F467519
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 596 | 300 | 596 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100000271|Ga0070708_10000027128 |
| Length | 299 |
| Sequence | MDAGPSVREKKVSSVTEVLARNIVESGRRAAARSDTSAGTEKRSATFRVWRGAGPTGELRDYSTNVSEGMVVLDAIHQIQAETAGDLAVRWNCKAGKCGSCSAEINGMPRLMCMTRLSELDLKQPVTVEPMRAFPPVKDLVTDVSSNFRAKKRIRRFTPRPPDAPDGTWRMAQADADRVQEFRKCVECFLCQDVCHVLRDHHLHEQFIGPRLLVHAAQLEMHPLDILDRTDDLKESHGIGYCNITKCCTRVCPENIIITDNAIIPLKERVVDKHYDPLRKLVRLVRGRKSADRHQGGAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 102 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 179 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 197 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 198 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 199 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 200 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 201 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 202 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 203 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 204 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 205 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 206 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 207 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 208 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 209 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 210 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 264 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 265 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 266 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 268 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 269 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 271 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 272 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 273 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 274 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 275 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 281 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 285 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 294 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 295 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 296 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 297 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 298 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 299 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0.17 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.34 |
| Nodule | 0 |
| Rhizoplane | 3.36 |
| Rhizosphere | 94.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10017229 | 3300003203 | Bacteria | 2991 |
| 2 | Ga0065707_10105631 | 3300005295 | Bacteria | 2636 |
| 3 | Ga0070658_10194464 | 3300005327 | Bacteria | 1710 |
| 4 | Ga0070683_100137155 | 3300005329 | Bacteria | 2317 |
| 5 | Ga0070683_100382569 | 3300005329 | Bacteria | 1341 |
| 6 | Ga0070690_100041436 | 3300005330 | Bacteria | 2915 |
| 7 | Ga0070670_100010608 | 3300005331 | Bacteria | 7868 |
| 8 | Ga0070670_100191353 | 3300005331 | Bacteria | 1777 |
| 9 | Ga0070666_10065940 | 3300005335 | Bacteria | 2457 |
| 10 | Ga0070680_100025541 | 3300005336 | Bacteria | 4722 |
| 11 | Ga0070680_100125505 | 3300005336 | Bacteria | 2145 |
| 12 | Ga0070680_100136895 | 3300005336 | Bacteria | 2052 |
| 13 | Ga0070680_100229225 | 3300005336 | Bacteria | 1569 |
| 14 | Ga0070682_100000710 | 3300005337 | Bacteria | 19958 |
| 15 | Ga0070682_100002480 | 3300005337 | Bacteria | 10190 |
| 16 | Ga0070682_100081945 | 3300005337 | Bacteria | 2090 |
| 17 | Ga0068868_100020746 | 3300005338 | Bacteria | 4943 |
| 18 | Ga0068868_100088743 | 3300005338 | Bacteria | 2489 |
| 19 | Ga0070660_100292614 | 3300005339 | Bacteria | 1334 |
| 20 | Ga0070689_100347784 | 3300005340 | Bacteria | 1243 |
| 21 | Ga0070687_100004175 | 3300005343 | Bacteria | 5723 |
| 22 | Ga0070661_100001310 | 3300005344 | Bacteria | 17458 |
| 23 | Ga0070692_10022170 | 3300005345 | Bacteria | 3100 |
| 24 | Ga0070668_100035893 | 3300005347 | Bacteria | 3783 |
| 25 | Ga0070668_100325558 | 3300005347 | Bacteria | 1295 |
| 26 | Ga0070669_100003973 | 3300005353 | Bacteria | 10700 |
| 27 | Ga0070675_100072690 | 3300005354 | Bacteria | 2855 |
| 28 | Ga0070675_100317604 | 3300005354 | Bacteria | 1376 |
| 29 | Ga0070671_100058419 | 3300005355 | Bacteria | 3211 |
| 30 | Ga0070671_100373518 | 3300005355 | Bacteria | 1218 |
| 31 | Ga0070674_100010992 | 3300005356 | Bacteria | 5491 |
| 32 | Ga0070674_100034310 | 3300005356 | Bacteria | 3388 |
| 33 | Ga0070674_100781873 | 3300005356 | Bacteria | 823 |
| 34 | Ga0070673_100029311 | 3300005364 | Bacteria | 4103 |
| 35 | Ga0070673_100036426 | 3300005364 | Bacteria | 3740 |
| 36 | Ga0070659_100282113 | 3300005366 | Bacteria | 1382 |
| 37 | Ga0070709_10314855 | 3300005434 | Bacteria | 1147 |
| 38 | Ga0070713_100035908 | 3300005436 | Bacteria | 3995 |
| 39 | Ga0070713_100083974 | 3300005436 | Bacteria | 2724 |
| 40 | Ga0070705_100005309 | 3300005440 | Bacteria | 6270 |
| 41 | Ga0070705_100191399 | 3300005440 | Bacteria | 1395 |
| 42 | Ga0070705_100373802 | 3300005440 | Bacteria | 1047 |
| 43 | Ga0070694_100166151 | 3300005444 | Bacteria | 1623 |
| 44 | Ga0070708_100000150 | 3300005445 | Bacteria | 48256 |
| 45 | Ga0070708_100000271 | 3300005445 | Bacteria | 38546 |
| 46 | Ga0070708_100002538 | 3300005445 | Bacteria | 14094 |
| 47 | Ga0070678_100007796 | 3300005456 | Bacteria | 6370 |
| 48 | Ga0070678_100107527 | 3300005456 | Bacteria | 2176 |
| 49 | Ga0070678_100245178 | 3300005456 | Bacteria | 1500 |
| 50 | Ga0070662_100013849 | 3300005457 | Bacteria | 5373 |
| 51 | Ga0070681_10000857 | 3300005458 | Bacteria | 25575 |
| 52 | Ga0070681_10002590 | 3300005458 | Bacteria | 16583 |
| 53 | Ga0070681_10018811 | 3300005458 | Bacteria | 6912 |
| 54 | Ga0070681_10024902 | 3300005458 | Bacteria | 6021 |
| 55 | Ga0070681_10114175 | 3300005458 | Bacteria | 2640 |
| 56 | Ga0070681_10153883 | 3300005458 | Bacteria | 2225 |
| 57 | Ga0070681_10179506 | 3300005458 | Bacteria | 2039 |
| 58 | Ga0070681_10556348 | 3300005458 | Bacteria | 1061 |
| 59 | Ga0068867_100044511 | 3300005459 | Bacteria | 3252 |
| 60 | Ga0068867_100076893 | 3300005459 | Bacteria | 2507 |
| 61 | Ga0068867_100088174 | 3300005459 | Bacteria | 2351 |
| 62 | Ga0068867_100099888 | 3300005459 | Bacteria | 2215 |
| 63 | Ga0070685_10002842 | 3300005466 | Bacteria | 8844 |
| 64 | Ga0070706_100056056 | 3300005467 | Bacteria | 3637 |
| 65 | Ga0070706_100242830 | 3300005467 | Bacteria | 1682 |
| 66 | Ga0070706_100433055 | 3300005467 | Bacteria | 1224 |
| 67 | Ga0070706_100491534 | 3300005467 | Bacteria | 1142 |
| 68 | Ga0070706_100510812 | 3300005467 | Bacteria | 1118 |
| 69 | Ga0070707_100001174 | 3300005468 | Bacteria | 25766 |
| 70 | Ga0070707_100054158 | 3300005468 | Bacteria | 3846 |
| 71 | Ga0070698_100006078 | 3300005471 | Bacteria | 13151 |
| 72 | Ga0070698_100111270 | 3300005471 | Bacteria | 2704 |
| 73 | Ga0070698_100315943 | 3300005471 | Unclassified | 1493 |
| 74 | Ga0070699_100000005 | 3300005518 | Bacteria | 384287 |
| 75 | Ga0070699_100003942 | 3300005518 | Bacteria | 13111 |
| 76 | Ga0070699_100029764 | 3300005518 | Bacteria | 4709 |
| 77 | Ga0070699_100078038 | 3300005518 | Bacteria | 2884 |
| 78 | Ga0070699_100100447 | 3300005518 | Bacteria | 2536 |
| 79 | Ga0070699_100122772 | 3300005518 | Bacteria | 2285 |
| 80 | Ga0070699_100237226 | 3300005518 | Bacteria | 1627 |
| 81 | Ga0070699_100287808 | 3300005518 | Bacteria | 1473 |
| 82 | Ga0070679_100007892 | 3300005530 | Bacteria | 9985 |
| 83 | Ga0070679_100015761 | 3300005530 | Bacteria | 7271 |
| 84 | Ga0070679_100017895 | 3300005530 | Bacteria | 6864 |
| 85 | Ga0070679_100035556 | 3300005530 | Bacteria | 4943 |
| 86 | Ga0070679_100103902 | 3300005530 | Bacteria | 2827 |
| 87 | Ga0070679_100104393 | 3300005530 | Bacteria | 2820 |
| 88 | Ga0070679_100147606 | 3300005530 | Bacteria | 2329 |
| 89 | Ga0070684_100003277 | 3300005535 | Bacteria | 12122 |
| 90 | Ga0070684_100031153 | 3300005535 | Bacteria | 4538 |
| 91 | Ga0070684_100273905 | 3300005535 | Bacteria | 1545 |
| 92 | Ga0070697_100014045 | 3300005536 | Bacteria | 6290 |
| 93 | Ga0070697_100060051 | 3300005536 | Bacteria | 3098 |
| 94 | Ga0070697_100063258 | 3300005536 | Bacteria | 3021 |
| 95 | Ga0070697_100186023 | 3300005536 | Bacteria | 1761 |
| 96 | Ga0068853_100040406 | 3300005539 | Bacteria | 3980 |
| 97 | Ga0070695_100004909 | 3300005545 | Bacteria | 7886 |
| 98 | Ga0070695_100118354 | 3300005545 | Bacteria | 1809 |
| 99 | Ga0070696_100003441 | 3300005546 | Bacteria | 10542 |
| 100 | Ga0070696_100023539 | 3300005546 | Bacteria | 4187 |
| 101 | Ga0070693_100040926 | 3300005547 | Bacteria | 2604 |
| 102 | Ga0070693_100076263 | 3300005547 | Bacteria | 1987 |
| 103 | Ga0070693_100096984 | 3300005547 | Bacteria | 1788 |
| 104 | Ga0070665_100000235 | 3300005548 | Bacteria | 91903 |
| 105 | Ga0070665_100468714 | 3300005548 | Bacteria | 1270 |
| 106 | Ga0070665_100681705 | 3300005548 | Bacteria | 1041 |
| 107 | Ga0070704_100235221 | 3300005549 | Bacteria | 1497 |
| 108 | Ga0068855_100000575 | 3300005563 | Bacteria | 45015 |
| 109 | Ga0068855_100012943 | 3300005563 | Bacteria | 10064 |
| 110 | Ga0068855_100253672 | 3300005563 | Bacteria | 1962 |
| 111 | Ga0068855_100507749 | 3300005563 | Bacteria | 1309 |
| 112 | Ga0070664_100031389 | 3300005564 | Bacteria | 4438 |
| 113 | Ga0068854_100066028 | 3300005578 | Bacteria | 2632 |
| 114 | Ga0068856_100103255 | 3300005614 | Bacteria | 2844 |
| 115 | Ga0068856_100269024 | 3300005614 | Bacteria | 1720 |
| 116 | Ga0070702_100081001 | 3300005615 | Bacteria | 1944 |
| 117 | Ga0068852_100113591 | 3300005616 | Bacteria | 2467 |
| 118 | Ga0068859_100012017 | 3300005617 | Bacteria | 8698 |
| 119 | Ga0068859_100047750 | 3300005617 | Bacteria | 4301 |
| 120 | Ga0068859_100925459 | 3300005617 | Bacteria | 956 |
| 121 | Ga0068864_100007082 | 3300005618 | Bacteria | 9207 |
| 122 | Ga0068864_100148696 | 3300005618 | Bacteria | 2120 |
| 123 | Ga0068864_100241638 | 3300005618 | Bacteria | 1673 |
| 124 | Ga0068866_10010943 | 3300005718 | Bacteria | 3907 |
| 125 | Ga0068861_100246884 | 3300005719 | Bacteria | 1521 |
| 126 | Ga0068863_100025379 | 3300005841 | Bacteria | 5651 |
| 127 | Ga0068863_100057293 | 3300005841 | Bacteria | 3688 |
| 128 | Ga0068858_100247436 | 3300005842 | Bacteria | 1693 |
| 129 | Ga0068860_100023785 | 3300005843 | Bacteria | 5922 |
| 130 | Ga0068860_100024771 | 3300005843 | Bacteria | 5796 |
| 131 | Ga0068862_100050605 | 3300005844 | Bacteria | 3551 |
| 132 | Ga0081539_10000091 | 3300005985 | Bacteria | 211445 |
| 133 | Ga0070717_10062619 | 3300006028 | Bacteria | 3085 |
| 134 | Ga0070716_100011673 | 3300006173 | Bacteria | 4427 |
| 135 | Ga0070712_100138142 | 3300006175 | Bacteria | 1856 |
| 136 | Ga0070712_100320561 | 3300006175 | Bacteria | 1260 |
| 137 | Ga0097621_100027482 | 3300006237 | Bacteria | 4475 |
| 138 | Ga0068871_100053092 | 3300006358 | Bacteria | 3284 |
| 139 | Ga0068871_100063521 | 3300006358 | Bacteria | 3020 |
| 140 | Ga0068871_100609138 | 3300006358 | Bacteria | 994 |
| 141 | Ga0075428_100001555 | 3300006844 | Bacteria | 24580 |
| 142 | Ga0075428_100051720 | 3300006844 | Bacteria | 4505 |
| 143 | Ga0075430_100123577 | 3300006846 | Bacteria | 2157 |
| 144 | Ga0075431_100001632 | 3300006847 | Bacteria | 20964 |
| 145 | Ga0075431_100003524 | 3300006847 | Bacteria | 15165 |
| 146 | Ga0075431_100491609 | 3300006847 | Bacteria | 1219 |
| 147 | Ga0075431_100687100 | 3300006847 | Bacteria | 1002 |
| 148 | Ga0075433_10060876 | 3300006852 | Bacteria | 3307 |
| 149 | Ga0075433_10069658 | 3300006852 | Bacteria | 3090 |
| 150 | Ga0075434_100007650 | 3300006871 | Bacteria | 9994 |
| 151 | Ga0075429_100089045 | 3300006880 | Bacteria | 2690 |
| 152 | Ga0075429_100110910 | 3300006880 | Bacteria | 2398 |
| 153 | Ga0068865_100114059 | 3300006881 | Bacteria | 1998 |
| 154 | Ga0068865_100274402 | 3300006881 | Bacteria | 1340 |
| 155 | Ga0075436_100003368 | 3300006914 | Bacteria | 10942 |
| 156 | Ga0075436_100022284 | 3300006914 | Bacteria | 4350 |
| 157 | Ga0075436_100037247 | 3300006914 | Bacteria | 3358 |
| 158 | Ga0075436_100038046 | 3300006914 | Bacteria | 3321 |
| 159 | Ga0075436_100039972 | 3300006914 | Bacteria | 3236 |
| 160 | Ga0075436_100062553 | 3300006914 | Bacteria | 2572 |
| 161 | Ga0097620_100012017 | 3300006931 | Bacteria | 8698 |
| 162 | Ga0097620_100047752 | 3300006931 | Bacteria | 4301 |
| 163 | Ga0097620_100925314 | 3300006931 | Bacteria | 956 |
| 164 | Ga0099794_10004013 | 3300007265 | Bacteria | 5719 |
| 165 | Ga0099794_10043250 | 3300007265 | Bacteria | 2150 |
| 166 | Ga0105240_10008739 | 3300009093 | Bacteria | 14440 |
| 167 | Ga0105240_10014013 | 3300009093 | Bacteria | 10967 |
| 168 | Ga0105240_10244731 | 3300009093 | Bacteria | 2077 |
| 169 | Ga0105240_10328423 | 3300009093 | Bacteria | 1741 |
| 170 | Ga0111539_10006462 | 3300009094 | Bacteria | 15101 |
| 171 | Ga0111539_10075466 | 3300009094 | Bacteria | 3971 |
| 172 | Ga0111539_10169662 | 3300009094 | Bacteria | 2549 |
| 173 | Ga0111539_10173720 | 3300009094 | Bacteria | 2517 |
| 174 | Ga0111539_10289002 | 3300009094 | Bacteria | 1908 |
| 175 | Ga0111539_10692852 | 3300009094 | Bacteria | 1186 |
| 176 | Ga0105245_10093148 | 3300009098 | Bacteria | 2776 |
| 177 | Ga0114129_10002846 | 3300009147 | Bacteria | 24191 |
| 178 | Ga0114129_10027932 | 3300009147 | Bacteria | 7990 |
| 179 | Ga0114129_10107625 | 3300009147 | Bacteria | 3850 |
| 180 | Ga0114129_10134232 | 3300009147 | Bacteria | 3397 |
| 181 | Ga0114129_10266290 | 3300009147 | Bacteria | 2294 |
| 182 | Ga0105243_10533500 | 3300009148 | Bacteria | 1118 |
| 183 | Ga0105241_10070001 | 3300009174 | Bacteria | 2721 |
| 184 | Ga0105241_10202623 | 3300009174 | Bacteria | 1658 |
| 185 | Ga0105242_10337491 | 3300009176 | Bacteria | 1388 |
| 186 | Ga0105248_10733977 | 3300009177 | Bacteria | 1114 |
| 187 | Ga0105249_10013892 | 3300009553 | Bacteria | 7118 |
| 188 | Ga0105249_10655131 | 3300009553 | Bacteria | 1108 |
| 189 | Ga0105239_10834002 | 3300010375 | Bacteria | 1057 |
| 190 | Ga0105246_10109761 | 3300011119 | Bacteria | 2024 |
| 191 | Ga0157373_10025551 | 3300013100 | Bacteria | 4270 |
| 192 | Ga0157373_10117117 | 3300013100 | Bacteria | 1872 |
| 193 | Ga0157373_10150025 | 3300013100 | Bacteria | 1640 |
| 194 | Ga0157370_10006717 | 3300013104 | Bacteria | 12625 |
| 195 | Ga0157370_10080409 | 3300013104 | Bacteria | 3068 |
| 196 | Ga0157369_10033617 | 3300013105 | Bacteria | 5634 |
| 197 | Ga0157369_10043043 | 3300013105 | Bacteria | 4923 |
| 198 | Ga0157369_10056684 | 3300013105 | Bacteria | 4228 |
| 199 | Ga0157369_10443507 | 3300013105 | Bacteria | 1344 |
| 200 | Ga0157369_10554746 | 3300013105 | Bacteria | 1187 |
| 201 | Ga0157374_10111858 | 3300013296 | Bacteria | 2627 |
| 202 | Ga0157374_10368430 | 3300013296 | Bacteria | 1429 |
| 203 | Ga0157378_10007378 | 3300013297 | Bacteria | 9606 |
| 204 | Ga0157378_10024734 | 3300013297 | Bacteria | 5287 |
| 205 | Ga0157378_10173681 | 3300013297 | Bacteria | 2023 |
| 206 | Ga0157378_10241680 | 3300013297 | Bacteria | 1725 |
| 207 | Ga0157378_10922664 | 3300013297 | Bacteria | 905 |
| 208 | Ga0163162_10274092 | 3300013306 | Bacteria | 1819 |
| 209 | Ga0163162_10619351 | 3300013306 | Bacteria | 1208 |
| 210 | Ga0157372_10011796 | 3300013307 | Bacteria | 9308 |
| 211 | Ga0157372_10012338 | 3300013307 | Bacteria | 9106 |
| 212 | Ga0157372_10198457 | 3300013307 | Bacteria | 2324 |
| 213 | Ga0157372_10378680 | 3300013307 | Bacteria | 1649 |
| 214 | Ga0157375_10027751 | 3300013308 | Bacteria | 5296 |
| 215 | Ga0157375_10051227 | 3300013308 | Bacteria | 4053 |
| 216 | Ga0157375_10410420 | 3300013308 | Bacteria | 1520 |
| 217 | Ga0157375_11177121 | 3300013308 | Bacteria | 899 |
| 218 | Ga0163163_10088641 | 3300014325 | Bacteria | 3105 |
| 219 | Ga0157380_10141601 | 3300014326 | Bacteria | 2067 |
| 220 | Ga0157376_10045238 | 3300014969 | Bacteria | 3623 |
| 221 | Ga0157376_10187671 | 3300014969 | Bacteria | 1894 |
| 222 | Ga0163161_10002047 | 3300017792 | Bacteria | 14607 |
| 223 | Ga0163161_10014823 | 3300017792 | Bacteria | 5431 |
| 224 | Ga0163161_10167405 | 3300017792 | Bacteria | 1679 |
| 225 | Ga0213872_10013176 | 3300021361 | Bacteria | 3877 |
| 226 | Ga0213872_10021808 | 3300021361 | Unclassified | 2950 |
| 227 | Ga0213872_10042231 | 3300021361 | Bacteria | 2080 |
| 228 | Ga0213876_10001571 | 3300021384 | Bacteria | 14045 |
| 229 | Ga0213875_10028127 | 3300021388 | Bacteria | 2673 |
| 230 | Ga0213871_10072475 | 3300021441 | Bacteria | 975 |
| 231 | Ga0207692_10151740 | 3300025898 | Bacteria | 1327 |
| 232 | Ga0207642_10013605 | 3300025899 | Bacteria | 2974 |
| 233 | Ga0207680_10024793 | 3300025903 | Bacteria | 3297 |
| 234 | Ga0207699_10015130 | 3300025906 | Bacteria | 4002 |
| 235 | Ga0207699_10297747 | 3300025906 | Bacteria | 1126 |
| 236 | Ga0207645_10208441 | 3300025907 | Bacteria | 1287 |
| 237 | Ga0207645_10277388 | 3300025907 | Bacteria | 1113 |
| 238 | Ga0207705_10018139 | 3300025909 | Bacteria | 5031 |
| 239 | Ga0207705_10020682 | 3300025909 | Bacteria | 4700 |
| 240 | Ga0207705_10136625 | 3300025909 | Bacteria | 1828 |
| 241 | Ga0207684_10134990 | 3300025910 | Bacteria | 2118 |
| 242 | Ga0207684_10164411 | 3300025910 | Bacteria | 1912 |
| 243 | Ga0207684_10262314 | 3300025910 | Bacteria | 1491 |
| 244 | Ga0207684_10326243 | 3300025910 | Bacteria | 1323 |
| 245 | Ga0207684_10375075 | 3300025910 | Bacteria | 1224 |
| 246 | Ga0207707_10000988 | 3300025912 | Bacteria | 27336 |
| 247 | Ga0207707_10001924 | 3300025912 | Bacteria | 18876 |
| 248 | Ga0207707_10005051 | 3300025912 | Bacteria | 11577 |
| 249 | Ga0207707_10010257 | 3300025912 | Bacteria | 8130 |
| 250 | Ga0207707_10019747 | 3300025912 | Bacteria | 5883 |
| 251 | Ga0207707_10121967 | 3300025912 | Bacteria | 2279 |
| 252 | Ga0207707_10175904 | 3300025912 | Bacteria | 1870 |
| 253 | Ga0207707_10187450 | 3300025912 | Bacteria | 1805 |
| 254 | Ga0207695_10004228 | 3300025913 | Bacteria | 19737 |
| 255 | Ga0207695_10027148 | 3300025913 | Bacteria | 6377 |
| 256 | Ga0207695_10102843 | 3300025913 | Bacteria | 2849 |
| 257 | Ga0207695_10652942 | 3300025913 | Bacteria | 933 |
| 258 | Ga0207671_10041096 | 3300025914 | Bacteria | 3422 |
| 259 | Ga0207693_10190446 | 3300025915 | Bacteria | 1614 |
| 260 | Ga0207660_10032323 | 3300025917 | Bacteria | 3611 |
| 261 | Ga0207660_10043414 | 3300025917 | Bacteria | 3160 |
| 262 | Ga0207660_10106663 | 3300025917 | Bacteria | 2101 |
| 263 | Ga0207660_10177324 | 3300025917 | Bacteria | 1653 |
| 264 | Ga0207660_10229879 | 3300025917 | Bacteria | 1458 |
| 265 | Ga0207662_10010864 | 3300025918 | Bacteria | 5033 |
| 266 | Ga0207657_10160618 | 3300025919 | Bacteria | 1825 |
| 267 | Ga0207649_10031648 | 3300025920 | Bacteria | 3146 |
| 268 | Ga0207649_10090584 | 3300025920 | Bacteria | 2001 |
| 269 | Ga0207652_10005896 | 3300025921 | Bacteria | 9915 |
| 270 | Ga0207652_10026167 | 3300025921 | Bacteria | 4856 |
| 271 | Ga0207652_10102889 | 3300025921 | Bacteria | 2524 |
| 272 | Ga0207652_10134250 | 3300025921 | Bacteria | 2209 |
| 273 | Ga0207652_10173015 | 3300025921 | Bacteria | 1938 |
| 274 | Ga0207652_10248762 | 3300025921 | Bacteria | 1603 |
| 275 | Ga0207652_10812644 | 3300025921 | Bacteria | 830 |
| 276 | Ga0207646_10002046 | 3300025922 | Bacteria | 24232 |
| 277 | Ga0207646_10148669 | 3300025922 | Bacteria | 2112 |
| 278 | Ga0207646_10215295 | 3300025922 | Bacteria | 1735 |
| 279 | Ga0207681_10295189 | 3300025923 | Bacteria | 1281 |
| 280 | Ga0207650_10012022 | 3300025925 | Bacteria | 5967 |
| 281 | Ga0207700_10054036 | 3300025928 | Bacteria | 3013 |
| 282 | Ga0207644_10020000 | 3300025931 | Bacteria | 4548 |
| 283 | Ga0207644_10078344 | 3300025931 | Bacteria | 2436 |
| 284 | Ga0207644_10328887 | 3300025931 | Bacteria | 1237 |
| 285 | Ga0207690_10013583 | 3300025932 | Bacteria | 4895 |
| 286 | Ga0207690_10192323 | 3300025932 | Bacteria | 1544 |
| 287 | Ga0207690_10198248 | 3300025932 | Bacteria | 1523 |
| 288 | Ga0207706_10033383 | 3300025933 | Bacteria | 4582 |
| 289 | Ga0207686_10113600 | 3300025934 | Bacteria | 1831 |
| 290 | Ga0207709_10167988 | 3300025935 | Bacteria | 1537 |
| 291 | Ga0207670_10575579 | 3300025936 | Bacteria | 922 |
| 292 | Ga0207669_10010153 | 3300025937 | Bacteria | 4522 |
| 293 | Ga0207669_10180170 | 3300025937 | Bacteria | 1514 |
| 294 | Ga0207704_10383507 | 3300025938 | Bacteria | 1104 |
| 295 | Ga0207704_10567351 | 3300025938 | Bacteria | 925 |
| 296 | Ga0207665_10000353 | 3300025939 | Bacteria | 31856 |
| 297 | Ga0207665_10055518 | 3300025939 | Bacteria | 2672 |
| 298 | Ga0207691_10097612 | 3300025940 | Bacteria | 2626 |
| 299 | Ga0207691_10108308 | 3300025940 | Bacteria | 2473 |
| 300 | Ga0207661_10000775 | 3300025944 | Bacteria | 20758 |
| 301 | Ga0207661_10168838 | 3300025944 | Bacteria | 1903 |
| 302 | Ga0207661_10205556 | 3300025944 | Bacteria | 1733 |
| 303 | Ga0207661_10232053 | 3300025944 | Bacteria | 1634 |
| 304 | Ga0207667_10027040 | 3300025949 | Bacteria | 6255 |
| 305 | Ga0207667_10254877 | 3300025949 | Bacteria | 1795 |
| 306 | Ga0207651_10172249 | 3300025960 | Bacteria | 1708 |
| 307 | Ga0207712_10022359 | 3300025961 | Bacteria | 4162 |
| 308 | Ga0207712_10105962 | 3300025961 | Bacteria | 2099 |
| 309 | Ga0207668_10016839 | 3300025972 | Bacteria | 4571 |
| 310 | Ga0207640_10137328 | 3300025981 | Bacteria | 1777 |
| 311 | Ga0207658_10442895 | 3300025986 | Bacteria | 1149 |
| 312 | Ga0207677_10196345 | 3300026023 | Bacteria | 1600 |
| 313 | Ga0207703_10147675 | 3300026035 | Bacteria | 2047 |
| 314 | Ga0207703_10498966 | 3300026035 | Bacteria | 1142 |
| 315 | Ga0207678_10017222 | 3300026067 | Bacteria | 6344 |
| 316 | Ga0207678_10347988 | 3300026067 | Bacteria | 1278 |
| 317 | Ga0207708_10023395 | 3300026075 | Bacteria | 4669 |
| 318 | Ga0207702_10122128 | 3300026078 | Bacteria | 2333 |
| 319 | Ga0207702_10207962 | 3300026078 | Bacteria | 1818 |
| 320 | Ga0207648_10007202 | 3300026089 | Bacteria | 10969 |
| 321 | Ga0207648_10054948 | 3300026089 | Bacteria | 3476 |
| 322 | Ga0207648_10085312 | 3300026089 | Bacteria | 2755 |
| 323 | Ga0207676_10115574 | 3300026095 | Bacteria | 2253 |
| 324 | Ga0207676_10129457 | 3300026095 | Bacteria | 2143 |
| 325 | Ga0207676_10174355 | 3300026095 | Bacteria | 1877 |
| 326 | Ga0207675_100172658 | 3300026118 | Bacteria | 2067 |
| 327 | Ga0207683_10009043 | 3300026121 | Bacteria | 8488 |
| 328 | Ga0207683_10016563 | 3300026121 | Bacteria | 6276 |
| 329 | Ga0207683_10081509 | 3300026121 | Archaea | 2872 |
| 330 | Ga0207683_10318879 | 3300026121 | Bacteria | 1423 |
| 331 | Ga0207698_10526839 | 3300026142 | Bacteria | 1154 |
| 332 | Ga0209969_1016459 | 3300027360 | Bacteria | 1085 |
| 333 | Ga0209968_1001405 | 3300027526 | Bacteria | 3649 |
| 334 | Ga0209968_1009733 | 3300027526 | Bacteria | 1473 |
| 335 | Ga0209999_1001616 | 3300027543 | Bacteria | 3883 |
| 336 | Ga0209588_1011956 | 3300027671 | Bacteria | 2629 |
| 337 | Ga0209588_1135890 | 3300027671 | Bacteria | 783 |
| 338 | Ga0209966_1005202 | 3300027695 | Bacteria | 2228 |
| 339 | Ga0209998_10002325 | 3300027717 | Bacteria | 4391 |
| 340 | Ga0207428_10181076 | 3300027907 | Bacteria | 1592 |
| 341 | Ga0268266_10000147 | 3300028379 | Bacteria | 135216 |
| 342 | Ga0268265_10054755 | 3300028380 | Bacteria | 3029 |
| 343 | Ga0268264_10023004 | 3300028381 | Bacteria | 5085 |
| 344 | Ga0265319_1000004 | 3300028563 | Bacteria | 305085 |
| 345 | Ga0265336_10029635 | 3300028666 | Bacteria | 1707 |
| 346 | Ga0265760_10039952 | 3300031090 | Bacteria | 1397 |
| 347 | Ga0307408_100003808 | 3300031548 | Bacteria | 10273 |
| 348 | Ga0265313_10009188 | 3300031595 | Bacteria | 6447 |
| 349 | Ga0307508_10124616 | 3300031616 | Bacteria | 2179 |
| 350 | Ga0307405_10005701 | 3300031731 | Bacteria | 6042 |
| 351 | Ga0307405_10043508 | 3300031731 | Bacteria | 2740 |
| 352 | Ga0307405_10201092 | 3300031731 | Bacteria | 1447 |
| 353 | Ga0307413_10009128 | 3300031824 | Bacteria | 4729 |
| 354 | Ga0307413_10010709 | 3300031824 | Bacteria | 4466 |
| 355 | Ga0307413_10199943 | 3300031824 | Bacteria | 1442 |
| 356 | Ga0307410_10003284 | 3300031852 | Bacteria | 8079 |
| 357 | Ga0307410_10005033 | 3300031852 | Bacteria | 6941 |
| 358 | Ga0307410_10037232 | 3300031852 | Bacteria | 3175 |
| 359 | Ga0307410_10088625 | 3300031852 | Bacteria | 2191 |
| 360 | Ga0307410_10156285 | 3300031852 | Bacteria | 1703 |
| 361 | Ga0307410_10177177 | 3300031852 | Bacteria | 1611 |
| 362 | Ga0307410_10240955 | 3300031852 | Bacteria | 1401 |
| 363 | Ga0307410_10247833 | 3300031852 | Bacteria | 1384 |
| 364 | Ga0307406_10006231 | 3300031901 | Bacteria | 6568 |
| 365 | Ga0307406_10012889 | 3300031901 | Bacteria | 4776 |
| 366 | Ga0307406_10034267 | 3300031901 | Bacteria | 3114 |
| 367 | Ga0307406_10099979 | 3300031901 | Bacteria | 1973 |
| 368 | Ga0307407_10000525 | 3300031903 | Bacteria | 11926 |
| 369 | Ga0307407_10016117 | 3300031903 | Bacteria | 3712 |
| 370 | Ga0307407_10086790 | 3300031903 | Bacteria | 1907 |
| 371 | Ga0307407_10389000 | 3300031903 | Bacteria | 998 |
| 372 | Ga0307412_10003596 | 3300031911 | Bacteria | 8610 |
| 373 | Ga0307412_10063257 | 3300031911 | Bacteria | 2495 |
| 374 | Ga0307412_10063730 | 3300031911 | Bacteria | 2488 |
| 375 | Ga0307409_100013872 | 3300031995 | Bacteria | 5211 |
| 376 | Ga0307409_100053436 | 3300031995 | Bacteria | 3103 |
| 377 | Ga0307409_100226129 | 3300031995 | Bacteria | 1692 |
| 378 | Ga0307409_100734613 | 3300031995 | Bacteria | 990 |
| 379 | Ga0307416_100006835 | 3300032002 | Bacteria | 7178 |
| 380 | Ga0307416_100018075 | 3300032002 | Bacteria | 4955 |
| 381 | Ga0307416_100024505 | 3300032002 | Bacteria | 4406 |
| 382 | Ga0307416_100026289 | 3300032002 | Bacteria | 4286 |
| 383 | Ga0307416_100034294 | 3300032002 | Bacteria | 3860 |
| 384 | Ga0307416_100074539 | 3300032002 | Bacteria | 2836 |
| 385 | Ga0307416_100203742 | 3300032002 | Bacteria | 1880 |
| 386 | Ga0307416_100386956 | 3300032002 | Bacteria | 1431 |
| 387 | Ga0307414_10092247 | 3300032004 | Bacteria | 2254 |
| 388 | Ga0307414_10122832 | 3300032004 | Bacteria | 2000 |
| 389 | Ga0307414_10396110 | 3300032004 | Bacteria | 1198 |
| 390 | Ga0307414_10733227 | 3300032004 | Bacteria | 897 |
| 391 | Ga0307411_10012071 | 3300032005 | Bacteria | 4693 |
| 392 | Ga0307411_10036009 | 3300032005 | Bacteria | 3096 |
| 393 | Ga0307411_10123284 | 3300032005 | Bacteria | 1879 |
| 394 | Ga0307415_100007943 | 3300032126 | Bacteria | 5842 |
| 395 | Ga0307415_100066855 | 3300032126 | Bacteria | 2510 |
| 396 | Ga0307415_100088369 | 3300032126 | Bacteria | 2236 |
| 397 | Ga0307415_100203956 | 3300032126 | Bacteria | 1571 |
| 398 | Ga0373959_0008725 | 3300034820 | Bacteria | 1733 |
| 399 | Ga0373929_0012445 | 3300035085 | Bacteria | 1617 |
| 400 | Ga0373940_0051516 | 3300035088 | Bacteria | 1158 |
| 401 | Ga0373951_0054871 | 3300035091 | Bacteria | 987 |
| 402 | Ga0373923_0010301 | 3300035111 | Bacteria | 3397 |
| 403 | Ga0373932_0041022 | 3300035112 | Bacteria | 1336 |
| 404 | Ga0373954_0005888 | 3300035118 | Bacteria | 5329 |
| 405 | Ga0373956_0001960 | 3300035119 | Bacteria | 8521 |
| 406 | Ga0373957_0097194 | 3300035120 | Bacteria | 1176 |
| 407 | Ga0373943_0008709 | 3300035170 | Bacteria | 4549 |
| 408 | Ga0373955_0060645 | 3300035172 | Bacteria | 2087 |
| 409 | Ga0373942_0046770 | 3300035207 | Bacteria | 1200 |
| 410 | Ga0373935_0020533 | 3300035692 | Bacteria | 4037 |
| 411 | Ga0373927_0001201 | 3300035695 | Bacteria | 19664 |
| 412 | Ga0373927_0030297 | 3300035695 | Bacteria | 3530 |
| 413 | Ga0373927_0164434 | 3300035695 | Bacteria | 1454 |
| 414 | Ga0373933_0009245 | 3300035724 | Bacteria | 5381 |
| 415 | Ga0373937_0002168 | 3300036401 | Bacteria | 16442 |
| 416 | Ga0373937_0002247 | 3300036401 | Bacteria | 16119 |
| 417 | Ga0373937_0015906 | 3300036401 | Bacteria | 6672 |
| 418 | Ga0373937_0026952 | 3300036401 | Bacteria | 5195 |
| 419 | Ga0395905_0027078 | 3300037471 | Bacteria | 5406 |
| 420 | Ga0395905_0652979 | 3300037471 | Bacteria | 954 |
| 421 | Ga0436364_0501893 | 3300037853 | Bacteria | 3109 |
| 422 | Ga0436364_0917857 | 3300037853 | Bacteria | 3300 |
| 423 | Ga0436364_1121491 | 3300037853 | Bacteria | 1340 |
| 424 | Ga0436365_0980681 | 3300039437 | Bacteria | 16656 |
| 425 | Ga0436365_0983332 | 3300039437 | Bacteria | 2832 |
| 426 | Ga0436360_0242098 | 3300039438 | Bacteria | 4776 |
| 427 | Ga0436361_0684364 | 3300039447 | Bacteria | 6544 |
| 428 | Ga0436361_1153452 | 3300039447 | Bacteria | 2148 |
| 429 | Ga0436363_0977531 | 3300039450 | Bacteria | 1228 |
| 430 | Ga0436362_0010689 | 3300039453 | Bacteria | 2020 |
| 431 | Ga0439433_0019348 | 3300041999 | Bacteria | 1517 |
| 432 | Ga0439446_0044601 | 3300042156 | Bacteria | 1312 |
| 433 | Ga0439434_0053311 | 3300042435 | Bacteria | 1256 |
| 434 | Ga0439435_0067669 | 3300042436 | Bacteria | 1052 |
| 435 | Ga0466969_0062408 | 3300044656 | Bacteria | 1808 |
| 436 | Ga0453683_0051454 | 3300044673 | Bacteria | 2580 |
| 437 | Ga0466966_0056711 | 3300044684 | Bacteria | 2478 |
| 438 | Ga0466963_0048087 | 3300044694 | Bacteria | 2817 |
| 439 | Ga0466959_0082416 | 3300045049 | Bacteria | 2317 |
| 440 | Ga0451576_0399755 | 3300045051 | Bacteria | 1440 |
| 441 | Ga0495592_0152671 | 3300046454 | Bacteria | 1596 |
| 442 | Ga0495629_0194325 | 3300046459 | Bacteria | 1404 |
| 443 | Ga0495580_0018051 | 3300046472 | Bacteria | 5260 |
| 444 | Ga0495580_0079826 | 3300046472 | Bacteria | 2282 |
| 445 | Ga0495580_0108070 | 3300046472 | Bacteria | 1931 |
| 446 | Ga0495582_0069203 | 3300046473 | Bacteria | 1951 |
| 447 | Ga0495639_0029958 | 3300046475 | Bacteria | 2417 |
| 448 | Ga0495664_0153361 | 3300046477 | Bacteria | 1397 |
| 449 | Ga0495594_0008475 | 3300046499 | Bacteria | 5298 |
| 450 | Ga0495594_0009198 | 3300046499 | Bacteria | 5098 |
| 451 | Ga0495594_0264769 | 3300046499 | Bacteria | 979 |
| 452 | Ga0495608_0016070 | 3300046511 | Bacteria | 5179 |
| 453 | Ga0495618_0142191 | 3300046514 | Bacteria | 1534 |
| 454 | Ga0495630_0006389 | 3300046517 | Bacteria | 8381 |
| 455 | Ga0495630_0131266 | 3300046517 | Bacteria | 1902 |
| 456 | Ga0495666_0072230 | 3300046526 | Bacteria | 1639 |
| 457 | Ga0495652_0049795 | 3300046529 | Bacteria | 3584 |
| 458 | Ga0495640_0045808 | 3300046533 | Bacteria | 3034 |
| 459 | Ga0495640_0136344 | 3300046533 | Bacteria | 1585 |
| 460 | Ga0495586_0017163 | 3300046535 | Bacteria | 3847 |
| 461 | Ga0495587_0000482 | 3300046536 | Bacteria | 27682 |
| 462 | Ga0495587_0082549 | 3300046536 | Bacteria | 1862 |
| 463 | Ga0495621_0021169 | 3300046539 | Bacteria | 2141 |
| 464 | Ga0495645_0000281 | 3300046543 | Bacteria | 37502 |
| 465 | Ga0495667_0010652 | 3300046559 | Bacteria | 6216 |
| 466 | Ga0495667_0063289 | 3300046559 | Bacteria | 2422 |
| 467 | Ga0495634_0029490 | 3300046642 | Bacteria | 3798 |
| 468 | Ga0495635_0008778 | 3300046663 | Bacteria | 7057 |
| 469 | Ga0495635_0039748 | 3300046663 | Bacteria | 3253 |
| 470 | Ga0495657_0002538 | 3300046675 | Bacteria | 15310 |
| 471 | Ga0495599_0012658 | 3300046678 | Bacteria | 5203 |
| 472 | Ga0495599_0116796 | 3300046678 | Bacteria | 1660 |
| 473 | Ga0495623_0001495 | 3300046679 | Bacteria | 15855 |
| 474 | Ga0495623_0051016 | 3300046679 | Bacteria | 2619 |
| 475 | Ga0495623_0062236 | 3300046679 | Bacteria | 2339 |
| 476 | Ga0495623_0271947 | 3300046679 | Bacteria | 946 |
| 477 | Ga0495647_0041888 | 3300046681 | Bacteria | 1746 |
| 478 | Ga0495658_0125763 | 3300046683 | Bacteria | 1555 |
| 479 | Ga0495658_0170850 | 3300046683 | Bacteria | 1345 |
| 480 | Ga0495613_0030875 | 3300046689 | Bacteria | 3980 |
| 481 | Ga0495613_0189869 | 3300046689 | Bacteria | 1452 |
| 482 | Ga0495624_0002683 | 3300046690 | Bacteria | 13415 |
| 483 | Ga0495624_0138564 | 3300046690 | Bacteria | 1491 |
| 484 | Ga0495600_0014660 | 3300046809 | Bacteria | 4941 |
| 485 | Ga0495600_0051736 | 3300046809 | Bacteria | 2681 |
| 486 | Ga0495604_0001304 | 3300047317 | Bacteria | 20380 |
| 487 | Ga0495604_0039649 | 3300047317 | Bacteria | 3701 |
| 488 | Ga0495674_0034066 | 3300047319 | Bacteria | 4607 |
| 489 | Ga0495680_0009874 | 3300047322 | Bacteria | 8555 |
| 490 | Ga0495680_0275651 | 3300047322 | Bacteria | 1187 |
| 491 | Ga0495675_0019969 | 3300047444 | Bacteria | 4258 |
| 492 | Ga0495684_0057858 | 3300047471 | Bacteria | 2954 |
| 493 | Ga0495684_0242180 | 3300047471 | Bacteria | 1315 |
| 494 | Ga0495684_0253435 | 3300047471 | Bacteria | 1279 |
| 495 | Ga0495593_0007439 | 3300047673 | Bacteria | 6408 |
| 496 | Ga0495602_0029451 | 3300048088 | Bacteria | 5227 |
| 497 | Ga0496101_0059169 | 3300048904 | Bacteria | 2777 |
| 498 | Ga0496102_0064133 | 3300048905 | Bacteria | 3365 |
| 499 | Ga0496102_0113242 | 3300048905 | Bacteria | 2531 |
| 500 | Ga0496104_0202899 | 3300048907 | Bacteria | 1895 |
| 501 | Ga0496105_0107794 | 3300048908 | Bacteria | 2300 |
| 502 | Ga0496105_0151613 | 3300048908 | Bacteria | 1905 |
| 503 | Ga0496108_0001699 | 3300048911 | Bacteria | 17458 |
| 504 | Ga0496108_0034487 | 3300048911 | Bacteria | 4205 |
| 505 | Ga0496109_0001520 | 3300048912 | Bacteria | 19309 |
| 506 | Ga0496109_0069828 | 3300048912 | Bacteria | 3223 |
| 507 | Ga0496110_0043763 | 3300048913 | Bacteria | 3910 |
| 508 | Ga0496111_0019386 | 3300048914 | Bacteria | 4723 |
| 509 | Ga0496112_0025175 | 3300048915 | Bacteria | 5711 |
| 510 | Ga0496112_0336874 | 3300048915 | Bacteria | 1452 |
| 511 | Ga0496112_0342824 | 3300048915 | Bacteria | 1437 |
| 512 | Ga0496112_0480810 | 3300048915 | Bacteria | 1178 |
| 513 | Ga0496113_0000045 | 3300048916 | Bacteria | 51839 |
| 514 | Ga0496113_0433832 | 3300048916 | Bacteria | 1055 |
| 515 | Ga0496114_0004558 | 3300048917 | Bacteria | 10762 |
| 516 | Ga0496114_0071373 | 3300048917 | Bacteria | 2918 |
| 517 | Ga0501040_0145748 | 3300049576 | Bacteria | 1669 |
| 518 | Ga0501041_0182574 | 3300049577 | Bacteria | 1313 |
| 519 | Ga0501042_0026072 | 3300049578 | Bacteria | 4109 |
| 520 | Ga0501042_0322134 | 3300049578 | Bacteria | 1117 |
| 521 | Ga0501046_0000007 | 3300049580 | Bacteria | 356002 |
| 522 | Ga0501046_0347306 | 3300049580 | Bacteria | 1078 |
| 523 | Ga0501047_0002779 | 3300049581 | Bacteria | 16630 |
| 524 | Ga0501048_0005345 | 3300049582 | Bacteria | 9774 |
| 525 | Ga0501048_0047088 | 3300049582 | Bacteria | 3077 |
| 526 | Ga0501076_0144807 | 3300049592 | Bacteria | 1932 |
| 527 | Ga0501076_0222047 | 3300049592 | Bacteria | 1544 |
| 528 | Ga0501202_002164 | 3300049652 | Bacteria | 3271 |
| 529 | Ga0501216_001839 | 3300049660 | Bacteria | 2929 |
| 530 | Ga0501217_008724 | 3300049661 | Bacteria | 2196 |
| 531 | Ga0501224_025270 | 3300049664 | Bacteria | 888 |
| 532 | Ga0501230_014762 | 3300049667 | Bacteria | 1287 |
| 533 | Ga0501233_015316 | 3300049668 | Bacteria | 1577 |
| 534 | Ga0501235_001140 | 3300049669 | Bacteria | 5574 |
| 535 | Ga0501249_003903 | 3300049679 | Bacteria | 3012 |
| 536 | Ga0501251_011038 | 3300049681 | Bacteria | 1070 |
| 537 | Ga0501252_006973 | 3300049682 | Bacteria | 1269 |
| 538 | Ga0501259_010116 | 3300049688 | Bacteria | 1539 |
| 539 | Ga0501221_004359 | 3300049704 | Bacteria | 2346 |
| 540 | Ga0501225_0002931 | 3300049705 | Bacteria | 5234 |
| 541 | Ga0501234_003567 | 3300049707 | Bacteria | 2444 |
| 542 | Ga0501079_0282735 | 3300049741 | Bacteria | 1297 |
| 543 | Ga0501081_0124794 | 3300049743 | Bacteria | 1836 |
| 544 | Ga0501081_0199377 | 3300049743 | Bacteria | 1451 |
| 545 | Ga0501083_0000032 | 3300049744 | Bacteria | 102761 |
| 546 | Ga0501268_007645 | 3300049765 | Bacteria | 1617 |
| 547 | Ga0501035_0028247 | 3300049822 | Bacteria | 5121 |
| 548 | Ga0501044_0385959 | 3300049823 | Bacteria | 1315 |
| 549 | Ga0501045_0035278 | 3300049824 | Bacteria | 3631 |
| 550 | Ga0501045_0183038 | 3300049824 | Bacteria | 1561 |
| 551 | Ga0501212_006197 | 3300049851 | Bacteria | 1606 |
| 552 | nmdc:mga05p37_154290_c1 | 3300050507 | Bacteria | 2807 |
| 553 | nmdc:mga05p37_29_c1 | 3300050507 | Bacteria | 114400 |
| 554 | nmdc:mga05p37_498005_c1 | 3300050507 | Bacteria | 1399 |
| 555 | nmdc:mga05p37_96891_c1 | 3300050507 | Bacteria | 3634 |
| 556 | nmdc:mga09592_14387_c1 | 3300050508 | Bacteria | 6458 |
| 557 | nmdc:mga0qj67_48814_c1 | 3300050509 | Bacteria | 3344 |
| 558 | nmdc:mga06r32_14295_c1 | 3300050510 | Bacteria | 7200 |
| 559 | nmdc:mga06r32_167161_c1 | 3300050510 | Bacteria | 2183 |
| 560 | nmdc:mga06r32_396020_c1 | 3300050510 | Bacteria | 1363 |
| 561 | nmdc:mga06r32_429834_c1 | 3300050510 | Bacteria | 1301 |
| 562 | nmdc:mga06r32_5842_c1 | 3300050510 | Bacteria | 11076 |
| 563 | nmdc:mga06r32_664687_c1 | 3300050510 | Bacteria | 1009 |
| 564 | nmdc:mga06r32_87717_c1 | 3300050510 | Bacteria | 3036 |
| 565 | nmdc:mga08y16_107673_c1 | 3300050511 | Bacteria | 2902 |
| 566 | nmdc:mga08y16_12052_c1 | 3300050511 | Bacteria | 9084 |
| 567 | nmdc:mga08y16_178568_c1 | 3300050511 | Bacteria | 2205 |
| 568 | nmdc:mga08y16_196218_c1 | 3300050511 | Bacteria | 2092 |
| 569 | nmdc:mga08y16_201352_c1 | 3300050511 | Bacteria | 2063 |
| 570 | nmdc:mga08y16_363798_c1 | 3300050511 | Bacteria | 1485 |
| 571 | nmdc:mga08y16_4064_c1 | 3300050511 | Bacteria | 15280 |
| 572 | nmdc:mga08y16_50788_c1 | 3300050511 | Bacteria | 4339 |
| 573 | nmdc:mga08y16_65981_c1 | 3300050511 | Bacteria | 3777 |
| 574 | nmdc:mga08y16_817407_c1 | 3300050511 | Bacteria | 924 |
| 575 | nmdc:mga0n895_113412_c1 | 3300050512 | Bacteria | 2728 |
| 576 | nmdc:mga0n895_406234_c1 | 3300050512 | Bacteria | 1377 |
| 577 | nmdc:mga08x19_1980_c1 | 3300050514 | Bacteria | 12546 |
| 578 | nmdc:mga08x19_19932_c1 | 3300050514 | Bacteria | 4124 |
| 579 | nmdc:mga08x19_285771_c1 | 3300050514 | Bacteria | 1144 |
| 580 | nmdc:mga08x19_34822_c1 | 3300050514 | Bacteria | 3184 |
| 581 | nmdc:mga08x19_384_c1 | 3300050514 | Bacteria | 31046 |
| 582 | nmdc:mga08x19_57610_c1 | 3300050514 | Bacteria | 2511 |
| 583 | nmdc:mga08x19_74283_c1 | 3300050514 | Bacteria | 2221 |
| 584 | nmdc:mga0a205_102432_c1 | 3300050515 | Bacteria | 2761 |
| 585 | nmdc:mga0a205_311843_c1 | 3300050515 | Bacteria | 1445 |
| 586 | nmdc:mga0a205_362495_c1 | 3300050515 | Bacteria | 1316 |
| 587 | nmdc:mga0a205_63829_c1 | 3300050515 | Bacteria | 3557 |
| 588 | Ga0500556_0015581 | 3300053104 | Bacteria | 2348 |
| 589 | Ga0500628_000158 | 3300053129 | Bacteria | 13094 |
| 590 | Ga0590071_000045 | 3300059421 | Bacteria | 31970 |
| 591 | Ga0590074_004409 | 3300059423 | Bacteria | 2327 |
| 592 | Ga0590075_003436 | 3300059424 | Bacteria | 3766 |
| 593 | Ga0590077_000522 | 3300059426 | Bacteria | 10624 |
| 594 | Ga0501082_0095547 | 3300060353 | Bacteria | 2569 |
| 595 | Ga0501082_0353527 | 3300060353 | Bacteria | 1281 |
| 596 | Ga0530510_0585526 | 3300061734 | Bacteria | 848 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048905 | Ga0496102_0064133 | Ga0496102_0064133_35_733 | 227 |
| 2 | 3300005617 | Ga0068859_100925459 | Ga0068859_1009254592 | 231 |
| 3 | 3300006931 | Ga0097620_100925314 | Ga0097620_1009253141 | 231 |
| 4 | 3300025938 | Ga0207704_10567351 | Ga0207704_105673511 | 231 |
| 5 | 3300005434 | Ga0070709_10314855 | Ga0070709_103148552 | 236 |
| 6 | 3300048905 | Ga0496102_0113242 | Ga0496102_0113242_1297_2061 | 236 |
| 7 | 3300050514 | nmdc:mga08x19_34822_c1 | nmdc:mga08x19_34822_c1_952_1716 | 236 |
| 8 | 3300005336 | Ga0070680_100025541 | Ga0070680_1000255412 | 238 |
| 9 | 3300025912 | Ga0207707_10010257 | Ga0207707_100102576 | 238 |
| 10 | 3300025917 | Ga0207660_10229879 | Ga0207660_102298792 | 238 |
| 11 | 3300025921 | Ga0207652_10134250 | Ga0207652_101342502 | 238 |
| 12 | 3300031731 | Ga0307405_10043508 | Ga0307405_100435083 | 238 |
| 13 | 3300031852 | Ga0307410_10037232 | Ga0307410_100372323 | 238 |
| 14 | 3300031903 | Ga0307407_10000525 | Ga0307407_100005255 | 238 |
| 15 | 3300031911 | Ga0307412_10003596 | Ga0307412_100035965 | 238 |
| 16 | 3300032002 | Ga0307416_100026289 | Ga0307416_1000262893 | 238 |
| 17 | 3300032005 | Ga0307411_10036009 | Ga0307411_100360092 | 238 |
| 18 | 3300005518 | Ga0070699_100029764 | Ga0070699_1000297641 | 239 |
| 19 | 3300006914 | Ga0075436_100062553 | Ga0075436_1000625532 | 239 |
| 20 | 3300050512 | nmdc:mga0n895_406234_c1 | nmdc:mga0n895_406234_c1_87_842 | 239 |
| 21 | 3300031903 | Ga0307407_10086790 | Ga0307407_100867902 | 241 |
| 22 | 3300032002 | Ga0307416_100386956 | Ga0307416_1003869562 | 241 |
| 23 | 3300006847 | Ga0075431_100491609 | Ga0075431_1004916092 | 242 |
| 24 | 3300041999 | Ga0439433_0019348 | Ga0439433_0019348_403_1140 | 242 |
| 25 | 3300050510 | nmdc:mga06r32_396020_c1 | nmdc:mga06r32_396020_c1_272_1009 | 242 |
| 26 | 3300050510 | nmdc:mga06r32_429834_c1 | nmdc:mga06r32_429834_c1_283_1020 | 242 |
| 27 | 3300050510 | nmdc:mga06r32_664687_c1 | nmdc:mga06r32_664687_c1_187_924 | 242 |
| 28 | 3300053104 | Ga0500556_0015581 | Ga0500556_0015581_1117_1857 | 242 |
| 29 | 3300061734 | Ga0530510_0585526 | Ga0530510_0585526_26_829 | 242 |
| 30 | 3300046539 | Ga0495621_0021169 | Ga0495621_0021169_1377_2120 | 243 |
| 31 | 3300005841 | Ga0068863_100025379 | Ga0068863_1000253792 | 244 |
| 32 | 3300035091 | Ga0373951_0054871 | Ga0373951_0054871_29_862 | 244 |
| 33 | 3300048908 | Ga0496105_0151613 | Ga0496105_0151613_83_916 | 244 |
| 34 | 3300048911 | Ga0496108_0001699 | Ga0496108_0001699_16461_17294 | 244 |
| 35 | 3300048911 | Ga0496108_0034487 | Ga0496108_0034487_1823_2656 | 244 |
| 36 | 3300048912 | Ga0496109_0001520 | Ga0496109_0001520_1007_1840 | 244 |
| 37 | 3300048913 | Ga0496110_0043763 | Ga0496110_0043763_2177_3010 | 244 |
| 38 | 3300048914 | Ga0496111_0019386 | Ga0496111_0019386_2500_3333 | 244 |
| 39 | 3300048915 | Ga0496112_0480810 | Ga0496112_0480810_223_1056 | 244 |
| 40 | 3300048916 | Ga0496113_0000045 | Ga0496113_0000045_800_1633 | 244 |
| 41 | 3300048916 | Ga0496113_0433832 | Ga0496113_0433832_78_911 | 244 |
| 42 | 3300005354 | Ga0070675_100317604 | Ga0070675_1003176042 | 245 |
| 43 | 3300005440 | Ga0070705_100373802 | Ga0070705_1003738022 | 245 |
| 44 | 3300006844 | Ga0075428_100001555 | Ga0075428_1000015551 | 245 |
| 45 | 3300006880 | Ga0075429_100089045 | Ga0075429_1000890452 | 245 |
| 46 | 3300009094 | Ga0111539_10173720 | Ga0111539_101737202 | 245 |
| 47 | 3300042436 | Ga0439435_0067669 | Ga0439435_0067669_255_992 | 245 |
| 48 | 3300045051 | Ga0451576_0399755 | Ga0451576_0399755_388_1134 | 245 |
| 49 | 3300046683 | Ga0495658_0170850 | Ga0495658_0170850_447_1187 | 245 |
| 50 | 3300050510 | nmdc:mga06r32_87717_c1 | nmdc:mga06r32_87717_c1_1469_2209 | 245 |
| 51 | 3300050511 | nmdc:mga08y16_201352_c1 | nmdc:mga08y16_201352_c1_914_1651 | 245 |
| 52 | 3300005340 | Ga0070689_100347784 | Ga0070689_1003477842 | 246 |
| 53 | 3300005347 | Ga0070668_100325558 | Ga0070668_1003255581 | 246 |
| 54 | 3300005440 | Ga0070705_100191399 | Ga0070705_1001913991 | 246 |
| 55 | 3300005466 | Ga0070685_10002842 | Ga0070685_100028424 | 246 |
| 56 | 3300005467 | Ga0070706_100242830 | Ga0070706_1002428302 | 246 |
| 57 | 3300005467 | Ga0070706_100510812 | Ga0070706_1005108122 | 246 |
| 58 | 3300005471 | Ga0070698_100006078 | Ga0070698_10000607811 | 246 |
| 59 | 3300005518 | Ga0070699_100000005 | Ga0070699_100000005250 | 246 |
| 60 | 3300005518 | Ga0070699_100003942 | Ga0070699_1000039424 | 246 |
| 61 | 3300005518 | Ga0070699_100100447 | Ga0070699_1001004472 | 246 |
| 62 | 3300005518 | Ga0070699_100287808 | Ga0070699_1002878082 | 246 |
| 63 | 3300005548 | Ga0070665_100000235 | Ga0070665_10000023520 | 246 |
| 64 | 3300005564 | Ga0070664_100031389 | Ga0070664_1000313892 | 246 |
| 65 | 3300005618 | Ga0068864_100148696 | Ga0068864_1001486963 | 246 |
| 66 | 3300005618 | Ga0068864_100241638 | Ga0068864_1002416381 | 246 |
| 67 | 3300005843 | Ga0068860_100024771 | Ga0068860_1000247713 | 246 |
| 68 | 3300006358 | Ga0068871_100053092 | Ga0068871_1000530922 | 246 |
| 69 | 3300006881 | Ga0068865_100274402 | Ga0068865_1002744022 | 246 |
| 70 | 3300007265 | Ga0099794_10043250 | Ga0099794_100432502 | 246 |
| 71 | 3300009094 | Ga0111539_10006462 | Ga0111539_1000646210 | 246 |
| 72 | 3300009094 | Ga0111539_10289002 | Ga0111539_102890022 | 246 |
| 73 | 3300009147 | Ga0114129_10134232 | Ga0114129_101342326 | 246 |
| 74 | 3300009147 | Ga0114129_10266290 | Ga0114129_102662902 | 246 |
| 75 | 3300009553 | Ga0105249_10655131 | Ga0105249_106551311 | 246 |
| 76 | 3300013296 | Ga0157374_10111858 | Ga0157374_101118582 | 246 |
| 77 | 3300014969 | Ga0157376_10045238 | Ga0157376_100452383 | 246 |
| 78 | 3300025907 | Ga0207645_10277388 | Ga0207645_102773882 | 246 |
| 79 | 3300025910 | Ga0207684_10164411 | Ga0207684_101644112 | 246 |
| 80 | 3300025925 | Ga0207650_10012022 | Ga0207650_100120224 | 246 |
| 81 | 3300025931 | Ga0207644_10328887 | Ga0207644_103288872 | 246 |
| 82 | 3300025935 | Ga0207709_10167988 | Ga0207709_101679882 | 246 |
| 83 | 3300025938 | Ga0207704_10383507 | Ga0207704_103835072 | 246 |
| 84 | 3300026095 | Ga0207676_10129457 | Ga0207676_101294572 | 246 |
| 85 | 3300028379 | Ga0268266_10000147 | Ga0268266_1000014746 | 246 |
| 86 | 3300031616 | Ga0307508_10124616 | Ga0307508_101246163 | 246 |
| 87 | 3300032004 | Ga0307414_10733227 | Ga0307414_107332271 | 246 |
| 88 | 3300035085 | Ga0373929_0012445 | Ga0373929_0012445_431_1171 | 246 |
| 89 | 3300039450 | Ga0436363_0977531 | Ga0436363_0977531_459_1199 | 246 |
| 90 | 3300044673 | Ga0453683_0051454 | Ga0453683_0051454_1258_2001 | 246 |
| 91 | 3300044694 | Ga0466963_0048087 | Ga0466963_0048087_1470_2210 | 246 |
| 92 | 3300046473 | Ga0495582_0069203 | Ga0495582_0069203_811_1593 | 246 |
| 93 | 3300046477 | Ga0495664_0153361 | Ga0495664_0153361_435_1217 | 246 |
| 94 | 3300046499 | Ga0495594_0009198 | Ga0495594_0009198_75_857 | 246 |
| 95 | 3300046514 | Ga0495618_0142191 | Ga0495618_0142191_651_1433 | 246 |
| 96 | 3300046517 | Ga0495630_0131266 | Ga0495630_0131266_710_1492 | 246 |
| 97 | 3300046526 | Ga0495666_0072230 | Ga0495666_0072230_550_1332 | 246 |
| 98 | 3300046533 | Ga0495640_0045808 | Ga0495640_0045808_858_1640 | 246 |
| 99 | 3300046642 | Ga0495634_0029490 | Ga0495634_0029490_87_869 | 246 |
| 100 | 3300046681 | Ga0495647_0041888 | Ga0495647_0041888_121_903 | 246 |
| 101 | 3300046683 | Ga0495658_0125763 | Ga0495658_0125763_146_928 | 246 |
| 102 | 3300046689 | Ga0495613_0189869 | Ga0495613_0189869_446_1228 | 246 |
| 103 | 3300046690 | Ga0495624_0138564 | Ga0495624_0138564_382_1164 | 246 |
| 104 | 3300047319 | Ga0495674_0034066 | Ga0495674_0034066_360_1142 | 246 |
| 105 | 3300047471 | Ga0495684_0242180 | Ga0495684_0242180_214_996 | 246 |
| 106 | 3300048907 | Ga0496104_0202899 | Ga0496104_0202899_726_1466 | 246 |
| 107 | 3300049578 | Ga0501042_0322134 | Ga0501042_0322134_292_1032 | 246 |
| 108 | 3300049592 | Ga0501076_0222047 | Ga0501076_0222047_522_1262 | 246 |
| 109 | 3300049743 | Ga0501081_0199377 | Ga0501081_0199377_331_1077 | 246 |
| 110 | 3300050507 | nmdc:mga05p37_154290_c1 | nmdc:mga05p37_154290_c1_455_1195 | 246 |
| 111 | 3300050507 | nmdc:mga05p37_498005_c1 | nmdc:mga05p37_498005_c1_582_1325 | 246 |
| 112 | 3300050511 | nmdc:mga08y16_107673_c1 | nmdc:mga08y16_107673_c1_1323_2069 | 246 |
| 113 | 3300050511 | nmdc:mga08y16_12052_c1 | nmdc:mga08y16_12052_c1_441_1184 | 246 |
| 114 | 3300050511 | nmdc:mga08y16_4064_c1 | nmdc:mga08y16_4064_c1_5991_6731 | 246 |
| 115 | 3300050511 | nmdc:mga08y16_65981_c1 | nmdc:mga08y16_65981_c1_193_933 | 246 |
| 116 | 3300050515 | nmdc:mga0a205_311843_c1 | nmdc:mga0a205_311843_c1_424_1167 | 246 |
| 117 | 3300053129 | Ga0500628_000158 | Ga0500628_000158_7098_7955 | 246 |
| 118 | 3300059421 | Ga0590071_000045 | Ga0590071_000045_10084_10824 | 246 |
| 119 | 3300059423 | Ga0590074_004409 | Ga0590074_004409_1053_1793 | 246 |
| 120 | 3300059424 | Ga0590075_003436 | Ga0590075_003436_2435_3175 | 246 |
| 121 | 3300059426 | Ga0590077_000522 | Ga0590077_000522_6296_7036 | 246 |
| 122 | 3300005329 | Ga0070683_100137155 | Ga0070683_1001371552 | 247 |
| 123 | 3300005331 | Ga0070670_100010608 | Ga0070670_1000106083 | 247 |
| 124 | 3300005336 | Ga0070680_100229225 | Ga0070680_1002292252 | 247 |
| 125 | 3300005344 | Ga0070661_100001310 | Ga0070661_10000131014 | 247 |
| 126 | 3300005347 | Ga0070668_100035893 | Ga0070668_1000358933 | 247 |
| 127 | 3300005356 | Ga0070674_100781873 | Ga0070674_1007818731 | 247 |
| 128 | 3300005440 | Ga0070705_100005309 | Ga0070705_1000053092 | 247 |
| 129 | 3300005445 | Ga0070708_100002538 | Ga0070708_1000025386 | 247 |
| 130 | 3300005456 | Ga0070678_100007796 | Ga0070678_1000077962 | 247 |
| 131 | 3300005456 | Ga0070678_100245178 | Ga0070678_1002451782 | 247 |
| 132 | 3300005459 | Ga0068867_100076893 | Ga0068867_1000768934 | 247 |
| 133 | 3300005530 | Ga0070679_100103902 | Ga0070679_1001039022 | 247 |
| 134 | 3300005530 | Ga0070679_100104393 | Ga0070679_1001043933 | 247 |
| 135 | 3300005530 | Ga0070679_100147606 | Ga0070679_1001476063 | 247 |
| 136 | 3300005535 | Ga0070684_100273905 | Ga0070684_1002739052 | 247 |
| 137 | 3300005536 | Ga0070697_100060051 | Ga0070697_1000600512 | 247 |
| 138 | 3300005548 | Ga0070665_100468714 | Ga0070665_1004687142 | 247 |
| 139 | 3300005548 | Ga0070665_100681705 | Ga0070665_1006817052 | 247 |
| 140 | 3300005617 | Ga0068859_100012017 | Ga0068859_1000120173 | 247 |
| 141 | 3300005617 | Ga0068859_100047750 | Ga0068859_1000477505 | 247 |
| 142 | 3300005618 | Ga0068864_100007082 | Ga0068864_1000070828 | 247 |
| 143 | 3300005719 | Ga0068861_100246884 | Ga0068861_1002468842 | 247 |
| 144 | 3300005841 | Ga0068863_100057293 | Ga0068863_1000572934 | 247 |
| 145 | 3300005842 | Ga0068858_100247436 | Ga0068858_1002474361 | 247 |
| 146 | 3300005843 | Ga0068860_100023785 | Ga0068860_1000237857 | 247 |
| 147 | 3300005844 | Ga0068862_100050605 | Ga0068862_1000506055 | 247 |
| 148 | 3300006028 | Ga0070717_10062619 | Ga0070717_100626192 | 247 |
| 149 | 3300006237 | Ga0097621_100027482 | Ga0097621_1000274822 | 247 |
| 150 | 3300006358 | Ga0068871_100609138 | Ga0068871_1006091382 | 247 |
| 151 | 3300006847 | Ga0075431_100001632 | Ga0075431_10000163222 | 247 |
| 152 | 3300006847 | Ga0075431_100687100 | Ga0075431_1006871001 | 247 |
| 153 | 3300006880 | Ga0075429_100110910 | Ga0075429_1001109102 | 247 |
| 154 | 3300006914 | Ga0075436_100038046 | Ga0075436_1000380462 | 247 |
| 155 | 3300006931 | Ga0097620_100012017 | Ga0097620_1000120173 | 247 |
| 156 | 3300006931 | Ga0097620_100047752 | Ga0097620_1000477522 | 247 |
| 157 | 3300007265 | Ga0099794_10004013 | Ga0099794_100040134 | 247 |
| 158 | 3300009094 | Ga0111539_10692852 | Ga0111539_106928522 | 247 |
| 159 | 3300009174 | Ga0105241_10202623 | Ga0105241_102026232 | 247 |
| 160 | 3300009176 | Ga0105242_10337491 | Ga0105242_103374912 | 247 |
| 161 | 3300009553 | Ga0105249_10013892 | Ga0105249_100138925 | 247 |
| 162 | 3300013297 | Ga0157378_10173681 | Ga0157378_101736812 | 247 |
| 163 | 3300013306 | Ga0163162_10274092 | Ga0163162_102740922 | 247 |
| 164 | 3300013307 | Ga0157372_10198457 | Ga0157372_101984572 | 247 |
| 165 | 3300013308 | Ga0157375_10027751 | Ga0157375_100277517 | 247 |
| 166 | 3300013308 | Ga0157375_11177121 | Ga0157375_111771211 | 247 |
| 167 | 3300014325 | Ga0163163_10088641 | Ga0163163_100886413 | 247 |
| 168 | 3300014326 | Ga0157380_10141601 | Ga0157380_101416013 | 247 |
| 169 | 3300017792 | Ga0163161_10002047 | Ga0163161_100020475 | 247 |
| 170 | 3300021361 | Ga0213872_10013176 | Ga0213872_100131762 | 247 |
| 171 | 3300021361 | Ga0213872_10021808 | Ga0213872_100218082 | 247 |
| 172 | 3300021361 | Ga0213872_10042231 | Ga0213872_100422311 | 247 |
| 173 | 3300025910 | Ga0207684_10134990 | Ga0207684_101349902 | 247 |
| 174 | 3300025912 | Ga0207707_10187450 | Ga0207707_101874502 | 247 |
| 175 | 3300025919 | Ga0207657_10160618 | Ga0207657_101606182 | 247 |
| 176 | 3300025920 | Ga0207649_10031648 | Ga0207649_100316483 | 247 |
| 177 | 3300025921 | Ga0207652_10102889 | Ga0207652_101028892 | 247 |
| 178 | 3300025921 | Ga0207652_10173015 | Ga0207652_101730152 | 247 |
| 179 | 3300025940 | Ga0207691_10108308 | Ga0207691_101083082 | 247 |
| 180 | 3300025944 | Ga0207661_10168838 | Ga0207661_101688382 | 247 |
| 181 | 3300025944 | Ga0207661_10205556 | Ga0207661_102055562 | 247 |
| 182 | 3300025961 | Ga0207712_10022359 | Ga0207712_100223594 | 247 |
| 183 | 3300025961 | Ga0207712_10105962 | Ga0207712_101059622 | 247 |
| 184 | 3300025972 | Ga0207668_10016839 | Ga0207668_100168394 | 247 |
| 185 | 3300026035 | Ga0207703_10147675 | Ga0207703_101476753 | 247 |
| 186 | 3300026035 | Ga0207703_10498966 | Ga0207703_104989662 | 247 |
| 187 | 3300026089 | Ga0207648_10085312 | Ga0207648_100853124 | 247 |
| 188 | 3300026095 | Ga0207676_10115574 | Ga0207676_101155741 | 247 |
| 189 | 3300026118 | Ga0207675_100172658 | Ga0207675_1001726583 | 247 |
| 190 | 3300026121 | Ga0207683_10009043 | Ga0207683_100090434 | 247 |
| 191 | 3300026121 | Ga0207683_10081509 | Ga0207683_100815091 | 247 |
| 192 | 3300026121 | Ga0207683_10318879 | Ga0207683_103188793 | 247 |
| 193 | 3300027671 | Ga0209588_1011956 | Ga0209588_10119563 | 247 |
| 194 | 3300028380 | Ga0268265_10054755 | Ga0268265_100547555 | 247 |
| 195 | 3300028381 | Ga0268264_10023004 | Ga0268264_100230045 | 247 |
| 196 | 3300031090 | Ga0265760_10039952 | Ga0265760_100399522 | 247 |
| 197 | 3300031548 | Ga0307408_100003808 | Ga0307408_1000038082 | 247 |
| 198 | 3300031731 | Ga0307405_10005701 | Ga0307405_100057015 | 247 |
| 199 | 3300031824 | Ga0307413_10010709 | Ga0307413_100107092 | 247 |
| 200 | 3300031852 | Ga0307410_10005033 | Ga0307410_100050335 | 247 |
| 201 | 3300031901 | Ga0307406_10006231 | Ga0307406_100062314 | 247 |
| 202 | 3300031903 | Ga0307407_10016117 | Ga0307407_100161174 | 247 |
| 203 | 3300031903 | Ga0307407_10389000 | Ga0307407_103890001 | 247 |
| 204 | 3300031911 | Ga0307412_10063257 | Ga0307412_100632572 | 247 |
| 205 | 3300031995 | Ga0307409_100053436 | Ga0307409_1000534362 | 247 |
| 206 | 3300032002 | Ga0307416_100006835 | Ga0307416_1000068355 | 247 |
| 207 | 3300032005 | Ga0307411_10012071 | Ga0307411_100120712 | 247 |
| 208 | 3300032126 | Ga0307415_100007943 | Ga0307415_1000079434 | 247 |
| 209 | 3300032126 | Ga0307415_100088369 | Ga0307415_1000883691 | 247 |
| 210 | 3300039437 | Ga0436365_0983332 | Ga0436365_0983332_1307_2053 | 247 |
| 211 | 3300039438 | Ga0436360_0242098 | Ga0436360_0242098_1590_2336 | 247 |
| 212 | 3300039447 | Ga0436361_0684364 | Ga0436361_0684364_316_1062 | 247 |
| 213 | 3300039447 | Ga0436361_1153452 | Ga0436361_1153452_274_1020 | 247 |
| 214 | 3300044656 | Ga0466969_0062408 | Ga0466969_0062408_866_1609 | 247 |
| 215 | 3300045049 | Ga0466959_0082416 | Ga0466959_0082416_15_758 | 247 |
| 216 | 3300046679 | Ga0495623_0051016 | Ga0495623_0051016_1860_2603 | 247 |
| 217 | 3300048915 | Ga0496112_0342824 | Ga0496112_0342824_309_1052 | 247 |
| 218 | 3300049576 | Ga0501040_0145748 | Ga0501040_0145748_731_1474 | 247 |
| 219 | 3300049664 | Ga0501224_025270 | Ga0501224_025270_52_795 | 247 |
| 220 | 3300050508 | nmdc:mga09592_14387_c1 | nmdc:mga09592_14387_c1_4753_5496 | 247 |
| 221 | 3300050510 | nmdc:mga06r32_14295_c1 | nmdc:mga06r32_14295_c1_6079_6822 | 247 |
| 222 | 3300050511 | nmdc:mga08y16_196218_c1 | nmdc:mga08y16_196218_c1_779_1525 | 247 |
| 223 | 3300050511 | nmdc:mga08y16_363798_c1 | nmdc:mga08y16_363798_c1_130_876 | 247 |
| 224 | 3300050511 | nmdc:mga08y16_50788_c1 | nmdc:mga08y16_50788_c1_994_1740 | 247 |
| 225 | 3300050512 | nmdc:mga0n895_113412_c1 | nmdc:mga0n895_113412_c1_261_1010 | 247 |
| 226 | 3300050514 | nmdc:mga08x19_19932_c1 | nmdc:mga08x19_19932_c1_2268_3011 | 247 |
| 227 | 3300050515 | nmdc:mga0a205_102432_c1 | nmdc:mga0a205_102432_c1_168_923 | 247 |
| 228 | 3300060353 | Ga0501082_0353527 | Ga0501082_0353527_144_887 | 247 |
| 229 | 3300005330 | Ga0070690_100041436 | Ga0070690_1000414361 | 248 |
| 230 | 3300005331 | Ga0070670_100191353 | Ga0070670_1001913532 | 248 |
| 231 | 3300005335 | Ga0070666_10065940 | Ga0070666_100659403 | 248 |
| 232 | 3300005338 | Ga0068868_100088743 | Ga0068868_1000887431 | 248 |
| 233 | 3300005354 | Ga0070675_100072690 | Ga0070675_1000726903 | 248 |
| 234 | 3300005355 | Ga0070671_100058419 | Ga0070671_1000584192 | 248 |
| 235 | 3300005364 | Ga0070673_100029311 | Ga0070673_1000293112 | 248 |
| 236 | 3300005436 | Ga0070713_100035908 | Ga0070713_1000359083 | 248 |
| 237 | 3300005458 | Ga0070681_10024902 | Ga0070681_100249025 | 248 |
| 238 | 3300005458 | Ga0070681_10556348 | Ga0070681_105563482 | 248 |
| 239 | 3300005467 | Ga0070706_100433055 | Ga0070706_1004330551 | 248 |
| 240 | 3300005530 | Ga0070679_100017895 | Ga0070679_1000178952 | 248 |
| 241 | 3300005615 | Ga0070702_100081001 | Ga0070702_1000810013 | 248 |
| 242 | 3300006358 | Ga0068871_100063521 | Ga0068871_1000635212 | 248 |
| 243 | 3300006844 | Ga0075428_100051720 | Ga0075428_1000517204 | 248 |
| 244 | 3300006852 | Ga0075433_10069658 | Ga0075433_100696583 | 248 |
| 245 | 3300006881 | Ga0068865_100114059 | Ga0068865_1001140593 | 248 |
| 246 | 3300006914 | Ga0075436_100037247 | Ga0075436_1000372473 | 248 |
| 247 | 3300009093 | Ga0105240_10008739 | Ga0105240_1000873913 | 248 |
| 248 | 3300009094 | Ga0111539_10075466 | Ga0111539_100754664 | 248 |
| 249 | 3300009094 | Ga0111539_10169662 | Ga0111539_101696622 | 248 |
| 250 | 3300009098 | Ga0105245_10093148 | Ga0105245_100931482 | 248 |
| 251 | 3300009147 | Ga0114129_10002846 | Ga0114129_1000284619 | 248 |
| 252 | 3300009148 | Ga0105243_10533500 | Ga0105243_105335002 | 248 |
| 253 | 3300009177 | Ga0105248_10733977 | Ga0105248_107339772 | 248 |
| 254 | 3300011119 | Ga0105246_10109761 | Ga0105246_101097613 | 248 |
| 255 | 3300013308 | Ga0157375_10051227 | Ga0157375_100512274 | 248 |
| 256 | 3300013308 | Ga0157375_10410420 | Ga0157375_104104202 | 248 |
| 257 | 3300014969 | Ga0157376_10187671 | Ga0157376_101876711 | 248 |
| 258 | 3300017792 | Ga0163161_10014823 | Ga0163161_100148233 | 248 |
| 259 | 3300021384 | Ga0213876_10001571 | Ga0213876_1000157114 | 248 |
| 260 | 3300021441 | Ga0213871_10072475 | Ga0213871_100724751 | 248 |
| 261 | 3300025903 | Ga0207680_10024793 | Ga0207680_100247932 | 248 |
| 262 | 3300025910 | Ga0207684_10375075 | Ga0207684_103750752 | 248 |
| 263 | 3300025912 | Ga0207707_10019747 | Ga0207707_100197472 | 248 |
| 264 | 3300025913 | Ga0207695_10027148 | Ga0207695_100271489 | 248 |
| 265 | 3300025914 | Ga0207671_10041096 | Ga0207671_100410962 | 248 |
| 266 | 3300025923 | Ga0207681_10295189 | Ga0207681_102951892 | 248 |
| 267 | 3300025928 | Ga0207700_10054036 | Ga0207700_100540363 | 248 |
| 268 | 3300025931 | Ga0207644_10078344 | Ga0207644_100783442 | 248 |
| 269 | 3300025934 | Ga0207686_10113600 | Ga0207686_101136002 | 248 |
| 270 | 3300025936 | Ga0207670_10575579 | Ga0207670_105755792 | 248 |
| 271 | 3300025940 | Ga0207691_10097612 | Ga0207691_100976123 | 248 |
| 272 | 3300025960 | Ga0207651_10172249 | Ga0207651_101722492 | 248 |
| 273 | 3300025986 | Ga0207658_10442895 | Ga0207658_104428952 | 248 |
| 274 | 3300026023 | Ga0207677_10196345 | Ga0207677_101963452 | 248 |
| 275 | 3300026095 | Ga0207676_10174355 | Ga0207676_101743552 | 248 |
| 276 | 3300026142 | Ga0207698_10526839 | Ga0207698_105268392 | 248 |
| 277 | 3300027671 | Ga0209588_1135890 | Ga0209588_11358901 | 248 |
| 278 | 3300028666 | Ga0265336_10029635 | Ga0265336_100296352 | 248 |
| 279 | 3300031852 | Ga0307410_10247833 | Ga0307410_102478333 | 248 |
| 280 | 3300035111 | Ga0373923_0010301 | Ga0373923_0010301_2113_2859 | 248 |
| 281 | 3300035692 | Ga0373935_0020533 | Ga0373935_0020533_1071_1817 | 248 |
| 282 | 3300035695 | Ga0373927_0030297 | Ga0373927_0030297_2208_2954 | 248 |
| 283 | 3300036401 | Ga0373937_0002247 | Ga0373937_0002247_9128_9874 | 248 |
| 284 | 3300036401 | Ga0373937_0026952 | Ga0373937_0026952_3873_4619 | 248 |
| 285 | 3300037853 | Ga0436364_0917857 | Ga0436364_0917857_937_1683 | 248 |
| 286 | 3300037853 | Ga0436364_1121491 | Ga0436364_1121491_46_792 | 248 |
| 287 | 3300039437 | Ga0436365_0980681 | Ga0436365_0980681_12073_12819 | 248 |
| 288 | 3300039453 | Ga0436362_0010689 | Ga0436362_0010689_433_1182 | 248 |
| 289 | 3300046511 | Ga0495608_0016070 | Ga0495608_0016070_53_799 | 248 |
| 290 | 3300046517 | Ga0495630_0006389 | Ga0495630_0006389_6682_7428 | 248 |
| 291 | 3300046529 | Ga0495652_0049795 | Ga0495652_0049795_2233_2979 | 248 |
| 292 | 3300046559 | Ga0495667_0063289 | Ga0495667_0063289_476_1222 | 248 |
| 293 | 3300046663 | Ga0495635_0008778 | Ga0495635_0008778_1206_1952 | 248 |
| 294 | 3300046663 | Ga0495635_0039748 | Ga0495635_0039748_752_1498 | 248 |
| 295 | 3300046675 | Ga0495657_0002538 | Ga0495657_0002538_5653_6399 | 248 |
| 296 | 3300046678 | Ga0495599_0116796 | Ga0495599_0116796_429_1175 | 248 |
| 297 | 3300046679 | Ga0495623_0001495 | Ga0495623_0001495_15056_15802 | 248 |
| 298 | 3300046689 | Ga0495613_0030875 | Ga0495613_0030875_448_1194 | 248 |
| 299 | 3300046690 | Ga0495624_0002683 | Ga0495624_0002683_10856_11602 | 248 |
| 300 | 3300046809 | Ga0495600_0051736 | Ga0495600_0051736_887_1633 | 248 |
| 301 | 3300047317 | Ga0495604_0001304 | Ga0495604_0001304_15589_16335 | 248 |
| 302 | 3300047322 | Ga0495680_0275651 | Ga0495680_0275651_77_823 | 248 |
| 303 | 3300047471 | Ga0495684_0057858 | Ga0495684_0057858_544_1290 | 248 |
| 304 | 3300047471 | Ga0495684_0253435 | Ga0495684_0253435_326_1072 | 248 |
| 305 | 3300047673 | Ga0495593_0007439 | Ga0495593_0007439_5548_6294 | 248 |
| 306 | 3300048088 | Ga0495602_0029451 | Ga0495602_0029451_4344_5090 | 248 |
| 307 | 3300048904 | Ga0496101_0059169 | Ga0496101_0059169_515_1261 | 248 |
| 308 | 3300048908 | Ga0496105_0107794 | Ga0496105_0107794_1016_1762 | 248 |
| 309 | 3300048912 | Ga0496109_0069828 | Ga0496109_0069828_1107_1853 | 248 |
| 310 | 3300048917 | Ga0496114_0004558 | Ga0496114_0004558_9954_10700 | 248 |
| 311 | 3300048917 | Ga0496114_0071373 | Ga0496114_0071373_1535_2281 | 248 |
| 312 | 3300049580 | Ga0501046_0000007 | Ga0501046_0000007_60813_61583 | 248 |
| 313 | 3300049581 | Ga0501047_0002779 | Ga0501047_0002779_4955_5725 | 248 |
| 314 | 3300049582 | Ga0501048_0005345 | Ga0501048_0005345_574_1344 | 248 |
| 315 | 3300049744 | Ga0501083_0000032 | Ga0501083_0000032_57548_58318 | 248 |
| 316 | 3300049822 | Ga0501035_0028247 | Ga0501035_0028247_2088_2858 | 248 |
| 317 | 3300049823 | Ga0501044_0385959 | Ga0501044_0385959_337_1107 | 248 |
| 318 | 3300049824 | Ga0501045_0183038 | Ga0501045_0183038_759_1529 | 248 |
| 319 | 3300050507 | nmdc:mga05p37_29_c1 | nmdc:mga05p37_29_c1_79534_80280 | 248 |
| 320 | 3300050511 | nmdc:mga08y16_817407_c1 | nmdc:mga08y16_817407_c1_96_845 | 248 |
| 321 | 3300050514 | nmdc:mga08x19_285771_c1 | nmdc:mga08x19_285771_c1_26_772 | 248 |
| 322 | 3300050514 | nmdc:mga08x19_384_c1 | nmdc:mga08x19_384_c1_30275_31021 | 248 |
| 323 | 3300050515 | nmdc:mga0a205_362495_c1 | nmdc:mga0a205_362495_c1_274_1020 | 248 |
| 324 | 3300060353 | Ga0501082_0095547 | Ga0501082_0095547_1122_1892 | 248 |
| 325 | 3300005467 | Ga0070706_100056056 | Ga0070706_1000560562 | 249 |
| 326 | 3300005536 | Ga0070697_100014045 | Ga0070697_1000140456 | 249 |
| 327 | 3300006175 | Ga0070712_100138142 | Ga0070712_1001381423 | 249 |
| 328 | 3300006914 | Ga0075436_100003368 | Ga0075436_10000336810 | 249 |
| 329 | 3300009147 | Ga0114129_10107625 | Ga0114129_101076253 | 249 |
| 330 | 3300013306 | Ga0163162_10619351 | Ga0163162_106193512 | 249 |
| 331 | 3300021388 | Ga0213875_10028127 | Ga0213875_100281273 | 249 |
| 332 | 3300025910 | Ga0207684_10262314 | Ga0207684_102623142 | 249 |
| 333 | 3300025915 | Ga0207693_10190446 | Ga0207693_101904462 | 249 |
| 334 | 3300028563 | Ga0265319_1000004 | Ga0265319_100000414 | 249 |
| 335 | 3300031595 | Ga0265313_10009188 | Ga0265313_100091883 | 249 |
| 336 | 3300035088 | Ga0373940_0051516 | Ga0373940_0051516_243_995 | 249 |
| 337 | 3300035695 | Ga0373927_0001201 | Ga0373927_0001201_10329_11132 | 249 |
| 338 | 3300037853 | Ga0436364_0501893 | Ga0436364_0501893_840_1595 | 249 |
| 339 | 3300042435 | Ga0439434_0053311 | Ga0439434_0053311_264_1016 | 249 |
| 340 | 3300046472 | Ga0495580_0079826 | Ga0495580_0079826_86_889 | 249 |
| 341 | 3300049580 | Ga0501046_0347306 | Ga0501046_0347306_86_835 | 249 |
| 342 | 3300050510 | nmdc:mga06r32_167161_c1 | nmdc:mga06r32_167161_c1_386_1135 | 249 |
| 343 | 3300050514 | nmdc:mga08x19_1980_c1 | nmdc:mga08x19_1980_c1_5046_5849 | 249 |
| 344 | 3300005471 | Ga0070698_100315943 | Ga0070698_1003159432 | 250 |
| 345 | 3300005518 | Ga0070699_100237226 | Ga0070699_1002372263 | 250 |
| 346 | 3300005546 | Ga0070696_100003441 | Ga0070696_1000034414 | 250 |
| 347 | 3300006175 | Ga0070712_100320561 | Ga0070712_1003205612 | 250 |
| 348 | 3300006846 | Ga0075430_100123577 | Ga0075430_1001235772 | 250 |
| 349 | 3300013297 | Ga0157378_10241680 | Ga0157378_102416802 | 250 |
| 350 | 3300013297 | Ga0157378_10922664 | Ga0157378_109226641 | 250 |
| 351 | 3300017792 | Ga0163161_10167405 | Ga0163161_101674052 | 250 |
| 352 | 3300025913 | Ga0207695_10102843 | Ga0207695_101028432 | 250 |
| 353 | 3300025939 | Ga0207665_10055518 | Ga0207665_100555182 | 250 |
| 354 | 3300027907 | Ga0207428_10181076 | Ga0207428_101810762 | 250 |
| 355 | 3300031911 | Ga0307412_10063730 | Ga0307412_100637302 | 250 |
| 356 | 3300032002 | Ga0307416_100024505 | Ga0307416_1000245052 | 250 |
| 357 | 3300035118 | Ga0373954_0005888 | Ga0373954_0005888_3930_4745 | 250 |
| 358 | 3300035119 | Ga0373956_0001960 | Ga0373956_0001960_3807_4622 | 250 |
| 359 | 3300035120 | Ga0373957_0097194 | Ga0373957_0097194_136_981 | 250 |
| 360 | 3300035172 | Ga0373955_0060645 | Ga0373955_0060645_323_1138 | 250 |
| 361 | 3300035695 | Ga0373927_0164434 | Ga0373927_0164434_443_1258 | 250 |
| 362 | 3300035724 | Ga0373933_0009245 | Ga0373933_0009245_3511_4326 | 250 |
| 363 | 3300036401 | Ga0373937_0015906 | Ga0373937_0015906_4371_5186 | 250 |
| 364 | 3300046454 | Ga0495592_0152671 | Ga0495592_0152671_108_872 | 250 |
| 365 | 3300046459 | Ga0495629_0194325 | Ga0495629_0194325_68_832 | 250 |
| 366 | 3300046472 | Ga0495580_0108070 | Ga0495580_0108070_1038_1883 | 250 |
| 367 | 3300046533 | Ga0495640_0136344 | Ga0495640_0136344_395_1159 | 250 |
| 368 | 3300046536 | Ga0495587_0082549 | Ga0495587_0082549_508_1272 | 250 |
| 369 | 3300046559 | Ga0495667_0010652 | Ga0495667_0010652_62_826 | 250 |
| 370 | 3300046678 | Ga0495599_0012658 | Ga0495599_0012658_3959_4723 | 250 |
| 371 | 3300046679 | Ga0495623_0271947 | Ga0495623_0271947_147_911 | 250 |
| 372 | 3300047317 | Ga0495604_0039649 | Ga0495604_0039649_513_1277 | 250 |
| 373 | 3300047322 | Ga0495680_0009874 | Ga0495680_0009874_6103_6867 | 250 |
| 374 | 3300047444 | Ga0495675_0019969 | Ga0495675_0019969_675_1439 | 250 |
| 375 | 3300049577 | Ga0501041_0182574 | Ga0501041_0182574_86_931 | 250 |
| 376 | 3300049578 | Ga0501042_0026072 | Ga0501042_0026072_640_1485 | 250 |
| 377 | 3300049582 | Ga0501048_0047088 | Ga0501048_0047088_1642_2487 | 250 |
| 378 | 3300049592 | Ga0501076_0144807 | Ga0501076_0144807_1064_1864 | 250 |
| 379 | 3300049741 | Ga0501079_0282735 | Ga0501079_0282735_429_1229 | 250 |
| 380 | 3300049743 | Ga0501081_0124794 | Ga0501081_0124794_782_1627 | 250 |
| 381 | 3300049824 | Ga0501045_0035278 | Ga0501045_0035278_210_1055 | 250 |
| 382 | 3300050510 | nmdc:mga06r32_5842_c1 | nmdc:mga06r32_5842_c1_5814_6572 | 250 |
| 383 | 3300050511 | nmdc:mga08y16_178568_c1 | nmdc:mga08y16_178568_c1_981_1733 | 250 |
| 384 | 3300005366 | Ga0070659_100282113 | Ga0070659_1002821131 | 251 |
| 385 | 3300005616 | Ga0068852_100113591 | Ga0068852_1001135913 | 251 |
| 386 | 3300009093 | Ga0105240_10328423 | Ga0105240_103284231 | 251 |
| 387 | 3300025913 | Ga0207695_10652942 | Ga0207695_106529421 | 251 |
| 388 | 3300025917 | Ga0207660_10177324 | Ga0207660_101773242 | 251 |
| 389 | 3300025921 | Ga0207652_10812644 | Ga0207652_108126441 | 251 |
| 390 | 3300025932 | Ga0207690_10192323 | Ga0207690_101923232 | 251 |
| 391 | 3300042156 | Ga0439446_0044601 | Ga0439446_0044601_403_1236 | 252 |
| 392 | 3300005355 | Ga0070671_100373518 | Ga0070671_1003735182 | 253 |
| 393 | 3300025931 | Ga0207644_10020000 | Ga0207644_100200002 | 253 |
| 394 | 3300005518 | Ga0070699_100122772 | Ga0070699_1001227722 | 254 |
| 395 | 3300032002 | Ga0307416_100203742 | Ga0307416_1002037421 | 254 |
| 396 | 3300010375 | Ga0105239_10834002 | Ga0105239_108340021 | 255 |
| 397 | 3300025922 | Ga0207646_10148669 | Ga0207646_101486692 | 255 |
| 398 | 3300031824 | Ga0307413_10009128 | Ga0307413_100091282 | 255 |
| 399 | 3300031852 | Ga0307410_10003284 | Ga0307410_100032845 | 255 |
| 400 | 3300031901 | Ga0307406_10012889 | Ga0307406_100128892 | 255 |
| 401 | 3300031995 | Ga0307409_100226129 | Ga0307409_1002261293 | 255 |
| 402 | 3300032002 | Ga0307416_100034294 | Ga0307416_1000342942 | 255 |
| 403 | 3300032004 | Ga0307414_10092247 | Ga0307414_100922473 | 255 |
| 404 | 3300032005 | Ga0307411_10123284 | Ga0307411_101232842 | 255 |
| 405 | 3300032126 | Ga0307415_100066855 | Ga0307415_1000668552 | 255 |
| 406 | 3300005444 | Ga0070694_100166151 | Ga0070694_1001661512 | 256 |
| 407 | 3300005471 | Ga0070698_100111270 | Ga0070698_1001112702 | 256 |
| 408 | 3300006847 | Ga0075431_100003524 | Ga0075431_1000035242 | 256 |
| 409 | 3300044684 | Ga0466966_0056711 | Ga0466966_0056711_1603_2466 | 256 |
| 410 | 3300050509 | nmdc:mga0qj67_48814_c1 | nmdc:mga0qj67_48814_c1_550_1413 | 256 |
| 411 | 3300037471 | Ga0395905_0652979 | Ga0395905_0652979_47_859 | 257 |
| 412 | 3300013105 | Ga0157369_10443507 | Ga0157369_104435072 | 258 |
| 413 | 3300006173 | Ga0070716_100011673 | Ga0070716_1000116735 | 259 |
| 414 | 3300006914 | Ga0075436_100022284 | Ga0075436_1000222843 | 259 |
| 415 | 3300025898 | Ga0207692_10151740 | Ga0207692_101517402 | 259 |
| 416 | 3300025906 | Ga0207699_10015130 | Ga0207699_100151302 | 259 |
| 417 | 3300025907 | Ga0207645_10208441 | Ga0207645_102084411 | 259 |
| 418 | 3300025939 | Ga0207665_10000353 | Ga0207665_100003537 | 259 |
| 419 | 3300027360 | Ga0209969_1016459 | Ga0209969_10164592 | 259 |
| 420 | 3300027526 | Ga0209968_1001405 | Ga0209968_10014054 | 259 |
| 421 | 3300027543 | Ga0209999_1001616 | Ga0209999_10016162 | 259 |
| 422 | 3300050514 | nmdc:mga08x19_74283_c1 | nmdc:mga08x19_74283_c1_797_1675 | 259 |
| 423 | 3300005458 | Ga0070681_10000857 | Ga0070681_1000085724 | 260 |
| 424 | 3300005530 | Ga0070679_100007892 | Ga0070679_1000078927 | 260 |
| 425 | 3300005549 | Ga0070704_100235221 | Ga0070704_1002352211 | 260 |
| 426 | 3300005563 | Ga0068855_100253672 | Ga0068855_1002536723 | 260 |
| 427 | 3300005614 | Ga0068856_100269024 | Ga0068856_1002690242 | 260 |
| 428 | 3300009093 | Ga0105240_10014013 | Ga0105240_100140133 | 260 |
| 429 | 3300013100 | Ga0157373_10150025 | Ga0157373_101500251 | 260 |
| 430 | 3300013104 | Ga0157370_10006717 | Ga0157370_100067175 | 260 |
| 431 | 3300013105 | Ga0157369_10033617 | Ga0157369_100336173 | 260 |
| 432 | 3300013307 | Ga0157372_10011796 | Ga0157372_100117964 | 260 |
| 433 | 3300025909 | Ga0207705_10020682 | Ga0207705_100206824 | 260 |
| 434 | 3300025912 | Ga0207707_10000988 | Ga0207707_100009887 | 260 |
| 435 | 3300025921 | Ga0207652_10005896 | Ga0207652_100058968 | 260 |
| 436 | 3300025932 | Ga0207690_10013583 | Ga0207690_100135832 | 260 |
| 437 | 3300026078 | Ga0207702_10207962 | Ga0207702_102079622 | 260 |
| 438 | 3300050514 | nmdc:mga08x19_57610_c1 | nmdc:mga08x19_57610_c1_64_882 | 260 |
| 439 | 3300005436 | Ga0070713_100083974 | Ga0070713_1000839742 | 261 |
| 440 | 3300005445 | Ga0070708_100000150 | Ga0070708_10000015044 | 261 |
| 441 | 3300005467 | Ga0070706_100491534 | Ga0070706_1004915342 | 261 |
| 442 | 3300005468 | Ga0070707_100054158 | Ga0070707_1000541584 | 261 |
| 443 | 3300005536 | Ga0070697_100186023 | Ga0070697_1001860231 | 261 |
| 444 | 3300005563 | Ga0068855_100012943 | Ga0068855_1000129438 | 261 |
| 445 | 3300009174 | Ga0105241_10070001 | Ga0105241_100700013 | 261 |
| 446 | 3300013100 | Ga0157373_10025551 | Ga0157373_100255512 | 261 |
| 447 | 3300013104 | Ga0157370_10080409 | Ga0157370_100804092 | 261 |
| 448 | 3300013105 | Ga0157369_10056684 | Ga0157369_100566845 | 261 |
| 449 | 3300025906 | Ga0207699_10297747 | Ga0207699_102977472 | 261 |
| 450 | 3300025910 | Ga0207684_10326243 | Ga0207684_103262431 | 261 |
| 451 | 3300025913 | Ga0207695_10004228 | Ga0207695_1000422812 | 261 |
| 452 | 3300025922 | Ga0207646_10215295 | Ga0207646_102152951 | 261 |
| 453 | 3300025944 | Ga0207661_10232053 | Ga0207661_102320532 | 261 |
| 454 | 3300026078 | Ga0207702_10122128 | Ga0207702_101221283 | 261 |
| 455 | 3300027526 | Ga0209968_1009733 | Ga0209968_10097332 | 261 |
| 456 | 3300027695 | Ga0209966_1005202 | Ga0209966_10052022 | 261 |
| 457 | 3300027717 | Ga0209998_10002325 | Ga0209998_100023254 | 261 |
| 458 | 3300031731 | Ga0307405_10201092 | Ga0307405_102010922 | 261 |
| 459 | 3300031824 | Ga0307413_10199943 | Ga0307413_101999432 | 261 |
| 460 | 3300031852 | Ga0307410_10088625 | Ga0307410_100886253 | 261 |
| 461 | 3300031852 | Ga0307410_10156285 | Ga0307410_101562852 | 261 |
| 462 | 3300031852 | Ga0307410_10177177 | Ga0307410_101771772 | 261 |
| 463 | 3300031852 | Ga0307410_10240955 | Ga0307410_102409552 | 261 |
| 464 | 3300031901 | Ga0307406_10034267 | Ga0307406_100342673 | 261 |
| 465 | 3300031901 | Ga0307406_10099979 | Ga0307406_100999792 | 261 |
| 466 | 3300031995 | Ga0307409_100013872 | Ga0307409_1000138724 | 261 |
| 467 | 3300031995 | Ga0307409_100734613 | Ga0307409_1007346131 | 261 |
| 468 | 3300032002 | Ga0307416_100018075 | Ga0307416_1000180752 | 261 |
| 469 | 3300032002 | Ga0307416_100074539 | Ga0307416_1000745393 | 261 |
| 470 | 3300032004 | Ga0307414_10122832 | Ga0307414_101228322 | 261 |
| 471 | 3300032004 | Ga0307414_10396110 | Ga0307414_103961102 | 261 |
| 472 | 3300032126 | Ga0307415_100203956 | Ga0307415_1002039562 | 261 |
| 473 | 3300035170 | Ga0373943_0008709 | Ga0373943_0008709_1576_2409 | 261 |
| 474 | 3300036401 | Ga0373937_0002168 | Ga0373937_0002168_9042_9875 | 261 |
| 475 | 3300046472 | Ga0495580_0018051 | Ga0495580_0018051_3083_3916 | 261 |
| 476 | 3300046475 | Ga0495639_0029958 | Ga0495639_0029958_317_1150 | 261 |
| 477 | 3300046499 | Ga0495594_0008475 | Ga0495594_0008475_2782_3615 | 261 |
| 478 | 3300046499 | Ga0495594_0264769 | Ga0495594_0264769_134_967 | 261 |
| 479 | 3300046535 | Ga0495586_0017163 | Ga0495586_0017163_874_1707 | 261 |
| 480 | 3300046536 | Ga0495587_0000482 | Ga0495587_0000482_23305_24138 | 261 |
| 481 | 3300046543 | Ga0495645_0000281 | Ga0495645_0000281_34937_35770 | 261 |
| 482 | 3300046679 | Ga0495623_0062236 | Ga0495623_0062236_719_1552 | 261 |
| 483 | 3300046809 | Ga0495600_0014660 | Ga0495600_0014660_3247_4080 | 261 |
| 484 | 3300049652 | Ga0501202_002164 | Ga0501202_002164_1803_2633 | 261 |
| 485 | 3300049660 | Ga0501216_001839 | Ga0501216_001839_1834_2664 | 261 |
| 486 | 3300049661 | Ga0501217_008724 | Ga0501217_008724_228_1058 | 261 |
| 487 | 3300049667 | Ga0501230_014762 | Ga0501230_014762_262_1092 | 261 |
| 488 | 3300049668 | Ga0501233_015316 | Ga0501233_015316_618_1448 | 261 |
| 489 | 3300049669 | Ga0501235_001140 | Ga0501235_001140_1202_2032 | 261 |
| 490 | 3300049679 | Ga0501249_003903 | Ga0501249_003903_1229_2059 | 261 |
| 491 | 3300049681 | Ga0501251_011038 | Ga0501251_011038_122_952 | 261 |
| 492 | 3300049682 | Ga0501252_006973 | Ga0501252_006973_220_1050 | 261 |
| 493 | 3300049688 | Ga0501259_010116 | Ga0501259_010116_120_950 | 261 |
| 494 | 3300049704 | Ga0501221_004359 | Ga0501221_004359_972_1802 | 261 |
| 495 | 3300049705 | Ga0501225_0002931 | Ga0501225_0002931_4300_5130 | 261 |
| 496 | 3300049707 | Ga0501234_003567 | Ga0501234_003567_856_1686 | 261 |
| 497 | 3300049765 | Ga0501268_007645 | Ga0501268_007645_120_950 | 261 |
| 498 | 3300049851 | Ga0501212_006197 | Ga0501212_006197_190_1020 | 261 |
| 499 | 3300003203 | JGI25406J46586_10017229 | JGI25406J46586_100172292 | 262 |
| 500 | 3300005295 | Ga0065707_10105631 | Ga0065707_101056312 | 262 |
| 501 | 3300005327 | Ga0070658_10194464 | Ga0070658_101944642 | 262 |
| 502 | 3300005329 | Ga0070683_100382569 | Ga0070683_1003825692 | 262 |
| 503 | 3300005336 | Ga0070680_100125505 | Ga0070680_1001255052 | 262 |
| 504 | 3300005336 | Ga0070680_100136895 | Ga0070680_1001368953 | 262 |
| 505 | 3300005337 | Ga0070682_100000710 | Ga0070682_10000071021 | 262 |
| 506 | 3300005337 | Ga0070682_100002480 | Ga0070682_1000024805 | 262 |
| 507 | 3300005337 | Ga0070682_100081945 | Ga0070682_1000819453 | 262 |
| 508 | 3300005338 | Ga0068868_100020746 | Ga0068868_1000207462 | 262 |
| 509 | 3300005339 | Ga0070660_100292614 | Ga0070660_1002926142 | 262 |
| 510 | 3300005343 | Ga0070687_100004175 | Ga0070687_1000041752 | 262 |
| 511 | 3300005345 | Ga0070692_10022170 | Ga0070692_100221703 | 262 |
| 512 | 3300005353 | Ga0070669_100003973 | Ga0070669_1000039733 | 262 |
| 513 | 3300005356 | Ga0070674_100010992 | Ga0070674_1000109923 | 262 |
| 514 | 3300005356 | Ga0070674_100034310 | Ga0070674_1000343102 | 262 |
| 515 | 3300005364 | Ga0070673_100036426 | Ga0070673_1000364262 | 262 |
| 516 | 3300005445 | Ga0070708_100000271 | Ga0070708_10000027128 | 262 |
| 517 | 3300005456 | Ga0070678_100107527 | Ga0070678_1001075272 | 262 |
| 518 | 3300005457 | Ga0070662_100013849 | Ga0070662_1000138496 | 262 |
| 519 | 3300005458 | Ga0070681_10002590 | Ga0070681_100025908 | 262 |
| 520 | 3300005458 | Ga0070681_10018811 | Ga0070681_100188118 | 262 |
| 521 | 3300005458 | Ga0070681_10114175 | Ga0070681_101141752 | 262 |
| 522 | 3300005458 | Ga0070681_10153883 | Ga0070681_101538833 | 262 |
| 523 | 3300005458 | Ga0070681_10179506 | Ga0070681_101795062 | 262 |
| 524 | 3300005459 | Ga0068867_100044511 | Ga0068867_1000445113 | 262 |
| 525 | 3300005459 | Ga0068867_100088174 | Ga0068867_1000881742 | 262 |
| 526 | 3300005459 | Ga0068867_100099888 | Ga0068867_1000998883 | 262 |
| 527 | 3300005468 | Ga0070707_100001174 | Ga0070707_10000117420 | 262 |
| 528 | 3300005518 | Ga0070699_100078038 | Ga0070699_1000780382 | 262 |
| 529 | 3300005530 | Ga0070679_100015761 | Ga0070679_1000157615 | 262 |
| 530 | 3300005530 | Ga0070679_100035556 | Ga0070679_1000355562 | 262 |
| 531 | 3300005535 | Ga0070684_100003277 | Ga0070684_10000327714 | 262 |
| 532 | 3300005535 | Ga0070684_100031153 | Ga0070684_1000311533 | 262 |
| 533 | 3300005536 | Ga0070697_100063258 | Ga0070697_1000632583 | 262 |
| 534 | 3300005539 | Ga0068853_100040406 | Ga0068853_1000404062 | 262 |
| 535 | 3300005545 | Ga0070695_100004909 | Ga0070695_1000049094 | 262 |
| 536 | 3300005545 | Ga0070695_100118354 | Ga0070695_1001183542 | 262 |
| 537 | 3300005546 | Ga0070696_100023539 | Ga0070696_1000235394 | 262 |
| 538 | 3300005547 | Ga0070693_100040926 | Ga0070693_1000409263 | 262 |
| 539 | 3300005547 | Ga0070693_100076263 | Ga0070693_1000762632 | 262 |
| 540 | 3300005547 | Ga0070693_100096984 | Ga0070693_1000969841 | 262 |
| 541 | 3300005563 | Ga0068855_100000575 | Ga0068855_10000057536 | 262 |
| 542 | 3300005563 | Ga0068855_100507749 | Ga0068855_1005077492 | 262 |
| 543 | 3300005578 | Ga0068854_100066028 | Ga0068854_1000660283 | 262 |
| 544 | 3300005614 | Ga0068856_100103255 | Ga0068856_1001032552 | 262 |
| 545 | 3300005718 | Ga0068866_10010943 | Ga0068866_100109432 | 262 |
| 546 | 3300005985 | Ga0081539_10000091 | Ga0081539_10000091148 | 262 |
| 547 | 3300006852 | Ga0075433_10060876 | Ga0075433_100608762 | 262 |
| 548 | 3300006871 | Ga0075434_100007650 | Ga0075434_1000076507 | 262 |
| 549 | 3300006914 | Ga0075436_100039972 | Ga0075436_1000399723 | 262 |
| 550 | 3300009093 | Ga0105240_10244731 | Ga0105240_102447312 | 262 |
| 551 | 3300009147 | Ga0114129_10027932 | Ga0114129_100279322 | 262 |
| 552 | 3300013100 | Ga0157373_10117117 | Ga0157373_101171173 | 262 |
| 553 | 3300013105 | Ga0157369_10043043 | Ga0157369_100430434 | 262 |
| 554 | 3300013105 | Ga0157369_10554746 | Ga0157369_105547462 | 262 |
| 555 | 3300013296 | Ga0157374_10368430 | Ga0157374_103684301 | 262 |
| 556 | 3300013297 | Ga0157378_10007378 | Ga0157378_1000737810 | 262 |
| 557 | 3300013297 | Ga0157378_10024734 | Ga0157378_100247342 | 262 |
| 558 | 3300013307 | Ga0157372_10012338 | Ga0157372_100123382 | 262 |
| 559 | 3300013307 | Ga0157372_10378680 | Ga0157372_103786802 | 262 |
| 560 | 3300025899 | Ga0207642_10013605 | Ga0207642_100136052 | 262 |
| 561 | 3300025909 | Ga0207705_10018139 | Ga0207705_100181393 | 262 |
| 562 | 3300025909 | Ga0207705_10136625 | Ga0207705_101366252 | 262 |
| 563 | 3300025912 | Ga0207707_10001924 | Ga0207707_100019245 | 262 |
| 564 | 3300025912 | Ga0207707_10005051 | Ga0207707_100050514 | 262 |
| 565 | 3300025912 | Ga0207707_10121967 | Ga0207707_101219672 | 262 |
| 566 | 3300025912 | Ga0207707_10175904 | Ga0207707_101759042 | 262 |
| 567 | 3300025917 | Ga0207660_10032323 | Ga0207660_100323232 | 262 |
| 568 | 3300025917 | Ga0207660_10043414 | Ga0207660_100434143 | 262 |
| 569 | 3300025917 | Ga0207660_10106663 | Ga0207660_101066632 | 262 |
| 570 | 3300025918 | Ga0207662_10010864 | Ga0207662_100108642 | 262 |
| 571 | 3300025920 | Ga0207649_10090584 | Ga0207649_100905842 | 262 |
| 572 | 3300025921 | Ga0207652_10026167 | Ga0207652_100261674 | 262 |
| 573 | 3300025921 | Ga0207652_10248762 | Ga0207652_102487622 | 262 |
| 574 | 3300025922 | Ga0207646_10002046 | Ga0207646_100020461 | 262 |
| 575 | 3300025932 | Ga0207690_10198248 | Ga0207690_101982482 | 262 |
| 576 | 3300025933 | Ga0207706_10033383 | Ga0207706_100333832 | 262 |
| 577 | 3300025937 | Ga0207669_10010153 | Ga0207669_100101533 | 262 |
| 578 | 3300025937 | Ga0207669_10180170 | Ga0207669_101801702 | 262 |
| 579 | 3300025944 | Ga0207661_10000775 | Ga0207661_1000077521 | 262 |
| 580 | 3300025949 | Ga0207667_10027040 | Ga0207667_100270404 | 262 |
| 581 | 3300025949 | Ga0207667_10254877 | Ga0207667_102548773 | 262 |
| 582 | 3300025981 | Ga0207640_10137328 | Ga0207640_101373283 | 262 |
| 583 | 3300026067 | Ga0207678_10017222 | Ga0207678_100172226 | 262 |
| 584 | 3300026067 | Ga0207678_10347988 | Ga0207678_103479882 | 262 |
| 585 | 3300026075 | Ga0207708_10023395 | Ga0207708_100233955 | 262 |
| 586 | 3300026089 | Ga0207648_10007202 | Ga0207648_100072023 | 262 |
| 587 | 3300026089 | Ga0207648_10054948 | Ga0207648_100549483 | 262 |
| 588 | 3300026121 | Ga0207683_10016563 | Ga0207683_100165633 | 262 |
| 589 | 3300034820 | Ga0373959_0008725 | Ga0373959_0008725_528_1403 | 262 |
| 590 | 3300035112 | Ga0373932_0041022 | Ga0373932_0041022_413_1288 | 262 |
| 591 | 3300035207 | Ga0373942_0046770 | Ga0373942_0046770_185_1060 | 262 |
| 592 | 3300037471 | Ga0395905_0027078 | Ga0395905_0027078_2970_3815 | 262 |
| 593 | 3300048915 | Ga0496112_0025175 | Ga0496112_0025175_3745_4620 | 262 |
| 594 | 3300048915 | Ga0496112_0336874 | Ga0496112_0336874_424_1290 | 262 |
| 595 | 3300050507 | nmdc:mga05p37_96891_c1 | nmdc:mga05p37_96891_c1_1497_2414 | 262 |
| 596 | 3300050515 | nmdc:mga0a205_63829_c1 | nmdc:mga0a205_63829_c1_1091_1966 | 262 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7d6x-assembly1.cif.gz_B | mycobacterium smegmatis sdh1 complex in the apo form | 0.821 | 13 | 249 |
| 7d6x-assembly1.cif.gz_B | mycobacterium smegmatis sdh1 complex in the apo form | 0.8119 | 13 | 249 |
| 2wp9-assembly3.cif.gz_J | crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant | 0.789 | 14 | 245 |
| 2acz-assembly1.cif.gz_B | complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site | 0.7876 | 14 | 245 |
| 2bs3-assembly1.cif.gz_B | glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes | 0.7838 | 12 | 242 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53669_2_103_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9122 | 15 | 114 | 3.10.20.30 |
| af_O53669_2_103_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8866 | 15 | 114 | 3.10.20.30 |
| 4kx6N01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8569 | 12 | 114 | 3.10.20.30 |
| 5xmjN01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8506 | 12 | 114 | 3.10.20.30 |
| 2wdqB01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8466 | 14 | 114 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6KMR1-F1-model_v4 | Succinate dehydrogenase/fumarate reductase iron-sulfur subunit | 0.9266 | 14 | 116 |
GO:0005886
GO:0009055 GO:0009060 GO:0022904 GO:0051537 |
| AF-A0A7K1CVH8-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.9138 | 15 | 110 |
GO:0005886
GO:0009055 GO:0009060 GO:0022904 GO:0051537 |
| AF-A0A2V9PP48-F1-model_v4 | Succinate dehydrogenase/fumarate reductase iron-sulfur subunit | 0.9106 | 14 | 102 |
GO:0005886
GO:0009055 GO:0009060 GO:0022904 GO:0051537 |
| AF-A0A2V6KMR1-F1-model_v4 | Succinate dehydrogenase/fumarate reductase iron-sulfur subunit | 0.9094 | 14 | 116 |
GO:0005886
GO:0009055 GO:0009060 GO:0022904 GO:0051537 |
| AF-A0A7V9V5B9-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.8999 | 14 | 126 |
GO:0005886
GO:0009055 GO:0009060 GO:0022904 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar