689 Ga0436362_0010689_433_1182 248
289 3300046511 Ga0495608_0016070 Ga0495608_0016070_53_799 248
290 3300046517 Ga0495630_0006389 Ga0495630_0006389_6682_7428 248
291 3300046529 Ga0495652_0049795 Ga0495652_0049795_2233_2979 248
292 3300046559 Ga0495667_0063289 Ga0495667_0063289_476_1222 248
293 3300046663 Ga0495635_0008778 Ga0495635_0008778_1206_1952 248
294 3300046663 Ga0495635_0039748 Ga0495635_0039748_752_1498 248
295 3300046675 Ga0495657_0002538 Ga0495657_0002538_5653_6399 248
296 3300046678 Ga0495599_0116796 Ga0495599_0116796_429_1175 248
297 3300046679 Ga0495623_0001495 Ga0495623_0001495_15056_15802 248
298 3300046689 Ga0495613_0030875 Ga0495613_0030875_448_1194 248
299 3300046690 Ga0495624_0002683 Ga0495624_0002683_10856_11602 248
300 3300046809 Ga0495600_0051736 Ga0495600_0051736_887_1633 248
301 3300047317 Ga0495604_0001304 Ga0495604_0001304_15589_16335 248
302 3300047322 Ga0495680_0275651 Ga0495680_0275651_77_823 248
303 3300047471 Ga0495684_0057858 Ga0495684_0057858_544_1290 248
304 3300047471 Ga0495684_0253435 Ga0495684_0253435_326_1072 248
305 3300047673 Ga0495593_0007439 Ga0495593_0007439_5548_6294 248
306 3300048088 Ga0495602_0029451 Ga0495602_0029451_4344_5090 248
307 3300048904 Ga0496101_0059169 Ga0496101_0059169_515_1261 248
308 3300048908 Ga0496105_0107794 Ga0496105_0107794_1016_1762 248
309 3300048912 Ga0496109_0069828 Ga0496109_0069828_1107_1853 248
310 3300048917 Ga0496114_0004558 Ga0496114_0004558_9954_10700 248
311 3300048917 Ga0496114_0071373 Ga0496114_0071373_1535_2281 248
312 3300049580 Ga0501046_0000007 Ga0501046_0000007_60813_61583 248
313 3300049581 Ga0501047_0002779 Ga0501047_0002779_4955_5725 248
314 3300049582 Ga0501048_0005345 Ga0501048_0005345_574_1344 248
315 3300049744 Ga0501083_0000032 Ga0501083_0000032_57548_58318 248
316 3300049822 Ga0501035_0028247 Ga0501035_0028247_2088_2858 248
317 3300049823 Ga0501044_0385959 Ga0501044_0385959_337_1107 248
318 3300049824 Ga0501045_0183038 Ga0501045_0183038_759_1529 248
319 3300050507 nmdc:mga05p37_29_c1 nmdc:mga05p37_29_c1_79534_80280 248
320 3300050511 nmdc:mga08y16_817407_c1 nmdc:mga08y16_817407_c1_96_845 248
321 3300050514 nmdc:mga08x19_285771_c1 nmdc:mga08x19_285771_c1_26_772 248
322 3300050514 nmdc:mga08x19_384_c1 nmdc:mga08x19_384_c1_30275_31021 248
323 3300050515 nmdc:mga0a205_362495_c1 nmdc:mga0a205_362495_c1_274_1020 248
324 3300060353 Ga0501082_0095547 Ga0501082_0095547_1122_1892 248
325 3300005467 Ga0070706_100056056 Ga0070706_1000560562 249
326 3300005536 Ga0070697_100014045 Ga0070697_1000140456 249
327 3300006175 Ga0070712_100138142 Ga0070712_1001381423 249
328 3300006914 Ga0075436_100003368 Ga0075436_10000336810 249
329 3300009147 Ga0114129_10107625 Ga0114129_101076253 249
330 3300013306 Ga0163162_10619351 Ga0163162_106193512 249
331 3300021388 Ga0213875_10028127 Ga0213875_100281273 249
332 3300025910 Ga0207684_10262314 Ga0207684_102623142 249
333 3300025915 Ga0207693_10190446 Ga0207693_101904462 249
334 3300028563 Ga0265319_1000004 Ga0265319_100000414 249
335 3300031595 Ga0265313_10009188 Ga0265313_100091883 249
336 3300035088 Ga0373940_0051516 Ga0373940_0051516_243_995 249
337 3300035695 Ga0373927_0001201 Ga0373927_0001201_10329_11132 249
338 3300037853 Ga0436364_0501893 Ga0436364_0501893_840_1595 249
339 3300042435 Ga0439434_0053311 Ga0439434_0053311_264_1016 249
340 3300046472 Ga0495580_0079826 Ga0495580_0079826_86_889 249
341 3300049580 Ga0501046_0347306 Ga0501046_0347306_86_835 249
342 3300050510 nmdc:mga06r32_167161_c1 nmdc:mga06r32_167161_c1_386_1135 249
343 3300050514 nmdc:mga08x19_1980_c1 nmdc:mga08x19_1980_c1_5046_5849 249
344 3300005471 Ga0070698_100315943 Ga0070698_1003159432 250
345 3300005518 Ga0070699_100237226 Ga0070699_1002372263 250
346 3300005546 Ga0070696_100003441 Ga0070696_1000034414 250
347 3300006175 Ga0070712_100320561 Ga0070712_1003205612 250
348 3300006846 Ga0075430_100123577 Ga0075430_1001235772 250
349 3300013297 Ga0157378_10241680 Ga0157378_102416802 250
350 3300013297 Ga0157378_10922664 Ga0157378_109226641 250
351 3300017792 Ga0163161_10167405 Ga0163161_101674052 250
352 3300025913 Ga0207695_10102843 Ga0207695_101028432 250
353 3300025939 Ga0207665_10055518 Ga0207665_100555182 250
354 3300027907 Ga0207428_10181076 Ga0207428_101810762 250
355 3300031911 Ga0307412_10063730 Ga0307412_100637302 250
356 3300032002 Ga0307416_100024505 Ga0307416_1000245052 250
357 3300035118 Ga0373954_0005888 Ga0373954_0005888_3930_4745 250
358 3300035119 Ga0373956_0001960 Ga0373956_0001960_3807_4622 250
359 3300035120 Ga0373957_0097194 Ga0373957_0097194_136_981 250
360 3300035172 Ga0373955_0060645 Ga0373955_0060645_323_1138 250
361 3300035695 Ga0373927_0164434 Ga0373927_0164434_443_1258 250
362 3300035724 Ga0373933_0009245 Ga0373933_0009245_3511_4326 250
363 3300036401 Ga0373937_0015906 Ga0373937_0015906_4371_5186 250
364 3300046454 Ga0495592_0152671 Ga0495592_0152671_108_872 250
365 3300046459 Ga0495629_0194325 Ga0495629_0194325_68_832 250
366 3300046472 Ga0495580_0108070 Ga0495580_0108070_1038_1883 250
367 3300046533 Ga0495640_0136344 Ga0495640_0136344_395_1159 250
368 3300046536 Ga0495587_0082549 Ga0495587_0082549_508_1272 250
369 3300046559 Ga0495667_0010652 Ga0495667_0010652_62_826 250
370 3300046678 Ga0495599_0012658 Ga0495599_0012658_3959_4723 250
371 3300046679 Ga0495623_0271947 Ga0495623_0271947_147_911 250
372 3300047317 Ga0495604_0039649 Ga0495604_0039649_513_1277 250
373 3300047322 Ga0495680_0009874 Ga0495680_0009874_6103_6867 250
374 3300047444 Ga0495675_0019969 Ga0495675_0019969_675_1439 250
375 3300049577 Ga0501041_0182574 Ga0501041_0182574_86_931 250
376 3300049578 Ga0501042_0026072 Ga0501042_0026072_640_1485 250
377 3300049582 Ga0501048_0047088 Ga0501048_0047088_1642_2487 250
378 3300049592 Ga0501076_0144807 Ga0501076_0144807_1064_1864 250
379 3300049741 Ga0501079_0282735 Ga0501079_0282735_429_1229 250
380 3300049743 Ga0501081_0124794 Ga0501081_0124794_782_1627 250
381 3300049824 Ga0501045_0035278 Ga0501045_0035278_210_1055 250
382 3300050510 nmdc:mga06r32_5842_c1 nmdc:mga06r32_5842_c1_5814_6572 250
383 3300050511 nmdc:mga08y16_178568_c1 nmdc:mga08y16_178568_c1_981_1733 250
384 3300005366 Ga0070659_100282113 Ga0070659_1002821131 251
385 3300005616 Ga0068852_100113591 Ga0068852_1001135913 251
386 3300009093 Ga0105240_10328423 Ga0105240_103284231 251
387 3300025913 Ga0207695_10652942 Ga0207695_106529421 251
388 3300025917 Ga0207660_10177324 Ga0207660_101773242 251
389 3300025921 Ga0207652_10812644 Ga0207652_108126441 251
390 3300025932 Ga0207690_10192323 Ga0207690_101923232 251
391 3300042156 Ga0439446_0044601 Ga0439446_0044601_403_1236 252
392 3300005355 Ga0070671_100373518 Ga0070671_1003735182 253
393 3300025931 Ga0207644_10020000 Ga0207644_100200002 253
394 3300005518 Ga0070699_100122772 Ga0070699_1001227722 254
395 3300032002 Ga0307416_100203742 Ga0307416_1002037421 254
396 3300010375 Ga0105239_10834002 Ga0105239_108340021 255
397 3300025922 Ga0207646_10148669 Ga0207646_101486692 255
398 3300031824 Ga0307413_10009128 Ga0307413_100091282 255
399 3300031852 Ga0307410_10003284 Ga0307410_100032845 255
400 3300031901 Ga0307406_10012889 Ga0307406_100128892 255
401 3300031995 Ga0307409_100226129 Ga0307409_1002261293 255
402 3300032002 Ga0307416_100034294 Ga0307416_1000342942 255
403 3300032004 Ga0307414_10092247 Ga0307414_100922473 255
404 3300032005 Ga0307411_10123284 Ga0307411_101232842 255
405 3300032126 Ga0307415_100066855 Ga0307415_1000668552 255
406 3300005444 Ga0070694_100166151 Ga0070694_1001661512 256
407 3300005471 Ga0070698_100111270 Ga0070698_1001112702 256
408 3300006847 Ga0075431_100003524 Ga0075431_1000035242 256
409 3300044684 Ga0466966_0056711 Ga0466966_0056711_1603_2466 256
410 3300050509 nmdc:mga0qj67_48814_c1 nmdc:mga0qj67_48814_c1_550_1413 256
411 3300037471 Ga0395905_0652979 Ga0395905_0652979_47_859 257
412 3300013105 Ga0157369_10443507 Ga0157369_104435072 258
413 3300006173 Ga0070716_100011673 Ga0070716_1000116735 259
414 3300006914 Ga0075436_100022284 Ga0075436_1000222843 259
415 3300025898 Ga0207692_10151740 Ga0207692_101517402 259
416 3300025906 Ga0207699_10015130 Ga0207699_100151302 259
417 3300025907 Ga0207645_10208441 Ga0207645_102084411 259
418 3300025939 Ga0207665_10000353 Ga0207665_100003537 259
419 3300027360 Ga0209969_1016459 Ga0209969_10164592 259
420 3300027526 Ga0209968_1001405 Ga0209968_10014054 259
421 3300027543 Ga0209999_1001616 Ga0209999_10016162 259
422 3300050514 nmdc:mga08x19_74283_c1 nmdc:mga08x19_74283_c1_797_1675 259
423 3300005458 Ga0070681_10000857 Ga0070681_1000085724 260
424 3300005530 Ga0070679_100007892 Ga0070679_1000078927 260
425 3300005549 Ga0070704_100235221 Ga0070704_1002352211 260
426 3300005563 Ga0068855_100253672 Ga0068855_1002536723 260
427 3300005614 Ga0068856_100269024 Ga0068856_1002690242 260
428 3300009093 Ga0105240_10014013 Ga0105240_100140133 260
429 3300013100 Ga0157373_10150025 Ga0157373_101500251 260
430 3300013104 Ga0157370_10006717 Ga0157370_100067175 260
431 3300013105 Ga0157369_10033617 Ga0157369_100336173 260
432 3300013307 Ga0157372_10011796 Ga0157372_100117964 260
433 3300025909 Ga0207705_10020682 Ga0207705_100206824 260
434 3300025912 Ga0207707_10000988 Ga0207707_100009887 260
435 3300025921 Ga0207652_10005896 Ga0207652_100058968 260
436 3300025932 Ga0207690_10013583 Ga0207690_100135832 260
437 3300026078 Ga0207702_10207962 Ga0207702_102079622 260
438 3300050514 nmdc:mga08x19_57610_c1 nmdc:mga08x19_57610_c1_64_882 260
439 3300005436 Ga0070713_100083974 Ga0070713_1000839742 261
440 3300005445 Ga0070708_100000150 Ga0070708_10000015044 261
441 3300005467 Ga0070706_100491534 Ga0070706_1004915342 261
442 3300005468 Ga0070707_100054158 Ga0070707_1000541584 261
443 3300005536 Ga0070697_100186023 Ga0070697_1001860231 261
444 3300005563 Ga0068855_100012943 Ga0068855_1000129438 261
445 3300009174 Ga0105241_10070001 Ga0105241_100700013 261
446 3300013100 Ga0157373_10025551 Ga0157373_100255512 261
447 3300013104 Ga0157370_10080409 Ga0157370_100804092 261
448 3300013105 Ga0157369_10056684 Ga0157369_100566845 261
449 3300025906 Ga0207699_10297747 Ga0207699_102977472 261
450 3300025910 Ga0207684_10326243 Ga0207684_103262431 261
451 3300025913 Ga0207695_10004228 Ga0207695_1000422812 261
452 3300025922 Ga0207646_10215295 Ga0207646_102152951 261
453 3300025944 Ga0207661_10232053 Ga0207661_102320532 261
454 3300026078 Ga0207702_10122128 Ga0207702_101221283 261
455 3300027526 Ga0209968_1009733 Ga0209968_10097332 261
456 3300027695 Ga0209966_1005202 Ga0209966_10052022 261
457 3300027717 Ga0209998_10002325 Ga0209998_100023254 261
458 3300031731 Ga0307405_10201092 Ga0307405_102010922 261
459 3300031824 Ga0307413_10199943 Ga0307413_101999432 261
460 3300031852 Ga0307410_10088625 Ga0307410_100886253 261
461 3300031852 Ga0307410_10156285 Ga0307410_101562852 261
462 3300031852 Ga0307410_10177177 Ga0307410_101771772 261
463 3300031852 Ga0307410_10240955 Ga0307410_102409552 261
464 3300031901 Ga0307406_10034267 Ga0307406_100342673 261
465 3300031901 Ga0307406_10099979 Ga0307406_100999792 261
466 3300031995 Ga0307409_100013872 Ga0307409_1000138724 261
467 3300031995 Ga0307409_100734613 Ga0307409_1007346131 261
468 3300032002 Ga0307416_100018075 Ga0307416_1000180752 261
469 3300032002 Ga0307416_100074539 Ga0307416_1000745393 261
470 3300032004 Ga0307414_10122832 Ga0307414_101228322 261
471 3300032004 Ga0307414_10396110 Ga0307414_103961102 261
472 3300032126 Ga0307415_100203956 Ga0307415_1002039562 261
473 3300035170 Ga0373943_0008709 Ga0373943_0008709_1576_2409 261
474 3300036401 Ga0373937_0002168 Ga0373937_0002168_9042_9875 261
475 3300046472 Ga0495580_0018051 Ga0495580_0018051_3083_3916 261
476 3300046475 Ga0495639_0029958 Ga0495639_0029958_317_1150 261
477 3300046499 Ga0495594_0008475 Ga0495594_0008475_2782_3615 261
478 3300046499 Ga0495594_0264769 Ga0495594_0264769_134_967 261
479 3300046535 Ga0495586_0017163 Ga0495586_0017163_874_1707 261
480 3300046536 Ga0495587_0000482 Ga0495587_0000482_23305_24138 261
481 3300046543 Ga0495645_0000281 Ga0495645_0000281_34937_35770 261
482 3300046679 Ga0495623_0062236 Ga0495623_0062236_719_1552 261
483 3300046809 Ga0495600_0014660 Ga0495600_0014660_3247_4080 261
484 3300049652 Ga0501202_002164 Ga0501202_002164_1803_2633 261
485 3300049660 Ga0501216_001839 Ga0501216_001839_1834_2664 261
486 3300049661 Ga0501217_008724 Ga0501217_008724_228_1058 261
487 3300049667 Ga0501230_014762 Ga0501230_014762_262_1092 261
488 3300049668 Ga0501233_015316 Ga0501233_015316_618_1448 261
489 3300049669 Ga0501235_001140 Ga0501235_001140_1202_2032 261
490 3300049679 Ga0501249_003903 Ga0501249_003903_1229_2059 261
491 3300049681 Ga0501251_011038 Ga0501251_011038_122_952 261
492 3300049682 Ga0501252_006973 Ga0501252_006973_220_1050 261
493 3300049688 Ga0501259_010116 Ga0501259_010116_120_950 261
494 3300049704 Ga0501221_004359 Ga0501221_004359_972_1802 261
495 3300049705 Ga0501225_0002931 Ga0501225_0002931_4300_5130 261
496 3300049707 Ga0501234_003567 Ga0501234_003567_856_1686 261
497 3300049765 Ga0501268_007645 Ga0501268_007645_120_950 261
498 3300049851 Ga0501212_006197 Ga0501212_006197_190_1020 261
499 3300003203 JGI25406J46586_10017229 JGI25406J46586_100172292 262
500 3300005295 Ga0065707_10105631 Ga0065707_101056312 262
501 3300005327 Ga0070658_10194464 Ga0070658_101944642 262
502 3300005329 Ga0070683_100382569 Ga0070683_1003825692 262
503 3300005336 Ga0070680_100125505 Ga0070680_1001255052 262
504 3300005336 Ga0070680_100136895 Ga0070680_1001368953 262
505 3300005337 Ga0070682_100000710 Ga0070682_10000071021 262
506 3300005337 Ga0070682_100002480 Ga0070682_1000024805 262
507 3300005337 Ga0070682_100081945 Ga0070682_1000819453 262
508 3300005338 Ga0068868_100020746 Ga0068868_1000207462 262
509 3300005339 Ga0070660_100292614 Ga0070660_1002926142 262
510 3300005343 Ga0070687_100004175 Ga0070687_1000041752 262
511 3300005345 Ga0070692_10022170 Ga0070692_100221703 262
512 3300005353 Ga0070669_100003973 Ga0070669_1000039733 262
513 3300005356 Ga0070674_100010992 Ga0070674_1000109923 262
514 3300005356 Ga0070674_100034310 Ga0070674_1000343102 262
515 3300005364 Ga0070673_100036426 Ga0070673_1000364262 262
516 3300005445 Ga0070708_100000271 Ga0070708_10000027128 262
517 3300005456 Ga0070678_100107527 Ga0070678_1001075272 262
518 3300005457 Ga0070662_100013849 Ga0070662_1000138496 262
519 3300005458 Ga0070681_10002590 Ga0070681_100025908 262
520 3300005458 Ga0070681_10018811 Ga0070681_100188118 262
521 3300005458 Ga0070681_10114175 Ga0070681_101141752 262
522 3300005458 Ga0070681_10153883 Ga0070681_101538833 262
523 3300005458 Ga0070681_10179506 Ga0070681_101795062 262
524 3300005459 Ga0068867_100044511 Ga0068867_1000445113 262
525 3300005459 Ga0068867_100088174 Ga0068867_1000881742 262
526 3300005459 Ga0068867_100099888 Ga0068867_1000998883 262
527 3300005468 Ga0070707_100001174 Ga0070707_10000117420 262
528 3300005518 Ga0070699_100078038 Ga0070699_1000780382 262
529 3300005530 Ga0070679_100015761 Ga0070679_1000157615 262
530 3300005530 Ga0070679_100035556 Ga0070679_1000355562 262
531 3300005535 Ga0070684_100003277 Ga0070684_10000327714 262
532 3300005535 Ga0070684_100031153 Ga0070684_1000311533 262
533 3300005536 Ga0070697_100063258 Ga0070697_1000632583 262
534 3300005539 Ga0068853_100040406 Ga0068853_1000404062 262
535 3300005545 Ga0070695_100004909 Ga0070695_1000049094 262
536 3300005545 Ga0070695_100118354 Ga0070695_1001183542 262
537 3300005546 Ga0070696_100023539 Ga0070696_1000235394 262
538 3300005547 Ga0070693_100040926 Ga0070693_1000409263 262
539 3300005547 Ga0070693_100076263 Ga0070693_1000762632 262
540 3300005547 Ga0070693_100096984 Ga0070693_1000969841 262
541 3300005563 Ga0068855_100000575 Ga0068855_10000057536 262
542 3300005563 Ga0068855_100507749 Ga0068855_1005077492 262
543 3300005578 Ga0068854_100066028 Ga0068854_1000660283 262
544 3300005614 Ga0068856_100103255 Ga0068856_1001032552 262
545 3300005718 Ga0068866_10010943 Ga0068866_100109432 262
546 3300005985 Ga0081539_10000091 Ga0081539_10000091148 262
547 3300006852 Ga0075433_10060876 Ga0075433_100608762 262
548 3300006871 Ga0075434_100007650 Ga0075434_1000076507 262
549 3300006914 Ga0075436_100039972 Ga0075436_1000399723 262
550 3300009093 Ga0105240_10244731 Ga0105240_102447312 262
551 3300009147 Ga0114129_10027932 Ga0114129_100279322 262
552 3300013100 Ga0157373_10117117 Ga0157373_101171173 262
553 3300013105 Ga0157369_10043043 Ga0157369_100430434 262
554 3300013105 Ga0157369_10554746 Ga0157369_105547462 262
555 3300013296 Ga0157374_10368430 Ga0157374_103684301 262
556 3300013297 Ga0157378_10007378 Ga0157378_1000737810 262
557 3300013297 Ga0157378_10024734 Ga0157378_100247342 262
558 3300013307 Ga0157372_10012338 Ga0157372_100123382 262
559 3300013307 Ga0157372_10378680 Ga0157372_103786802 262
560 3300025899 Ga0207642_10013605 Ga0207642_100136052 262
561 3300025909 Ga0207705_10018139 Ga0207705_100181393 262
562 3300025909 Ga0207705_10136625 Ga0207705_101366252 262
563 3300025912 Ga0207707_10001924 Ga0207707_100019245 262
564 3300025912 Ga0207707_10005051 Ga0207707_100050514 262
565 3300025912 Ga0207707_10121967 Ga0207707_101219672 262
566 3300025912 Ga0207707_10175904 Ga0207707_101759042 262
567 3300025917 Ga0207660_10032323 Ga0207660_100323232 262
568 3300025917 Ga0207660_10043414 Ga0207660_100434143 262
569 3300025917 Ga0207660_10106663 Ga0207660_101066632 262
570 3300025918 Ga0207662_10010864 Ga0207662_100108642 262
571 3300025920 Ga0207649_10090584 Ga0207649_100905842 262
572 3300025921 Ga0207652_10026167 Ga0207652_100261674 262
573 3300025921 Ga0207652_10248762 Ga0207652_102487622 262
574 3300025922 Ga0207646_10002046 Ga0207646_100020461 262
575 3300025932 Ga0207690_10198248 Ga0207690_101982482 262
576 3300025933 Ga0207706_10033383 Ga0207706_100333832 262
577 3300025937 Ga0207669_10010153 Ga0207669_100101533 262
578 3300025937 Ga0207669_10180170 Ga0207669_101801702 262
579 3300025944 Ga0207661_10000775 Ga0207661_1000077521 262
580 3300025949 Ga0207667_10027040 Ga0207667_100270404 262
581 3300025949 Ga0207667_10254877 Ga0207667_102548773 262
582 3300025981 Ga0207640_10137328 Ga0207640_101373283 262
583 3300026067 Ga0207678_10017222 Ga0207678_100172226 262
584 3300026067 Ga0207678_10347988 Ga0207678_103479882 262
585 3300026075 Ga0207708_10023395 Ga0207708_100233955 262
586 3300026089 Ga0207648_10007202 Ga0207648_100072023 262
587 3300026089 Ga0207648_10054948 Ga0207648_100549483 262
588 3300026121 Ga0207683_10016563 Ga0207683_100165633 262
589 3300034820 Ga0373959_0008725 Ga0373959_0008725_528_1403 262
590 3300035112 Ga0373932_0041022 Ga0373932_0041022_413_1288 262
591 3300035207 Ga0373942_0046770 Ga0373942_0046770_185_1060 262
592 3300037471 Ga0395905_0027078 Ga0395905_0027078_2970_3815 262
593 3300048915 Ga0496112_0025175 Ga0496112_0025175_3745_4620 262
594 3300048915 Ga0496112_0336874 Ga0496112_0336874_424_1290 262
595 3300050507 nmdc:mga05p37_96891_c1 nmdc:mga05p37_96891_c1_1497_2414 262
596 3300050515 nmdc:mga0a205_63829_c1 nmdc:mga0a205_63829_c1_1091_1966 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

46

149

0.9

PF13534

Fer4_17

4Fe-4S dicluster domain

184

257

0.86

PF13183

Fer4_8

4Fe-4S dicluster domain

181

256

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d6x-assembly1.cif.gz_B mycobacterium smegmatis sdh1 complex in the apo form 0.821 13 249
7d6x-assembly1.cif.gz_B mycobacterium smegmatis sdh1 complex in the apo form 0.8119 13 249
2wp9-assembly3.cif.gz_J crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant 0.789 14 245
2acz-assembly1.cif.gz_B complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.7876 14 245
2bs3-assembly1.cif.gz_B glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes 0.7838 12 242
ID Description Score Start End Superfamily
af_O53669_2_103_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9122 15 114 3.10.20.30
af_O53669_2_103_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8866 15 114 3.10.20.30
4kx6N01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8569 12 114 3.10.20.30
5xmjN01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8506 12 114 3.10.20.30
2wdqB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8466 14 114 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A2V6KMR1-F1-model_v4 Succinate dehydrogenase/fumarate reductase iron-sulfur subunit 0.9266 14 116 GO:0005886
GO:0009055
GO:0009060
GO:0022904
GO:0051537
AF-A0A7K1CVH8-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9138 15 110 GO:0005886
GO:0009055
GO:0009060
GO:0022904
GO:0051537
AF-A0A2V9PP48-F1-model_v4 Succinate dehydrogenase/fumarate reductase iron-sulfur subunit 0.9106 14 102 GO:0005886
GO:0009055
GO:0009060
GO:0022904
GO:0051537
AF-A0A2V6KMR1-F1-model_v4 Succinate dehydrogenase/fumarate reductase iron-sulfur subunit 0.9094 14 116 GO:0005886
GO:0009055
GO:0009060
GO:0022904
GO:0051537
AF-A0A7V9V5B9-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.8999 14 126 GO:0005886
GO:0009055
GO:0009060
GO:0022904
GO:0051537

Feature Viewer

pLDDT pTM Quality
76.98 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map